F363431

General Info

Members Datasets Scaffolds Average Seq Length
252 162 504 172

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0135815|Ga0451577_0135815_1051_1584
Length 177
Sequence LEEVVVMEELKHIIRDIPDFPKQGIIFKDITTLLADAKSYQRMIDLLAHRYIGQKIEKVVGVEARGFIIGAALAYKLGAGIVLVRKPGKLPAKTFKKSYALEYGTDTLEIHTDAIKQGEKILIADDLLATGGTMAAVVDMVSSMGGEIVECCFMAELEFLNGKDKLPVDKVYSLLKF

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
121 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 0.4
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0135815 3300042876 Bacteria 2209
2 Ga0065707_10498019 3300005295 Bacteria 751
3 Ga0070676_10023165 3300005328 Bacteria 3488
4 Ga0070690_100061165 3300005330 Bacteria 2425
5 Ga0070670_100298520 3300005331 Bacteria 1409
6 Ga0070677_10232935 3300005333 Bacteria 906
7 Ga0068869_100006396 3300005334 Bacteria 7470
8 Ga0070666_10001737 3300005335 Bacteria 13286
9 Ga0070680_100058174 3300005336 Unclassified 3161
10 Ga0070682_100100237 3300005337 Bacteria 1911
11 Ga0068868_100012854 3300005338 Bacteria 6124
12 Ga0068868_100052837 3300005338 Bacteria 3199
13 Ga0070689_100278286 3300005340 Bacteria 1387
14 Ga0070689_100889308 3300005340 Bacteria 787
15 Ga0070669_100000066 3300005353 Bacteria 105449
16 Ga0070669_100025142 3300005353 Bacteria 4275
17 Ga0070675_100108317 3300005354 Bacteria 2346
18 Ga0070675_100849418 3300005354 Bacteria 835
19 Ga0070671_100049641 3300005355 Bacteria 3491
20 Ga0070673_100205918 3300005364 Bacteria 1696
21 Ga0070667_100033462 3300005367 Bacteria 4297
22 Ga0070703_10003267 3300005406 Bacteria 4624
23 Ga0070709_10652350 3300005434 Bacteria 815
24 Ga0070710_10004064 3300005437 Bacteria 6946
25 Ga0070705_100035243 3300005440 Bacteria 2804
26 Ga0070700_100014291 3300005441 Bacteria 4479
27 Ga0070708_100006004 3300005445 Bacteria 9651
28 Ga0070663_100036081 3300005455 Bacteria 3434
29 Ga0070663_100141082 3300005455 Bacteria 1840
30 Ga0070662_100027195 3300005457 Bacteria 3968
31 Ga0070662_100199036 3300005457 Unclassified 1588
32 Ga0070681_10022760 3300005458 Bacteria 6297
33 Ga0070685_10037706 3300005466 Bacteria 2739
34 Ga0070706_100001501 3300005467 Bacteria 24501
35 Ga0070706_100563971 3300005467 Bacteria 1059
36 Ga0070707_100197668 3300005468 Bacteria 1960
37 Ga0070707_100284634 3300005468 Bacteria 1606
38 Ga0070698_100040148 3300005471 Bacteria 4812
39 Ga0070699_100000126 3300005518 Bacteria 70354
40 Ga0070679_100178008 3300005530 Bacteria 2099
41 Ga0070679_100197164 3300005530 Bacteria 1980
42 Ga0070697_100027850 3300005536 Bacteria 4523
43 Ga0070672_100091291 3300005543 Bacteria 2457
44 Ga0070686_100047198 3300005544 Bacteria 2722
45 Ga0070686_100182406 3300005544 Bacteria 1492
46 Ga0070665_100077352 3300005548 Bacteria 3334
47 Ga0070665_100321340 3300005548 Bacteria 1552
48 Ga0068855_100413708 3300005563 Bacteria 1476
49 Ga0068855_100773505 3300005563 Bacteria 1022
50 Ga0070664_100002640 3300005564 Bacteria 14461
51 Ga0068857_100188735 3300005577 Bacteria 1877
52 Ga0068856_100255065 3300005614 Bacteria 1769
53 Ga0068859_100181700 3300005617 Bacteria 2186
54 Ga0068859_100294345 3300005617 Bacteria 1716
55 Ga0068859_100932499 3300005617 Bacteria 952
56 Ga0068870_10014374 3300005840 Bacteria 3737
57 Ga0068863_100001053 3300005841 Bacteria 27573
58 Ga0068858_100141364 3300005842 Bacteria 2260
59 Ga0068858_100481154 3300005842 Bacteria 1198
60 Ga0068858_100531589 3300005842 Bacteria 1137
61 Ga0081455_10042088 3300005937 Bacteria 4010
62 Ga0070717_10000031 3300006028 Bacteria 139394
63 Ga0075364_10107816 3300006051 Bacteria 1857
64 Ga0070712_101093036 3300006175 Bacteria 692
65 Ga0097621_100479409 3300006237 Bacteria 1124
66 Ga0068871_100178814 3300006358 Bacteria 1822
67 Ga0075430_100154012 3300006846 Unclassified 1914
68 Ga0075431_100194962 3300006847 Bacteria 2074
69 Ga0075433_10016621 3300006852 Bacteria 6071
70 Ga0075433_10027142 3300006852 Bacteria 4854
71 Ga0075434_100323567 3300006871 Bacteria 1562
72 Ga0075434_100466340 3300006871 Bacteria 1284
73 Ga0075429_100181501 3300006880 Bacteria 1844
74 Ga0075429_100516755 3300006880 Bacteria 1046
75 Ga0075436_100018395 3300006914 Bacteria 4784
76 Ga0075436_100101596 3300006914 Bacteria 2003
77 Ga0097620_100181706 3300006931 Bacteria 2186
78 Ga0097620_100294345 3300006931 Bacteria 1716
79 Ga0097620_100932534 3300006931 Bacteria 952
80 Ga0075435_100076657 3300007076 Bacteria 2740
81 Ga0099794_10280043 3300007265 Bacteria 862
82 Ga0111539_10055510 3300009094 Bacteria 4709
83 Ga0114129_10994353 3300009147 Bacteria 1057
84 Ga0105248_10028193 3300009177 Bacteria 6253
85 Ga0105248_10156368 3300009177 Bacteria 2573
86 Ga0105249_10210397 3300009553 Bacteria 1908
87 Ga0105239_10988023 3300010375 Bacteria 967
88 Ga0105246_10009550 3300011119 Bacteria 5978
89 Ga0157342_1009746 3300012507 Bacteria 971
90 Ga0157370_10330980 3300013104 Bacteria 1404
91 Ga0157378_10126412 3300013297 Bacteria 2362
92 Ga0157375_10029862 3300013308 Bacteria 5132
93 Ga0163163_10108974 3300014325 Bacteria 2797
94 Ga0157380_10020013 3300014326 Bacteria 4996
95 Ga0157377_10132491 3300014745 Unclassified 1524
96 Ga0157379_10015243 3300014968 Bacteria 6742
97 Ga0163161_10002588 3300017792 Bacteria 12900
98 Ga0213874_10179512 3300021377 Unclassified 753
99 Ga0213875_10000531 3300021388 Bacteria 31479
100 Ga0213875_10002973 3300021388 Bacteria 9876
101 Ga0213875_10023472 3300021388 Bacteria 2946
102 Ga0213875_10032507 3300021388 Bacteria 2466
103 Ga0207697_10000746 3300025315 Bacteria 18410
104 Ga0207692_10044706 3300025898 Bacteria 2212
105 Ga0207688_10001112 3300025901 Bacteria 13804
106 Ga0207680_10027862 3300025903 Bacteria 3153
107 Ga0207645_10004305 3300025907 Bacteria 10561
108 Ga0207643_10592573 3300025908 Unclassified 713
109 Ga0207684_10000035 3300025910 Bacteria 289353
110 Ga0207684_10510759 3300025910 Bacteria 1030
111 Ga0207707_10278936 3300025912 Bacteria 1448
112 Ga0207707_10291610 3300025912 Bacteria 1411
113 Ga0207660_10080520 3300025917 Bacteria 2392
114 Ga0207662_10036156 3300025918 Bacteria 2885
115 Ga0207652_10099050 3300025921 Bacteria 2572
116 Ga0207652_10223960 3300025921 Bacteria 1695
117 Ga0207646_10033120 3300025922 Bacteria 4675
118 Ga0207646_10158236 3300025922 Bacteria 2044
119 Ga0207681_10000007 3300025923 Bacteria 483669
120 Ga0207681_10033950 3300025923 Bacteria 3350
121 Ga0207681_10110043 3300025923 Bacteria 2002
122 Ga0207650_10273014 3300025925 Bacteria 1374
123 Ga0207659_10077675 3300025926 Bacteria 2444
124 Ga0207659_10142066 3300025926 Bacteria 1865
125 Ga0207659_10775521 3300025926 Bacteria 823
126 Ga0207664_10078780 3300025929 Bacteria 2673
127 Ga0207644_10037979 3300025931 Bacteria 3390
128 Ga0207706_10143827 3300025933 Bacteria 2098
129 Ga0207706_10214544 3300025933 Bacteria 1686
130 Ga0207670_10103412 3300025936 Bacteria 2038
131 Ga0207670_10549360 3300025936 Unclassified 943
132 Ga0207691_10189500 3300025940 Unclassified 1794
133 Ga0207711_10087772 3300025941 Bacteria 2729
134 Ga0207679_10010302 3300025945 Bacteria 6016
135 Ga0207712_10321063 3300025961 Bacteria 1278
136 Ga0207658_10100725 3300025986 Unclassified 2262
137 Ga0207658_10252940 3300025986 Bacteria 1498
138 Ga0207677_10079941 3300026023 Bacteria 2340
139 Ga0207678_10013783 3300026067 Bacteria 7103
140 Ga0207678_10057297 3300026067 Bacteria 3353
141 Ga0207708_10025582 3300026075 Bacteria 4467
142 Ga0207702_10248690 3300026078 Unclassified 1669
143 Ga0207641_10105904 3300026088 Bacteria 2484
144 Ga0207676_10199590 3300026095 Bacteria 1766
145 Ga0207674_10080200 3300026116 Bacteria 3267
146 Ga0207683_10008137 3300026121 Bacteria 8969
147 Ga0207698_10034320 3300026142 Bacteria 3697
148 Ga0209971_1070571 3300027682 Bacteria 848
149 Ga0207428_10007531 3300027907 Bacteria 9921
150 Ga0268266_10253023 3300028379 Bacteria 1630
151 Ga0268266_10534238 3300028379 Bacteria 1122
152 Ga0268265_10038514 3300028380 Bacteria 3517
153 Ga0307511_10011166 3300030521 Bacteria 8862
154 Ga0265770_1011352 3300030878 Unclassified 1306
155 Ga0265316_10184974 3300031344 Bacteria 1550
156 Ga0307408_100685906 3300031548 Bacteria 919
157 Ga0265342_10023363 3300031712 Bacteria 3915
158 Ga0307405_10607770 3300031731 Bacteria 893
159 Ga0373928_0001148 3300035084 Bacteria 5255
160 Ga0373940_0037775 3300035088 Bacteria 1316
161 Ga0373932_0029966 3300035112 Bacteria 1505
162 Ga0373937_0002463 3300036401 Bacteria 15387
163 Ga0373937_0617566 3300036401 Bacteria 1029
164 Ga0373925_0397947 3300037068 Bacteria 1123
165 Ga0395900_0633838 3300037418 Bacteria 1007
166 Ga0436364_0090066 3300037853 Unclassified 1548
167 Ga0436364_0199039 3300037853 Bacteria 2462
168 Ga0436364_0359175 3300037853 Bacteria 1385
169 Ga0436364_0362340 3300037853 Bacteria 1082
170 Ga0436364_0396555 3300037853 Bacteria 14391
171 Ga0436364_0768332 3300037853 Bacteria 697
172 Ga0436364_1105375 3300037853 Bacteria 139847
173 Ga0436364_1244791 3300037853 Unclassified 1150
174 Ga0436364_1536279 3300037853 Bacteria 15239
175 Ga0436365_0460023 3300039437 Bacteria 965
176 Ga0436365_0884007 3300039437 Bacteria 1283
177 Ga0436365_1034592 3300039437 Bacteria 1392
178 Ga0436360_0338891 3300039438 Bacteria 921
179 Ga0436360_0643445 3300039438 Bacteria 974
180 Ga0436361_0434431 3300039447 Bacteria 90700
181 Ga0436361_0635658 3300039447 Bacteria 2358
182 Ga0436363_0012240 3300039450 Bacteria 637
183 Ga0436363_0258355 3300039450 Unclassified 1368
184 Ga0436363_0646403 3300039450 Bacteria 607
185 Ga0436362_0183871 3300039453 Unclassified 772
186 Ga0450890_033292 3300042127 Unclassified 740
187 Ga0451577_0000035 3300042876 Bacteria 373467
188 Ga0451577_0001846 3300042876 Bacteria 27006
189 Ga0451577_0176084 3300042876 Bacteria 1928
190 Ga0451577_0391863 3300042876 Bacteria 1261
191 Ga0451577_1141185 3300042876 Bacteria 696
192 Ga0453683_0000028 3300044673 Bacteria 247877
193 Ga0453683_0000125 3300044673 Bacteria 114233
194 Ga0453683_0000420 3300044673 Bacteria 49260
195 Ga0453683_0001702 3300044673 Bacteria 18306
196 Ga0453683_0013046 3300044673 Bacteria 5433
197 Ga0453683_0015954 3300044673 Bacteria 4854
198 Ga0453683_0383821 3300044673 Unclassified 904
199 Ga0466961_0184192 3300044693 Unclassified 1296
200 Ga0453684_0000097 3300044712 Bacteria 377772
201 Ga0453684_0004528 3300044712 Bacteria 29161
202 Ga0453684_0004714 3300044712 Bacteria 28208
203 Ga0453684_0012581 3300044712 Bacteria 13925
204 Ga0453684_0012785 3300044712 Bacteria 13769
205 Ga0453684_0018763 3300044712 Bacteria 10588
206 Ga0453684_0018881 3300044712 Bacteria 10547
207 Ga0453684_0020888 3300044712 Bacteria 9827
208 Ga0453684_0024637 3300044712 Bacteria 8780
209 Ga0453684_0183297 3300044712 Bacteria 2456
210 Ga0453684_0184731 3300044712 Bacteria 2445
211 Ga0453684_0202652 3300044712 Bacteria 2312
212 Ga0453684_0529601 3300044712 Bacteria 1300
213 Ga0453684_0546195 3300044712 Bacteria 1277
214 Ga0466960_0524172 3300044901 Unclassified 696
215 Ga0466959_0106444 3300045049 Bacteria 2005
216 Ga0451576_0000316 3300045051 Bacteria 116978
217 Ga0451576_0019304 3300045051 Bacteria 7441
218 Ga0451576_0221122 3300045051 Bacteria 1977
219 Ga0451576_0300065 3300045051 Bacteria 1680
220 Ga0451576_0509987 3300045051 Bacteria 1264
221 Ga0451576_1073043 3300045051 Bacteria 843
222 Ga0451576_1081060 3300045051 Bacteria 840
223 Ga0451576_1101059 3300045051 Bacteria 831
224 Ga0451576_1234154 3300045051 Bacteria 780
225 Ga0451576_1785261 3300045051 Unclassified 636
226 Ga0466958_0238380 3300045836 Bacteria 1162
227 Ga0466958_0314758 3300045836 Unclassified 1006
228 Ga0495592_0454318 3300046454 Bacteria 802
229 Ga0495634_0086048 3300046642 Bacteria 2048
230 Ga0495657_0697444 3300046675 Bacteria 584
231 Ga0495674_0766015 3300047319 Bacteria 753
232 Ga0495684_0475942 3300047471 Bacteria 863
233 Ga0496110_0024359 3300048913 Bacteria 5158
234 Ga0496126_0076412 3300048929 Bacteria 2971
235 Ga0501033_0464504 3300049570 Bacteria 878
236 Ga0501037_0719938 3300049573 Bacteria 663
237 Ga0501047_0368149 3300049581 Bacteria 1272
238 Ga0501067_0229344 3300049583 Bacteria 1034
239 Ga0501073_0908779 3300049589 Bacteria 606
240 Ga0501044_0017384 3300049823 Bacteria 7715
241 nmdc:mga00v17_95250_c1 3300050491 Bacteria 1873
242 nmdc:mga05p37_762402_c1 3300050507 Bacteria 1065
243 nmdc:mga09592_108242_c1 3300050508 Bacteria 2384
244 nmdc:mga09592_787092_c1 3300050508 Bacteria 805
245 nmdc:mga0qj67_146571_c1 3300050509 Bacteria 1914
246 nmdc:mga06r32_51156_c1 3300050510 Bacteria 3953
247 nmdc:mga08y16_9456_c1 3300050511 Bacteria 10228
248 nmdc:mga0n895_746788_c1 3300050512 Bacteria 972
249 nmdc:mga0rr50_153275_c1 3300050513 Bacteria 1865
250 nmdc:mga08x19_165057_c1 3300050514 Bacteria 1505
251 nmdc:mga08x19_82233_c1 3300050514 Bacteria 2116
252 nmdc:mga0a205_38596_c1 3300050515 Bacteria 4595
253 Ga0451577_0135815
254 Ga0065707_10498019
255 Ga0070676_10023165
256 Ga0070690_100061165
257 Ga0070670_100298520
258 Ga0070677_10232935
259 Ga0068869_100006396
260 Ga0070666_10001737
261 Ga0070680_100058174
262 Ga0070682_100100237
263 Ga0068868_100012854
264 Ga0068868_100052837
265 Ga0070689_100278286
266 Ga0070689_100889308
267 Ga0070669_100000066
268 Ga0070669_100025142
269 Ga0070675_100108317
270 Ga0070675_100849418
271 Ga0070671_100049641
272 Ga0070673_100205918
273 Ga0070667_100033462
274 Ga0070703_10003267
275 Ga0070709_10652350
276 Ga0070710_10004064
277 Ga0070705_100035243
278 Ga0070700_100014291
279 Ga0070708_100006004
280 Ga0070663_100036081
281 Ga0070663_100141082
282 Ga0070662_100027195
283 Ga0070662_100199036
284 Ga0070681_10022760
285 Ga0070685_10037706
286 Ga0070706_100001501
287 Ga0070706_100563971
288 Ga0070707_100197668
289 Ga0070707_100284634
290 Ga0070698_100040148
291 Ga0070699_100000126
292 Ga0070679_100178008
293 Ga0070679_100197164
294 Ga0070697_100027850
295 Ga0070672_100091291
296 Ga0070686_100047198
297 Ga0070686_100182406
298 Ga0070665_100077352
299 Ga0070665_100321340
300 Ga0068855_100413708
301 Ga0068855_100773505
302 Ga0070664_100002640
303 Ga0068857_100188735
304 Ga0068856_100255065
305 Ga0068859_100181700
306 Ga0068859_100294345
307 Ga0068859_100932499
308 Ga0068870_10014374
309 Ga0068863_100001053
310 Ga0068858_100141364
311 Ga0068858_100481154
312 Ga0068858_100531589
313 Ga0081455_10042088
314 Ga0070717_10000031
315 Ga0075364_10107816
316 Ga0070712_101093036
317 Ga0097621_100479409
318 Ga0068871_100178814
319 Ga0075430_100154012
320 Ga0075431_100194962
321 Ga0075433_10016621
322 Ga0075433_10027142
323 Ga0075434_100323567
324 Ga0075434_100466340
325 Ga0075429_100181501
326 Ga0075429_100516755
327 Ga0075436_100018395
328 Ga0075436_100101596
329 Ga0097620_100181706
330 Ga0097620_100294345
331 Ga0097620_100932534
332 Ga0075435_100076657
333 Ga0099794_10280043
334 Ga0111539_10055510
335 Ga0114129_10994353
336 Ga0105248_10028193
337 Ga0105248_10156368
338 Ga0105249_10210397
339 Ga0105239_10988023
340 Ga0105246_10009550
341 Ga0157342_1009746
342 Ga0157370_10330980
343 Ga0157378_10126412
344 Ga0157375_10029862
345 Ga0163163_10108974
346 Ga0157380_10020013
347 Ga0157377_10132491
348 Ga0157379_10015243
349 Ga0163161_10002588
350 Ga0213874_10179512
351 Ga0213875_10000531
352 Ga0213875_10002973
353 Ga0213875_10023472
354 Ga0213875_10032507
355 Ga0207697_10000746
356 Ga0207692_10044706
357 Ga0207688_10001112
358 Ga0207680_10027862
359 Ga0207645_10004305
360 Ga0207643_10592573
361 Ga0207684_10000035
362 Ga0207684_10510759
363 Ga0207707_10278936
364 Ga0207707_10291610
365 Ga0207660_10080520
366 Ga0207662_10036156
367 Ga0207652_10099050
368 Ga0207652_10223960
369 Ga0207646_10033120
370 Ga0207646_10158236
371 Ga0207681_10000007
372 Ga0207681_10033950
373 Ga0207681_10110043
374 Ga0207650_10273014
375 Ga0207659_10077675
376 Ga0207659_10142066
377 Ga0207659_10775521
378 Ga0207664_10078780
379 Ga0207644_10037979
380 Ga0207706_10143827
381 Ga0207706_10214544
382 Ga0207670_10103412
383 Ga0207670_10549360
384 Ga0207691_10189500
385 Ga0207711_10087772
386 Ga0207679_10010302
387 Ga0207712_10321063
388 Ga0207658_10100725
389 Ga0207658_10252940
390 Ga0207677_10079941
391 Ga0207678_10013783
392 Ga0207678_10057297
393 Ga0207708_10025582
394 Ga0207702_10248690
395 Ga0207641_10105904
396 Ga0207676_10199590
397 Ga0207674_10080200
398 Ga0207683_10008137
399 Ga0207698_10034320
400 Ga0209971_1070571
401 Ga0207428_10007531
402 Ga0268266_10253023
403 Ga0268266_10534238
404 Ga0268265_10038514
405 Ga0307511_10011166
406 Ga0265770_1011352
407 Ga0265316_10184974
408 Ga0307408_100685906
409 Ga0265342_10023363
410 Ga0307405_10607770
411 Ga0373928_0001148
412 Ga0373940_0037775
413 Ga0373932_0029966
414 Ga0373937_0002463
415 Ga0373937_0617566
416 Ga0373925_0397947
417 Ga0395900_0633838
418 Ga0436364_0090066
419 Ga0436364_0199039
420 Ga0436364_0359175
421 Ga0436364_0362340
422 Ga0436364_0396555
423 Ga0436364_0768332
424 Ga0436364_1105375
425 Ga0436364_1244791
426 Ga0436364_1536279
427 Ga0436365_0460023
428 Ga0436365_0884007
429 Ga0436365_1034592
430 Ga0436360_0338891
431 Ga0436360_0643445
432 Ga0436361_0434431
433 Ga0436361_0635658
434 Ga0436363_0012240
435 Ga0436363_0258355
436 Ga0436363_0646403
437 Ga0436362_0183871
438 Ga0450890_033292
439 Ga0451577_0000035
440 Ga0451577_0001846
441 Ga0451577_0176084
442 Ga0451577_0391863
443 Ga0451577_1141185
444 Ga0453683_0000028
445 Ga0453683_0000125
446 Ga0453683_0000420
447 Ga0453683_0001702
448 Ga0453683_0013046
449 Ga0453683_0015954
450 Ga0453683_0383821
451 Ga0466961_0184192
452 Ga0453684_0000097
453 Ga0453684_0004528
454 Ga0453684_0004714
455 Ga0453684_0012581
456 Ga0453684_0012785
457 Ga0453684_0018763
458 Ga0453684_0018881
459 Ga0453684_0020888
460 Ga0453684_0024637
461 Ga0453684_0183297
462 Ga0453684_0184731
463 Ga0453684_0202652
464 Ga0453684_0529601
465 Ga0453684_0546195
466 Ga0466960_0524172
467 Ga0466959_0106444
468 Ga0451576_0000316
469 Ga0451576_0019304
470 Ga0451576_0221122
471 Ga0451576_0300065
472 Ga0451576_0509987
473 Ga0451576_1073043
474 Ga0451576_1081060
475 Ga0451576_1101059
476 Ga0451576_1234154
477 Ga0451576_1785261
478 Ga0466958_0238380
479 Ga0466958_0314758
480 Ga0495592_0454318
481 Ga0495634_0086048
482 Ga0495657_0697444
483 Ga0495674_0766015
484 Ga0495684_0475942
485 Ga0496110_0024359
486 Ga0496126_0076412
487 Ga0501033_0464504
488 Ga0501037_0719938
489 Ga0501047_0368149
490 Ga0501067_0229344
491 Ga0501073_0908779
492 Ga0501044_0017384
493 nmdc:mga00v17_95250_c1
494 nmdc:mga05p37_762402_c1
495 nmdc:mga09592_108242_c1
496 nmdc:mga09592_787092_c1
497 nmdc:mga0qj67_146571_c1
498 nmdc:mga06r32_51156_c1
499 nmdc:mga08y16_9456_c1
500 nmdc:mga0n895_746788_c1
501 nmdc:mga0rr50_153275_c1
502 nmdc:mga08x19_165057_c1
503 nmdc:mga08x19_82233_c1
504 nmdc:mga0a205_38596_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

29

176

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9606 2 171
7xi2-assembly1.cif.gz_B crystal structure of escherichia coli adenine phosphoribosyltransferase (aprt) in complex with phosphate 0.9584 2 171
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.9567 2 171
4mb6-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from yersinia pseudotuberculosis. 0.9552 2 171
4x45-assembly1.cif.gz_A crystal structure of f173g mutant of human aprt 0.9543 2 171
ID Description Score Start End Superfamily
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9626 2 135 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9615 2 171 3.40.50.2020
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9519 2 171 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9506 2 171 3.40.50.2020
af_P91455_5_184_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9422 2 171 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A6G0EWF5-F1-model_v4 deleted 0.9892 30 128
AF-A0A7J4CZX2-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9874 54 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A535VVT9-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9866 34 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A7Y1X3Q4-F1-model_v4 deleted 0.9861 70 147
AF-A0A849EMC6-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.986 67 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map