F363397

General Info

Members Datasets Scaffolds Average Seq Length
252 162 504 109

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0040806|Ga0395905_0040806_816_1172
Length 118
Sequence MKTCRHTVALILAPSLVLVAALMGLAASAVAATKTFQYPAETAQLKPSALPGYAKAQAQCVACHSAEYMLYQPPTAGRAYWDAMVKRMKAVFKAPVDDADIPLLVDYLVKTYGNEQPK

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 4.76
Rhizosphere 88.49
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0040806 3300037471 Bacteria 4354
2 rootH1_10106007 3300003323 Unclassified 2626
3 rootH1_10106008 3300003323 Bacteria 1017
4 rootH1_10173354 3300003323 Bacteria 1215
5 Ga0055540_1003583 3300003792 Bacteria 7415
6 Ga0055540_1023481 3300003792 Bacteria 1553
7 Ga0055531_10000353 3300003794 Bacteria 44922
8 Ga0070658_10456961 3300005327 Bacteria 1101
9 Ga0070658_11116743 3300005327 Bacteria 686
10 Ga0070666_11124275 3300005335 Unclassified 584
11 Ga0070680_100442851 3300005336 Bacteria 1109
12 Ga0068868_100547719 3300005338 Bacteria 1019
13 Ga0070660_100038080 3300005339 Bacteria 3648
14 Ga0070691_10225050 3300005341 Bacteria 996
15 Ga0070669_100607498 3300005353 Bacteria 917
16 Ga0070671_100593909 3300005355 Bacteria 956
17 Ga0070674_100280115 3300005356 Bacteria 1321
18 Ga0070674_100546645 3300005356 Bacteria 971
19 Ga0070673_101822247 3300005364 Bacteria 577
20 Ga0070667_100298931 3300005367 Bacteria 1449
21 Ga0070667_101104796 3300005367 Bacteria 741
22 Ga0070667_101745250 3300005367 Unclassified 586
23 Ga0070714_100462583 3300005435 Bacteria 1206
24 Ga0070705_101955322 3300005440 Bacteria 500
25 Ga0070681_10382561 3300005458 Bacteria 1318
26 Ga0070707_100539140 3300005468 Bacteria 1129
27 Ga0070679_100021932 3300005530 Bacteria 6237
28 Ga0070665_100348169 3300005548 Bacteria 1487
29 Ga0070665_100373155 3300005548 Bacteria 1434
30 Ga0070702_100607878 3300005615 Bacteria 821
31 Ga0068852_100091951 3300005616 Bacteria 2716
32 Ga0068852_102451819 3300005616 Unclassified 542
33 Ga0068852_102453131 3300005616 Unclassified 542
34 Ga0068859_100602525 3300005617 Bacteria 1192
35 Ga0068864_100124246 3300005618 Bacteria 2311
36 Ga0068864_101023748 3300005618 Bacteria 820
37 Ga0068863_100041900 3300005841 Bacteria 4352
38 Ga0068863_100429031 3300005841 Bacteria 1296
39 Ga0068863_102235962 3300005841 Bacteria 557
40 Ga0068858_100417008 3300005842 Bacteria 1291
41 Ga0068858_101466362 3300005842 Bacteria 673
42 Ga0068860_100130590 3300005843 Bacteria 2410
43 Ga0068860_100348582 3300005843 Bacteria 1457
44 Ga0068860_100609644 3300005843 Bacteria 1097
45 Ga0068860_101006546 3300005843 Bacteria 851
46 Ga0068860_101578034 3300005843 Bacteria 678
47 Ga0068862_100618005 3300005844 Unclassified 1042
48 Ga0097621_100276010 3300006237 Bacteria 1478
49 Ga0097620_100602485 3300006931 Bacteria 1192
50 Ga0105240_10006246 3300009093 Bacteria 17532
51 Ga0105240_10021539 3300009093 Bacteria 8571
52 Ga0105240_10038921 3300009093 Bacteria 6096
53 Ga0105240_11767476 3300009093 Bacteria 645
54 Ga0105243_11584496 3300009148 Bacteria 681
55 Ga0105242_11373419 3300009176 Bacteria 733
56 Ga0105248_10002855 3300009177 Bacteria 19175
57 Ga0105248_10094029 3300009177 Bacteria 3376
58 Ga0105237_10000529 3300009545 Bacteria 53671
59 Ga0105237_10040414 3300009545 Bacteria 4703
60 Ga0105238_10001158 3300009551 Bacteria 26593
61 Ga0105238_10149404 3300009551 Bacteria 2312
62 Ga0105238_11280839 3300009551 Bacteria 759
63 Ga0105238_11510871 3300009551 Bacteria 700
64 Ga0105239_10000802 3300010375 Bacteria 44448
65 Ga0157378_10984029 3300013297 Bacteria 877
66 Ga0163162_10134109 3300013306 Bacteria 2587
67 Ga0163162_10688792 3300013306 Bacteria 1144
68 Ga0157375_10331756 3300013308 Bacteria 1686
69 Ga0157375_10481724 3300013308 Bacteria 1406
70 Ga0163163_10269680 3300014325 Bacteria 1753
71 Ga0163163_10800390 3300014325 Bacteria 1006
72 Ga0157379_10264573 3300014968 Bacteria 1563
73 Ga0157379_11794146 3300014968 Bacteria 603
74 Ga0157376_10590437 3300014969 Bacteria 1104
75 Ga0157376_11611750 3300014969 Bacteria 683
76 Ga0213872_10000637 3300021361 Bacteria 26491
77 Ga0213876_10074654 3300021384 Bacteria 1791
78 Ga0213876_10685809 3300021384 Bacteria 545
79 Ga0209673_1007636 3300025273 Bacteria 4940
80 Ga0209051_1000552 3300025303 Bacteria 45581
81 Ga0209051_1023648 3300025303 Bacteria 2549
82 Ga0209257_1000022 3300025304 Bacteria 765258
83 Ga0207710_10360873 3300025900 Bacteria 741
84 Ga0207695_10004136 3300025913 Bacteria 19925
85 Ga0207695_10289555 3300025913 Bacteria 1530
86 Ga0207695_10883085 3300025913 Bacteria 774
87 Ga0207671_10005142 3300025914 Bacteria 12184
88 Ga0207671_11049197 3300025914 Bacteria 641
89 Ga0207660_10104955 3300025917 Bacteria 2116
90 Ga0207657_10043375 3300025919 Bacteria 3962
91 Ga0207646_10494109 3300025922 Bacteria 1103
92 Ga0207681_10856827 3300025923 Bacteria 760
93 Ga0207694_10006012 3300025924 Bacteria 9286
94 Ga0207694_10474371 3300025924 Bacteria 1046
95 Ga0207659_10495202 3300025926 Bacteria 1034
96 Ga0207644_10910108 3300025931 Bacteria 737
97 Ga0207670_10581386 3300025936 Unclassified 918
98 Ga0207711_10085063 3300025941 Bacteria 2770
99 Ga0207711_10220503 3300025941 Bacteria 1734
100 Ga0207667_10194393 3300025949 Bacteria 2081
101 Ga0207658_10824571 3300025986 Bacteria 843
102 Ga0207703_12272776 3300026035 Bacteria 518
103 Ga0207639_10040818 3300026041 Bacteria 3466
104 Ga0207678_11162620 3300026067 Bacteria 683
105 Ga0207641_10159273 3300026088 Bacteria 2051
106 Ga0207641_10246748 3300026088 Bacteria 1666
107 Ga0207641_10881472 3300026088 Bacteria 888
108 Ga0207676_10110861 3300026095 Bacteria 2296
109 Ga0207676_10140213 3300026095 Bacteria 2069
110 Ga0207676_10631114 3300026095 Bacteria 1032
111 Ga0207675_101885995 3300026118 Bacteria 616
112 Ga0207683_10029925 3300026121 Bacteria 4716
113 Ga0207698_12159952 3300026142 Unclassified 570
114 Ga0268266_10040898 3300028379 Bacteria 3953
115 Ga0268266_10559591 3300028379 Bacteria 1096
116 Ga0268265_10610112 3300028380 Unclassified 1044
117 Ga0268264_10394167 3300028381 Bacteria 1329
118 Ga0268264_10672805 3300028381 Bacteria 1026
119 Ga0268264_10918982 3300028381 Bacteria 879
120 Ga0268264_11322741 3300028381 Bacteria 731
121 Ga0268264_11336206 3300028381 Bacteria 727
122 Ga0265330_10045562 3300031235 Bacteria 1934
123 Ga0265332_10004225 3300031238 Bacteria 6797
124 Ga0265328_10159695 3300031239 Bacteria 849
125 Ga0265328_10446050 3300031239 Bacteria 511
126 Ga0265339_10160851 3300031249 Bacteria 1130
127 Ga0265316_10340188 3300031344 Bacteria 1087
128 Ga0265314_10003783 3300031711 Bacteria 14464
129 Ga0265314_10168628 3300031711 Bacteria 1324
130 Ga0373926_0144440 3300035083 Bacteria 904
131 Ga0373934_0319130 3300035086 Bacteria 645
132 Ga0373944_0253297 3300035089 Unclassified 650
133 Ga0373954_0283310 3300035118 Unclassified 817
134 Ga0373943_0281833 3300035170 Bacteria 940
135 Ga0373955_0300885 3300035172 Bacteria 967
136 Ga0373924_0086991 3300035410 Bacteria 1334
137 Ga0373935_0965992 3300035692 Unclassified 632
138 Ga0373927_0851939 3300035695 Unclassified 602
139 Ga0373933_0378996 3300035724 Bacteria 921
140 Ga0373947_0033026 3300035725 Bacteria 3053
141 Ga0373947_0113059 3300035725 Bacteria 1718
142 Ga0373937_0029787 3300036401 Bacteria 4944
143 Ga0373925_0043384 3300037068 Bacteria 3337
144 Ga0373925_0102860 3300037068 Unclassified 2198
145 Ga0373925_0756389 3300037068 Unclassified 801
146 Ga0395899_0005714 3300037312 Bacteria 9654
147 Ga0395899_0017658 3300037312 Bacteria 5434
148 Ga0395900_0010158 3300037418 Bacteria 9627
149 Ga0395900_0084561 3300037418 Bacteria 3260
150 Ga0395900_1736050 3300037418 Unclassified 535
151 Ga0395898_0003690 3300037466 Bacteria 17014
152 Ga0395898_0045651 3300037466 Bacteria 4306
153 Ga0395898_0055021 3300037466 Bacteria 3881
154 Ga0395898_1383603 3300037466 Bacteria 632
155 Ga0395905_0002683 3300037471 Bacteria 19510
156 Ga0395905_0006942 3300037471 Bacteria 11322
157 Ga0395905_0051476 3300037471 Bacteria 3857
158 Ga0395905_0052044 3300037471 Bacteria 3835
159 Ga0395905_0086891 3300037471 Bacteria 2931
160 Ga0395905_0128648 3300037471 Bacteria 2382
161 Ga0395905_0262753 3300037471 Bacteria 1611
162 Ga0395905_0485391 3300037471 Bacteria 1135
163 Ga0395905_0569427 3300037471 Bacteria 1034
164 Ga0436364_0453133 3300037853 Bacteria 762
165 Ga0395901_0015358 3300038443 Bacteria 7792
166 Ga0395901_0189364 3300038443 Bacteria 2158
167 Ga0395901_0272619 3300038443 Bacteria 1759
168 Ga0395901_1680605 3300038443 Unclassified 587
169 Ga0436365_0050122 3300039437 Bacteria 875
170 Ga0436365_1388883 3300039437 Bacteria 1869
171 Ga0436360_0869632 3300039438 Bacteria 656
172 Ga0436361_0348718 3300039447 Bacteria 28917
173 Ga0451577_0024547 3300042876 Bacteria 5483
174 Ga0466969_0032685 3300044656 Bacteria 2645
175 Ga0466969_0104787 3300044656 Bacteria 1328
176 Ga0466972_0055782 3300044658 Unclassified 1900
177 Ga0466972_0089582 3300044658 Bacteria 1459
178 Ga0453683_1165242 3300044673 Bacteria 515
179 Ga0466965_0198873 3300044683 Bacteria 1062
180 Ga0466966_0018803 3300044684 Bacteria 4551
181 Ga0466966_0085215 3300044684 Bacteria 1964
182 Ga0466961_0057216 3300044693 Bacteria 2482
183 Ga0466963_0749776 3300044694 Bacteria 689
184 Ga0466964_0049710 3300044706 Bacteria 1717
185 Ga0453684_0040790 3300044712 Bacteria 6295
186 Ga0453684_0049737 3300044712 Bacteria 5523
187 Ga0453684_0135000 3300044712 Bacteria 2956
188 Ga0466971_0023950 3300044719 Bacteria 2722
189 Ga0466968_0092308 3300044735 Bacteria 1343
190 Ga0466970_0097185 3300044765 Bacteria 1602
191 Ga0466970_0232219 3300044765 Bacteria 1031
192 Ga0466957_0080152 3300044842 Bacteria 2032
193 Ga0466957_0555310 3300044842 Bacteria 800
194 Ga0466960_1033124 3300044901 Unclassified 506
195 Ga0466959_0019650 3300045049 Bacteria 4968
196 Ga0451576_0092518 3300045051 Bacteria 3146
197 Ga0451576_0117872 3300045051 Bacteria 2764
198 Ga0451576_2252101 3300045051 Unclassified 559
199 Ga0466967_0435326 3300045976 Bacteria 1280
200 Ga0466967_1963710 3300045976 Bacteria 582
201 Ga0495590_0035800 3300046457 Bacteria 1732
202 Ga0495629_0135867 3300046459 Unclassified 1712
203 Ga0495639_0055594 3300046475 Bacteria 1806
204 Ga0495630_0713960 3300046517 Unclassified 767
205 Ga0495663_0252652 3300046525 Bacteria 626
206 Ga0495645_0927680 3300046543 Unclassified 515
207 Ga0495667_0175624 3300046559 Bacteria 1376
208 Ga0495656_0157534 3300046615 Bacteria 1101
209 Ga0495635_0956205 3300046663 Unclassified 547
210 Ga0495647_0286988 3300046681 Unclassified 739
211 Ga0495658_0054478 3300046683 Unclassified 2275
212 Ga0495613_0600970 3300046689 Unclassified 732
213 Ga0495685_137054 3300047447 Bacteria 798
214 Ga0495681_0315341 3300047470 Bacteria 602
215 Ga0496102_1890197 3300048905 Bacteria 514
216 Ga0496103_0323795 3300048906 Bacteria 991
217 Ga0496104_0149564 3300048907 Bacteria 2242
218 Ga0496104_0797862 3300048907 Bacteria 850
219 Ga0496105_0421561 3300048908 Bacteria 1057
220 Ga0496108_0109252 3300048911 Bacteria 2363
221 Ga0496109_0085668 3300048912 Bacteria 2909
222 Ga0496110_0749787 3300048913 Bacteria 879
223 Ga0496112_0048530 3300048915 Bacteria 4162
224 Ga0496112_1668122 3300048915 Bacteria 550
225 Ga0496113_0093288 3300048916 Bacteria 2323
226 Ga0496114_0367453 3300048917 Bacteria 1273
227 Ga0496125_0133903 3300048928 Bacteria 1738
228 Ga0501032_0844774 3300049569 Bacteria 577
229 Ga0501033_0505969 3300049570 Bacteria 835
230 Ga0501034_0064994 3300049571 Bacteria 3661
231 Ga0501036_0066951 3300049572 Bacteria 3039
232 Ga0501037_0112404 3300049573 Bacteria 1962
233 Ga0501038_0044696 3300049574 Bacteria 3847
234 Ga0501038_0746450 3300049574 Bacteria 730
235 Ga0501043_0049099 3300049579 Bacteria 3317
236 Ga0501043_0734580 3300049579 Bacteria 719
237 Ga0501046_0024637 3300049580 Bacteria 4932
238 Ga0501047_0116803 3300049581 Bacteria 2549
239 Ga0501047_0607311 3300049581 Bacteria 915
240 Ga0501048_0672949 3300049582 Bacteria 743
241 Ga0501073_0269052 3300049589 Unclassified 1176
242 Ga0501080_0015385 3300049742 Bacteria 7052
243 Ga0501080_0550377 3300049742 Bacteria 1028
244 Ga0501035_0191270 3300049822 Bacteria 1759
245 Ga0501035_1493515 3300049822 Unclassified 515
246 Ga0501044_0002301 3300049823 Bacteria 21770
247 Ga0495601_0227906 3300053077 Bacteria 1217
248 Ga0495595_0306555 3300053084 Unclassified 799
249 Ga0500636_0201415 3300053177 Bacteria 1053
250 Ga0466962_0011360 3300061719 Bacteria 4288
251 Ga0466962_0215699 3300061719 Bacteria 939
252 Ga0466962_0562806 3300061719 Unclassified 579
253 Ga0395905_0040806
254 rootH1_10106007
255 rootH1_10106008
256 rootH1_10173354
257 Ga0055540_1003583
258 Ga0055540_1023481
259 Ga0055531_10000353
260 Ga0070658_10456961
261 Ga0070658_11116743
262 Ga0070666_11124275
263 Ga0070680_100442851
264 Ga0068868_100547719
265 Ga0070660_100038080
266 Ga0070691_10225050
267 Ga0070669_100607498
268 Ga0070671_100593909
269 Ga0070674_100280115
270 Ga0070674_100546645
271 Ga0070673_101822247
272 Ga0070667_100298931
273 Ga0070667_101104796
274 Ga0070667_101745250
275 Ga0070714_100462583
276 Ga0070705_101955322
277 Ga0070681_10382561
278 Ga0070707_100539140
279 Ga0070679_100021932
280 Ga0070665_100348169
281 Ga0070665_100373155
282 Ga0070702_100607878
283 Ga0068852_100091951
284 Ga0068852_102451819
285 Ga0068852_102453131
286 Ga0068859_100602525
287 Ga0068864_100124246
288 Ga0068864_101023748
289 Ga0068863_100041900
290 Ga0068863_100429031
291 Ga0068863_102235962
292 Ga0068858_100417008
293 Ga0068858_101466362
294 Ga0068860_100130590
295 Ga0068860_100348582
296 Ga0068860_100609644
297 Ga0068860_101006546
298 Ga0068860_101578034
299 Ga0068862_100618005
300 Ga0097621_100276010
301 Ga0097620_100602485
302 Ga0105240_10006246
303 Ga0105240_10021539
304 Ga0105240_10038921
305 Ga0105240_11767476
306 Ga0105243_11584496
307 Ga0105242_11373419
308 Ga0105248_10002855
309 Ga0105248_10094029
310 Ga0105237_10000529
311 Ga0105237_10040414
312 Ga0105238_10001158
313 Ga0105238_10149404
314 Ga0105238_11280839
315 Ga0105238_11510871
316 Ga0105239_10000802
317 Ga0157378_10984029
318 Ga0163162_10134109
319 Ga0163162_10688792
320 Ga0157375_10331756
321 Ga0157375_10481724
322 Ga0163163_10269680
323 Ga0163163_10800390
324 Ga0157379_10264573
325 Ga0157379_11794146
326 Ga0157376_10590437
327 Ga0157376_11611750
328 Ga0213872_10000637
329 Ga0213876_10074654
330 Ga0213876_10685809
331 Ga0209673_1007636
332 Ga0209051_1000552
333 Ga0209051_1023648
334 Ga0209257_1000022
335 Ga0207710_10360873
336 Ga0207695_10004136
337 Ga0207695_10289555
338 Ga0207695_10883085
339 Ga0207671_10005142
340 Ga0207671_11049197
341 Ga0207660_10104955
342 Ga0207657_10043375
343 Ga0207646_10494109
344 Ga0207681_10856827
345 Ga0207694_10006012
346 Ga0207694_10474371
347 Ga0207659_10495202
348 Ga0207644_10910108
349 Ga0207670_10581386
350 Ga0207711_10085063
351 Ga0207711_10220503
352 Ga0207667_10194393
353 Ga0207658_10824571
354 Ga0207703_12272776
355 Ga0207639_10040818
356 Ga0207678_11162620
357 Ga0207641_10159273
358 Ga0207641_10246748
359 Ga0207641_10881472
360 Ga0207676_10110861
361 Ga0207676_10140213
362 Ga0207676_10631114
363 Ga0207675_101885995
364 Ga0207683_10029925
365 Ga0207698_12159952
366 Ga0268266_10040898
367 Ga0268266_10559591
368 Ga0268265_10610112
369 Ga0268264_10394167
370 Ga0268264_10672805
371 Ga0268264_10918982
372 Ga0268264_11322741
373 Ga0268264_11336206
374 Ga0265330_10045562
375 Ga0265332_10004225
376 Ga0265328_10159695
377 Ga0265328_10446050
378 Ga0265339_10160851
379 Ga0265316_10340188
380 Ga0265314_10003783
381 Ga0265314_10168628
382 Ga0373926_0144440
383 Ga0373934_0319130
384 Ga0373944_0253297
385 Ga0373954_0283310
386 Ga0373943_0281833
387 Ga0373955_0300885
388 Ga0373924_0086991
389 Ga0373935_0965992
390 Ga0373927_0851939
391 Ga0373933_0378996
392 Ga0373947_0033026
393 Ga0373947_0113059
394 Ga0373937_0029787
395 Ga0373925_0043384
396 Ga0373925_0102860
397 Ga0373925_0756389
398 Ga0395899_0005714
399 Ga0395899_0017658
400 Ga0395900_0010158
401 Ga0395900_0084561
402 Ga0395900_1736050
403 Ga0395898_0003690
404 Ga0395898_0045651
405 Ga0395898_0055021
406 Ga0395898_1383603
407 Ga0395905_0002683
408 Ga0395905_0006942
409 Ga0395905_0051476
410 Ga0395905_0052044
411 Ga0395905_0086891
412 Ga0395905_0128648
413 Ga0395905_0262753
414 Ga0395905_0485391
415 Ga0395905_0569427
416 Ga0436364_0453133
417 Ga0395901_0015358
418 Ga0395901_0189364
419 Ga0395901_0272619
420 Ga0395901_1680605
421 Ga0436365_0050122
422 Ga0436365_1388883
423 Ga0436360_0869632
424 Ga0436361_0348718
425 Ga0451577_0024547
426 Ga0466969_0032685
427 Ga0466969_0104787
428 Ga0466972_0055782
429 Ga0466972_0089582
430 Ga0453683_1165242
431 Ga0466965_0198873
432 Ga0466966_0018803
433 Ga0466966_0085215
434 Ga0466961_0057216
435 Ga0466963_0749776
436 Ga0466964_0049710
437 Ga0453684_0040790
438 Ga0453684_0049737
439 Ga0453684_0135000
440 Ga0466971_0023950
441 Ga0466968_0092308
442 Ga0466970_0097185
443 Ga0466970_0232219
444 Ga0466957_0080152
445 Ga0466957_0555310
446 Ga0466960_1033124
447 Ga0466959_0019650
448 Ga0451576_0092518
449 Ga0451576_0117872
450 Ga0451576_2252101
451 Ga0466967_0435326
452 Ga0466967_1963710
453 Ga0495590_0035800
454 Ga0495629_0135867
455 Ga0495639_0055594
456 Ga0495630_0713960
457 Ga0495663_0252652
458 Ga0495645_0927680
459 Ga0495667_0175624
460 Ga0495656_0157534
461 Ga0495635_0956205
462 Ga0495647_0286988
463 Ga0495658_0054478
464 Ga0495613_0600970
465 Ga0495685_137054
466 Ga0495681_0315341
467 Ga0496102_1890197
468 Ga0496103_0323795
469 Ga0496104_0149564
470 Ga0496104_0797862
471 Ga0496105_0421561
472 Ga0496108_0109252
473 Ga0496109_0085668
474 Ga0496110_0749787
475 Ga0496112_0048530
476 Ga0496112_1668122
477 Ga0496113_0093288
478 Ga0496114_0367453
479 Ga0496125_0133903
480 Ga0501032_0844774
481 Ga0501033_0505969
482 Ga0501034_0064994
483 Ga0501036_0066951
484 Ga0501037_0112404
485 Ga0501038_0044696
486 Ga0501038_0746450
487 Ga0501043_0049099
488 Ga0501043_0734580
489 Ga0501046_0024637
490 Ga0501047_0116803
491 Ga0501047_0607311
492 Ga0501048_0672949
493 Ga0501073_0269052
494 Ga0501080_0015385
495 Ga0501080_0550377
496 Ga0501035_0191270
497 Ga0501035_1493515
498 Ga0501044_0002301
499 Ga0495601_0227906
500 Ga0495595_0306555
501 Ga0500636_0201415
502 Ga0466962_0011360
503 Ga0466962_0215699
504 Ga0466962_0562806

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ca4-assembly1.cif.gz_B sulfite dehydrogenase from starkeya novella mutant 0.8471 28 108
2ca4-assembly1.cif.gz_B sulfite dehydrogenase from starkeya novella mutant 0.8375 28 108
1pby-assembly1.cif.gz_A structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution 0.7428 48 109
1jmx-assembly1.cif.gz_A crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida 0.7338 50 109
7v1o-assembly2.cif.gz_B crystal structure of mouse cytosolic sulfotransferase msult3a1 0.692 78 104
ID Description Score Start End Superfamily
2blfB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9243 47 108 1.10.760.10
2blfB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8974 47 108 1.10.760.10
af_Q58191_50_266_3.30.450.380 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.772 73 106 3.30.450.380
3f2dA05 Special;Helix non-globular;Insulin-like, subunit E; 0.7299 71 102 6.10.50.10
af_Q2FUP9_4_63_1.10.8.200 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Replisome organizer (g39p helicase loader/inhibitor protein) 0.686 73 113 1.10.8.200
ID Description Score Start End GO Terms
AF-A0A0Q6M783-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.937 33 115 GO:0006790
GO:0008482
GO:0009055
GO:0020037
GO:0043546
AF-A0A117DSD1-F1-model_v4 deleted 0.9105 31 113
AF-A0A6G8BWF6-F1-model_v4 Cytochrome c 0.9079 31 112 GO:0009055
GO:0020037
AF-A0A315EWF9-F1-model_v4 Sulfite:cytochrome C oxidoreductase subunit B 0.9042 30 114 GO:0009055
GO:0020037
AF-A0A0U5INY2-F1-model_v4 Putative Monoheme cytochrome c 0.9031 48 109 GO:0009055
GO:0020037

Map