F362940

General Info

Members Datasets Scaffolds Average Seq Length
252 112 252 262

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10133647|Ga0065715_101336472
Length 289
Sequence MSVAPLQMSGGLTVSPANPLLQSLASPFTPWGMASIQTELGKVGVIEAGSGERTPLAFLHGVGSDKSVWAPQLEHFGRSRRTVAFDYPGYGDSRFRDDATRDDYAAAVLAAMTALGIEKAHICGLSLGGVVAIAMHAAAPERCASLVLADTFAVHPQGRAIYDRSIAASHDMRGLAESRVGALLVSEDASLRGNVIDTMAAIEPEAYRLGARAVWLADQTERTSAIRIPTLILVGDQDAITSPALSEELASLIPHARLGVIDGASHLANLDKPVEFNRSIEDFLSAVEA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
100 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.38
Rhizosphere 97.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11873926 2162886012 Bacteria 1233
2 Ga0065715_10133647 3300005293 Bacteria 1969
3 Ga0070658_10008191 3300005327 Bacteria 8401
4 Ga0070658_10023413 3300005327 Bacteria 4958
5 Ga0070658_10056263 3300005327 Bacteria 3196
6 Ga0070658_10063537 3300005327 Bacteria 3010
7 Ga0070658_10224333 3300005327 Bacteria 1590
8 Ga0070676_10188816 3300005328 Bacteria 1344
9 Ga0070683_100019647 3300005329 Bacteria 6003
10 Ga0070683_100193774 3300005329 Bacteria 1930
11 Ga0070670_100010220 3300005331 Bacteria 8009
12 Ga0070670_100130894 3300005331 Bacteria 2166
13 Ga0070677_10001101 3300005333 Bacteria 8676
14 Ga0070660_100005173 3300005339 Bacteria 9021
15 Ga0070660_100016929 3300005339 Bacteria 5305
16 Ga0070660_100113473 3300005339 Bacteria 2158
17 Ga0070660_100191177 3300005339 Bacteria 1658
18 Ga0070692_10038905 3300005345 Bacteria 2426
19 Ga0070692_10049066 3300005345 Bacteria 2189
20 Ga0070668_100242896 3300005347 Bacteria 1492
21 Ga0070669_100015666 3300005353 Bacteria 5406
22 Ga0070669_100072678 3300005353 Bacteria 2547
23 Ga0070675_100013805 3300005354 Bacteria 6359
24 Ga0070675_100381984 3300005354 Bacteria 1254
25 Ga0070671_100053443 3300005355 Bacteria 3358
26 Ga0070674_100119141 3300005356 Bacteria 1952
27 Ga0070674_100238917 3300005356 Bacteria 1421
28 Ga0070673_100031993 3300005364 Bacteria 3955
29 Ga0070673_100135670 3300005364 Bacteria 2071
30 Ga0070659_100184226 3300005366 Bacteria 1714
31 Ga0070659_100453111 3300005366 Bacteria 1088
32 Ga0070714_100253674 3300005435 Bacteria 1627
33 Ga0070714_100299257 3300005435 Bacteria 1499
34 Ga0070663_100012824 3300005455 Bacteria 5318
35 Ga0070663_100503236 3300005455 Unclassified 1006
36 Ga0070678_100137857 3300005456 Bacteria 1948
37 Ga0070662_100056195 3300005457 Bacteria 2857
38 Ga0070662_100073438 3300005457 Bacteria 2527
39 Ga0070679_100250901 3300005530 Bacteria 1726
40 Ga0070684_100401839 3300005535 Bacteria 1263
41 Ga0068853_100177788 3300005539 Bacteria 1929
42 Ga0070672_100029262 3300005543 Bacteria 4130
43 Ga0070665_100008036 3300005548 Bacteria 10684
44 Ga0070665_100218787 3300005548 Bacteria 1905
45 Ga0068855_100001630 3300005563 Bacteria 28165
46 Ga0068854_100249285 3300005578 Bacteria 1417
47 Ga0068856_100154618 3300005614 Bacteria 2304
48 Ga0068852_100207952 3300005616 Bacteria 1855
49 Ga0068852_100269296 3300005616 Bacteria 1638
50 Ga0068864_100002199 3300005618 Bacteria 16094
51 Ga0068864_100531769 3300005618 Bacteria 1134
52 Ga0068870_10041752 3300005840 Bacteria 2385
53 Ga0068863_100638181 3300005841 Unclassified 1056
54 Ga0068862_100153485 3300005844 Bacteria 2051
55 Ga0075428_100066082 3300006844 Bacteria 3960
56 Ga0075431_100025199 3300006847 Bacteria 6097
57 Ga0105248_10163671 3300009177 Bacteria 2508
58 Ga0105237_10710600 3300009545 Bacteria 1011
59 Ga0157373_10100562 3300013100 Bacteria 2035
60 Ga0157371_10005343 3300013102 Bacteria 10859
61 Ga0157371_10012905 3300013102 Bacteria 6361
62 Ga0157370_10032478 3300013104 Bacteria 5098
63 Ga0157370_10130211 3300013104 Unclassified 2347
64 Ga0157370_10140594 3300013104 Bacteria 2249
65 Ga0157370_10233553 3300013104 Bacteria 1702
66 Ga0157369_10156359 3300013105 Bacteria 2408
67 Ga0157369_10290353 3300013105 Bacteria 1702
68 Ga0157372_10501234 3300013307 Bacteria 1416
69 Ga0157375_10184495 3300013308 Bacteria 2239
70 Ga0157380_10000418 3300014326 Bacteria 25871
71 Ga0157380_10001794 3300014326 Bacteria 14166
72 Ga0157380_10003259 3300014326 Bacteria 11116
73 Ga0207656_10011185 3300025321 Bacteria 3384
74 Ga0207682_10002291 3300025893 Bacteria 8623
75 Ga0207688_10094837 3300025901 Bacteria 1717
76 Ga0207705_10001685 3300025909 Bacteria 17579
77 Ga0207705_10003111 3300025909 Bacteria 12661
78 Ga0207705_10087715 3300025909 Bacteria 2275
79 Ga0207705_10166071 3300025909 Bacteria 1660
80 Ga0207705_10206866 3300025909 Bacteria 1488
81 Ga0207707_10200947 3300025912 Bacteria 1738
82 Ga0207695_10039572 3300025913 Bacteria 5067
83 Ga0207660_10003839 3300025917 Bacteria 9796
84 Ga0207660_10235378 3300025917 Unclassified 1441
85 Ga0207657_10002664 3300025919 Bacteria 19268
86 Ga0207657_10008901 3300025919 Bacteria 10148
87 Ga0207657_10010498 3300025919 Bacteria 9239
88 Ga0207657_10062957 3300025919 Bacteria 3174
89 Ga0207657_10125505 3300025919 Bacteria 2108
90 Ga0207657_10243672 3300025919 Bacteria 1435
91 Ga0207681_10035284 3300025923 Bacteria 3294
92 Ga0207681_10076584 3300025923 Bacteria 2349
93 Ga0207650_10011705 3300025925 Bacteria 6044
94 Ga0207650_10063917 3300025925 Bacteria 2753
95 Ga0207650_10098071 3300025925 Bacteria 2251
96 Ga0207659_10005281 3300025926 Bacteria 7829
97 Ga0207659_10034427 3300025926 Bacteria 3493
98 Ga0207664_10018914 3300025929 Bacteria 5080
99 Ga0207664_10022282 3300025929 Bacteria 4727
100 Ga0207644_10000419 3300025931 Bacteria 27559
101 Ga0207644_10005111 3300025931 Bacteria 8567
102 Ga0207644_10180611 3300025931 Bacteria 1653
103 Ga0207644_10451546 3300025931 Bacteria 1056
104 Ga0207690_10177263 3300025932 Bacteria 1602
105 Ga0207690_10266083 3300025932 Bacteria 1330
106 Ga0207690_10333745 3300025932 Bacteria 1195
107 Ga0207706_10012864 3300025933 Bacteria 7616
108 Ga0207669_10110493 3300025937 Bacteria 1841
109 Ga0207691_10052211 3300025940 Bacteria 3734
110 Ga0207711_10000345 3300025941 Bacteria 49338
111 Ga0207661_10028745 3300025944 Bacteria 4261
112 Ga0207679_10092358 3300025945 Bacteria 2345
113 Ga0207667_10001174 3300025949 Bacteria 32915
114 Ga0207667_10315308 3300025949 Bacteria 1597
115 Ga0207668_10187319 3300025972 Bacteria 1637
116 Ga0207668_10205370 3300025972 Bacteria 1572
117 Ga0207639_10383623 3300026041 Bacteria 1262
118 Ga0207678_10427004 3300026067 Unclassified 1150
119 Ga0207676_10049281 3300026095 Bacteria 3275
120 Ga0207683_10133841 3300026121 Bacteria 2231
121 Ga0207698_10140938 3300026142 Bacteria 2077
122 Ga0268266_10101413 3300028379 Bacteria 2537
123 Ga0268265_10026376 3300028380 Bacteria 4134
124 Ga0268265_10260670 3300028380 Unclassified 1541
125 Ga0268264_10045236 3300028381 Bacteria 3654
126 Ga0307408_100025260 3300031548 Bacteria 4067
127 Ga0307408_100069598 3300031548 Bacteria 2595
128 Ga0307408_100429366 3300031548 Bacteria 1141
129 Ga0307405_10055444 3300031731 Bacteria 2480
130 Ga0307405_10058523 3300031731 Unclassified 2425
131 Ga0307405_10086283 3300031731 Bacteria 2066
132 Ga0307405_10359008 3300031731 Bacteria 1127
133 Ga0307413_10014537 3300031824 Bacteria 4002
134 Ga0307413_10015456 3300031824 Bacteria 3911
135 Ga0307413_10020540 3300031824 Bacteria 3515
136 Ga0307413_10113735 3300031824 Bacteria 1817
137 Ga0307413_10188605 3300031824 Bacteria 1478
138 Ga0307413_10437722 3300031824 Bacteria 1034
139 Ga0307410_10028321 3300031852 Bacteria 3551
140 Ga0307410_10044038 3300031852 Bacteria 2962
141 Ga0307410_10047702 3300031852 Unclassified 2864
142 Ga0307410_10101098 3300031852 Bacteria 2066
143 Ga0307410_10119393 3300031852 Bacteria 1920
144 Ga0307410_10331866 3300031852 Bacteria 1210
145 Ga0307406_10011269 3300031901 Bacteria 5071
146 Ga0307406_10028549 3300031901 Unclassified 3372
147 Ga0307406_10093170 3300031901 Bacteria 2033
148 Ga0307407_10035027 3300031903 Bacteria 2754
149 Ga0307407_10102238 3300031903 Unclassified 1781
150 Ga0307412_10059223 3300031911 Bacteria 2565
151 Ga0307409_100002769 3300031995 Bacteria 9268
152 Ga0307409_100012510 3300031995 Bacteria 5411
153 Ga0307409_100015872 3300031995 Bacteria 4962
154 Ga0307409_100055597 3300031995 Bacteria 3057
155 Ga0307409_100160302 3300031995 Bacteria 1966
156 Ga0307409_100179109 3300031995 Unclassified 1874
157 Ga0307409_100238869 3300031995 Unclassified 1652
158 Ga0307409_100307804 3300031995 Unclassified 1477
159 Ga0307409_100458126 3300031995 Bacteria 1232
160 Ga0307416_100468200 3300032002 Bacteria 1317
161 Ga0307414_10003089 3300032004 Bacteria 8840
162 Ga0307414_10012427 3300032004 Bacteria 5033
163 Ga0307414_10013767 3300032004 Bacteria 4824
164 Ga0307414_10046862 3300032004 Bacteria 2971
165 Ga0307414_10064521 3300032004 Bacteria 2608
166 Ga0307414_10100334 3300032004 Unclassified 2177
167 Ga0307414_10604951 3300032004 Bacteria 983
168 Ga0307411_10000441 3300032005 Bacteria 14203
169 Ga0307411_10001786 3300032005 Bacteria 9088
170 Ga0307411_10001927 3300032005 Bacteria 8874
171 Ga0307411_10012577 3300032005 Bacteria 4627
172 Ga0307411_10040894 3300032005 Bacteria 2944
173 Ga0307415_100020028 3300032126 Bacteria 4075
174 Ga0307415_100163771 3300032126 Bacteria 1727
175 Ga0307415_100231094 3300032126 Bacteria 1489
176 Ga0307415_100645480 3300032126 Bacteria 948
177 Ga0373937_0469289 3300036401 Bacteria 1195
178 Ga0395899_0000244 3300037312 Bacteria 72329
179 Ga0395899_0007561 3300037312 Bacteria 8386
180 Ga0395899_0010450 3300037312 Bacteria 7111
181 Ga0395899_0093554 3300037312 Bacteria 2175
182 Ga0395899_0104144 3300037312 Bacteria 2045
183 Ga0395899_0196902 3300037312 Bacteria 1407
184 Ga0395900_0000771 3300037418 Bacteria 42659
185 Ga0395900_0001848 3300037418 Bacteria 24139
186 Ga0395900_0012660 3300037418 Bacteria 8623
187 Ga0395900_0023244 3300037418 Bacteria 6344
188 Ga0395900_0119148 3300037418 Bacteria 2709
189 Ga0395900_0170581 3300037418 Bacteria 2215
190 Ga0395900_0176680 3300037418 Bacteria 2171
191 Ga0395900_0184942 3300037418 Bacteria 2115
192 Ga0395900_0200349 3300037418 Bacteria 2020
193 Ga0395900_0269423 3300037418 Bacteria 1698
194 Ga0395898_0003597 3300037466 Bacteria 17278
195 Ga0395898_0061051 3300037466 Bacteria 3662
196 Ga0395898_0069859 3300037466 Bacteria 3397
197 Ga0395898_0479473 3300037466 Bacteria 1183
198 Ga0395898_0555075 3300037466 Bacteria 1091
199 Ga0395898_0564849 3300037466 Bacteria 1080
200 Ga0395905_0006217 3300037471 Bacteria 12054
201 Ga0395905_0020745 3300037471 Bacteria 6221
202 Ga0395905_0020968 3300037471 Bacteria 6188
203 Ga0395905_0034635 3300037471 Bacteria 4743
204 Ga0395905_0037608 3300037471 Bacteria 4543
205 Ga0395905_0046479 3300037471 Bacteria 4070
206 Ga0395905_0091310 3300037471 Unclassified 2855
207 Ga0395905_0113247 3300037471 Bacteria 2548
208 Ga0395905_0196740 3300037471 Bacteria 1890
209 Ga0395905_0252860 3300037471 Bacteria 1646
210 Ga0395901_0000206 3300038443 Bacteria 73997
211 Ga0395901_0005618 3300038443 Bacteria 12695
212 Ga0395901_0017926 3300038443 Bacteria 7226
213 Ga0395901_0027422 3300038443 Bacteria 5852
214 Ga0395901_0048157 3300038443 Bacteria 4427
215 Ga0395901_0049178 3300038443 Bacteria 4380
216 Ga0395901_0061549 3300038443 Bacteria 3906
217 Ga0395901_0072583 3300038443 Bacteria 3588
218 Ga0395901_0114634 3300038443 Bacteria 2831
219 Ga0395901_0175250 3300038443 Bacteria 2249
220 Ga0395901_0221931 3300038443 Bacteria 1975
221 Ga0395901_0380025 3300038443 Bacteria 1454
222 Ga0395901_0448328 3300038443 Bacteria 1320
223 Ga0439432_069660 3300042006 Unclassified 1074
224 Ga0466966_0111220 3300044684 Bacteria 1688
225 Ga0466966_0131408 3300044684 Bacteria 1533
226 Ga0466957_0075295 3300044842 Bacteria 2094
227 Ga0466959_0236634 3300045049 Bacteria 1262
228 Ga0466967_0041227 3300045976 Bacteria 3979
229 Ga0495596_0042512 3300046500 Bacteria 1791
230 Ga0495663_0006275 3300046525 Bacteria 3282
231 Ga0495663_0006468 3300046525 Bacteria 3236
232 Ga0495663_0011680 3300046525 Bacteria 2444
233 Ga0495642_0093382 3300046528 Bacteria 1275
234 Ga0495621_0028391 3300046539 Bacteria 1901
235 Ga0495621_0052321 3300046539 Bacteria 1463
236 Ga0495621_0087241 3300046539 Bacteria 1171
237 Ga0495669_0010716 3300046684 Bacteria 3879
238 Ga0495669_0018219 3300046684 Bacteria 3017
239 Ga0495669_0036234 3300046684 Bacteria 2180
240 Ga0495669_0162547 3300046684 Unclassified 1060
241 Ga0495670_0072091 3300046691 Bacteria 1749
242 Ga0495670_0157550 3300046691 Bacteria 1192
243 Ga0495677_0046996 3300047445 Bacteria 1584
244 Ga0496107_0000462 3300048910 Bacteria 22204
245 Ga0496109_0007972 3300048912 Bacteria 8980
246 Ga0496111_0000356 3300048914 Bacteria 22705
247 Ga0496112_0023422 3300048915 Bacteria 5899
248 Ga0496113_0098317 3300048916 Bacteria 2265
249 Ga0496113_0161863 3300048916 Bacteria 1769
250 nmdc:mga09592_887209_c1 3300050508 Unclassified 750
251 nmdc:mga06r32_34989_c1 3300050510 Bacteria 4739
252 Ga0466962_0035035 3300061719 Bacteria 2403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10184495 Ga0157375_101844953 221
2 3300044684 Ga0466966_0111220 Ga0466966_0111220_54_725 221
3 3300045049 Ga0466959_0236634 Ga0466959_0236634_54_725 221
4 3300037418 Ga0395900_0269423 Ga0395900_0269423_594_1271 222
5 3300050508 nmdc:mga09592_887209_c1 nmdc:mga09592_887209_c1_15_698 222
6 3300005356 Ga0070674_100119141 Ga0070674_1001191412 236
7 3300025937 Ga0207669_10110493 Ga0207669_101104932 236
8 3300005353 Ga0070669_100015666 Ga0070669_1000156663 241
9 3300013102 Ga0157371_10005343 Ga0157371_100053436 241
10 3300013104 Ga0157370_10032478 Ga0157370_100324782 241
11 3300031852 Ga0307410_10044038 Ga0307410_100440383 245
12 3300031852 Ga0307410_10047702 Ga0307410_100477023 245
13 3300031903 Ga0307407_10035027 Ga0307407_100350272 245
14 3300031995 Ga0307409_100015872 Ga0307409_1000158724 245
15 3300031995 Ga0307409_100458126 Ga0307409_1004581262 245
16 3300032004 Ga0307414_10003089 Ga0307414_100030894 245
17 3300032004 Ga0307414_10012427 Ga0307414_100124272 245
18 3300032005 Ga0307411_10001786 Ga0307411_100017868 245
19 3300032005 Ga0307411_10001927 Ga0307411_100019277 245
20 3300031731 Ga0307405_10086283 Ga0307405_100862832 247
21 3300031824 Ga0307413_10437722 Ga0307413_104377222 247
22 3300032126 Ga0307415_100163771 Ga0307415_1001637712 247
23 3300025925 Ga0207650_10098071 Ga0207650_100980712 248
24 3300025931 Ga0207644_10000419 Ga0207644_1000041921 248
25 3300005530 Ga0070679_100250901 Ga0070679_1002509012 249
26 3300025909 Ga0207705_10087715 Ga0207705_100877152 251
27 3300005327 Ga0070658_10224333 Ga0070658_102243332 253
28 3300005329 Ga0070683_100019647 Ga0070683_1000196474 253
29 3300005339 Ga0070660_100191177 Ga0070660_1001911772 253
30 3300005345 Ga0070692_10049066 Ga0070692_100490662 253
31 3300005354 Ga0070675_100381984 Ga0070675_1003819841 253
32 3300005366 Ga0070659_100184226 Ga0070659_1001842262 253
33 3300005455 Ga0070663_100012824 Ga0070663_1000128243 253
34 3300005457 Ga0070662_100073438 Ga0070662_1000734382 253
35 3300005539 Ga0068853_100177788 Ga0068853_1001777882 253
36 3300013100 Ga0157373_10100562 Ga0157373_101005622 253
37 3300013105 Ga0157369_10156359 Ga0157369_101563592 253
38 3300025909 Ga0207705_10001685 Ga0207705_100016852 253
39 3300025909 Ga0207705_10166071 Ga0207705_101660712 253
40 3300025912 Ga0207707_10200947 Ga0207707_102009472 253
41 3300025917 Ga0207660_10235378 Ga0207660_102353781 253
42 3300025919 Ga0207657_10002664 Ga0207657_1000266417 253
43 3300025919 Ga0207657_10062957 Ga0207657_100629572 253
44 3300025923 Ga0207681_10035284 Ga0207681_100352843 253
45 3300025926 Ga0207659_10034427 Ga0207659_100344273 253
46 3300025932 Ga0207690_10177263 Ga0207690_101772632 253
47 3300025944 Ga0207661_10028745 Ga0207661_100287452 253
48 3300026041 Ga0207639_10383623 Ga0207639_103836232 253
49 3300028380 Ga0268265_10260670 Ga0268265_102606701 253
50 3300028381 Ga0268264_10045236 Ga0268264_100452363 253
51 3300037312 Ga0395899_0007561 Ga0395899_0007561_5047_5817 253
52 3300037312 Ga0395899_0104144 Ga0395899_0104144_1141_1911 253
53 3300037312 Ga0395899_0196902 Ga0395899_0196902_330_1100 253
54 3300037418 Ga0395900_0012660 Ga0395900_0012660_3067_3837 253
55 3300037418 Ga0395900_0176680 Ga0395900_0176680_1249_2019 253
56 3300037418 Ga0395900_0184942 Ga0395900_0184942_310_1080 253
57 3300037466 Ga0395898_0061051 Ga0395898_0061051_461_1231 253
58 3300037466 Ga0395898_0069859 Ga0395898_0069859_812_1582 253
59 3300037471 Ga0395905_0020745 Ga0395905_0020745_2958_3728 253
60 3300037471 Ga0395905_0037608 Ga0395905_0037608_3667_4437 253
61 3300037471 Ga0395905_0046479 Ga0395905_0046479_2852_3622 253
62 3300038443 Ga0395901_0048157 Ga0395901_0048157_141_911 253
63 3300038443 Ga0395901_0221931 Ga0395901_0221931_1080_1850 253
64 3300038443 Ga0395901_0448328 Ga0395901_0448328_234_1004 253
65 3300005366 Ga0070659_100453111 Ga0070659_1004531111 254
66 3300025919 Ga0207657_10243672 Ga0207657_102436722 254
67 3300025932 Ga0207690_10333745 Ga0207690_103337451 254
68 3300005327 Ga0070658_10056263 Ga0070658_100562633 255
69 3300005364 Ga0070673_100135670 Ga0070673_1001356702 255
70 3300025321 Ga0207656_10011185 Ga0207656_100111854 255
71 3300036401 Ga0373937_0469289 Ga0373937_0469289_50_826 255
72 3300046528 Ga0495642_0093382 Ga0495642_0093382_213_989 255
73 3300046539 Ga0495621_0028391 Ga0495621_0028391_837_1613 255
74 3300005327 Ga0070658_10008191 Ga0070658_100081914 256
75 3300005339 Ga0070660_100005173 Ga0070660_1000051736 256
76 3300005345 Ga0070692_10038905 Ga0070692_100389052 256
77 3300005563 Ga0068855_100001630 Ga0068855_1000016305 256
78 3300005618 Ga0068864_100531769 Ga0068864_1005317692 256
79 3300006844 Ga0075428_100066082 Ga0075428_1000660822 256
80 3300013102 Ga0157371_10012905 Ga0157371_100129053 256
81 3300013104 Ga0157370_10130211 Ga0157370_101302111 256
82 3300014326 Ga0157380_10003259 Ga0157380_100032597 256
83 3300025909 Ga0207705_10003111 Ga0207705_100031115 256
84 3300025919 Ga0207657_10010498 Ga0207657_100104986 256
85 3300025925 Ga0207650_10063917 Ga0207650_100639173 256
86 3300025932 Ga0207690_10266083 Ga0207690_102660832 256
87 3300025949 Ga0207667_10001174 Ga0207667_1000117431 256
88 3300025972 Ga0207668_10205370 Ga0207668_102053702 256
89 3300031995 Ga0307409_100055597 Ga0307409_1000555973 256
90 3300037312 Ga0395899_0010450 Ga0395899_0010450_5453_6232 256
91 3300037418 Ga0395900_0023244 Ga0395900_0023244_4276_5055 256
92 3300037418 Ga0395900_0119148 Ga0395900_0119148_828_1607 256
93 3300037466 Ga0395898_0003597 Ga0395898_0003597_7700_8479 256
94 3300037466 Ga0395898_0564849 Ga0395898_0564849_186_965 256
95 3300037471 Ga0395905_0006217 Ga0395905_0006217_2282_3061 256
96 3300037471 Ga0395905_0020968 Ga0395905_0020968_4460_5239 256
97 3300037471 Ga0395905_0091310 Ga0395905_0091310_1022_1801 256
98 3300037471 Ga0395905_0113247 Ga0395905_0113247_1648_2427 256
99 3300037471 Ga0395905_0196740 Ga0395905_0196740_463_1242 256
100 3300038443 Ga0395901_0005618 Ga0395901_0005618_7177_7956 256
101 3300038443 Ga0395901_0017926 Ga0395901_0017926_1278_2057 256
102 3300038443 Ga0395901_0049178 Ga0395901_0049178_2236_3015 256
103 3300038443 Ga0395901_0061549 Ga0395901_0061549_482_1261 256
104 3300038443 Ga0395901_0072583 Ga0395901_0072583_1255_2034 256
105 3300045976 Ga0466967_0041227 Ga0466967_0041227_414_1193 256
106 3300046525 Ga0495663_0006275 Ga0495663_0006275_2463_3242 256
107 3300046539 Ga0495621_0052321 Ga0495621_0052321_497_1276 256
108 3300061719 Ga0466962_0035035 Ga0466962_0035035_478_1257 256
109 3300005329 Ga0070683_100193774 Ga0070683_1001937742 257
110 3300005355 Ga0070671_100053443 Ga0070671_1000534433 257
111 3300005435 Ga0070714_100253674 Ga0070714_1002536742 257
112 3300005435 Ga0070714_100299257 Ga0070714_1002992571 257
113 3300005548 Ga0070665_100008036 Ga0070665_1000080364 257
114 3300005548 Ga0070665_100218787 Ga0070665_1002187873 257
115 3300005578 Ga0068854_100249285 Ga0068854_1002492852 257
116 3300005616 Ga0068852_100269296 Ga0068852_1002692963 257
117 3300005844 Ga0068862_100153485 Ga0068862_1001534852 257
118 3300009545 Ga0105237_10710600 Ga0105237_107106001 257
119 3300013307 Ga0157372_10501234 Ga0157372_105012342 257
120 3300025913 Ga0207695_10039572 Ga0207695_100395722 257
121 3300025929 Ga0207664_10018914 Ga0207664_100189142 257
122 3300025929 Ga0207664_10022282 Ga0207664_100222826 257
123 3300025931 Ga0207644_10005111 Ga0207644_100051117 257
124 3300025931 Ga0207644_10451546 Ga0207644_104515462 257
125 3300025949 Ga0207667_10315308 Ga0207667_103153082 257
126 3300026142 Ga0207698_10140938 Ga0207698_101409382 257
127 3300028379 Ga0268266_10101413 Ga0268266_101014133 257
128 3300028380 Ga0268265_10026376 Ga0268265_100263765 257
129 3300031548 Ga0307408_100025260 Ga0307408_1000252604 257
130 3300031548 Ga0307408_100069598 Ga0307408_1000695982 257
131 3300031548 Ga0307408_100429366 Ga0307408_1004293662 257
132 3300031731 Ga0307405_10058523 Ga0307405_100585231 257
133 3300031731 Ga0307405_10359008 Ga0307405_103590081 257
134 3300031824 Ga0307413_10015456 Ga0307413_100154562 257
135 3300031824 Ga0307413_10113735 Ga0307413_101137352 257
136 3300031824 Ga0307413_10188605 Ga0307413_101886052 257
137 3300031852 Ga0307410_10028321 Ga0307410_100283214 257
138 3300031852 Ga0307410_10119393 Ga0307410_101193931 257
139 3300031852 Ga0307410_10331866 Ga0307410_103318662 257
140 3300031901 Ga0307406_10011269 Ga0307406_100112692 257
141 3300031901 Ga0307406_10028549 Ga0307406_100285493 257
142 3300031901 Ga0307406_10093170 Ga0307406_100931702 257
143 3300031911 Ga0307412_10059223 Ga0307412_100592233 257
144 3300031995 Ga0307409_100002769 Ga0307409_1000027693 257
145 3300031995 Ga0307409_100012510 Ga0307409_1000125102 257
146 3300031995 Ga0307409_100160302 Ga0307409_1001603022 257
147 3300031995 Ga0307409_100179109 Ga0307409_1001791092 257
148 3300031995 Ga0307409_100307804 Ga0307409_1003078042 257
149 3300032004 Ga0307414_10013767 Ga0307414_100137672 257
150 3300032004 Ga0307414_10046862 Ga0307414_100468623 257
151 3300032004 Ga0307414_10064521 Ga0307414_100645213 257
152 3300032004 Ga0307414_10100334 Ga0307414_101003342 257
153 3300032004 Ga0307414_10604951 Ga0307414_106049511 257
154 3300032005 Ga0307411_10012577 Ga0307411_100125772 257
155 3300032005 Ga0307411_10040894 Ga0307411_100408942 257
156 3300032126 Ga0307415_100020028 Ga0307415_1000200285 257
157 3300032126 Ga0307415_100231094 Ga0307415_1002310941 257
158 3300032126 Ga0307415_100645480 Ga0307415_1006454801 257
159 3300037418 Ga0395900_0170581 Ga0395900_0170581_627_1427 257
160 3300038443 Ga0395901_0027422 Ga0395901_0027422_1230_2030 257
161 3300038443 Ga0395901_0114634 Ga0395901_0114634_1658_2440 257
162 3300038443 Ga0395901_0380025 Ga0395901_0380025_255_1037 257
163 3300046525 Ga0495663_0006468 Ga0495663_0006468_212_994 257
164 3300046684 Ga0495669_0010716 Ga0495669_0010716_649_1437 257
165 3300046684 Ga0495669_0018219 Ga0495669_0018219_96_878 257
166 3300048916 Ga0496113_0098317 Ga0496113_0098317_1158_1958 257
167 3300005339 Ga0070660_100113473 Ga0070660_1001134732 258
168 3300005364 Ga0070673_100031993 Ga0070673_1000319933 258
169 3300005616 Ga0068852_100207952 Ga0068852_1002079523 258
170 3300005618 Ga0068864_100002199 Ga0068864_10000219915 258
171 3300005841 Ga0068863_100638181 Ga0068863_1006381812 258
172 3300009177 Ga0105248_10163671 Ga0105248_101636712 258
173 3300025919 Ga0207657_10125505 Ga0207657_101255053 258
174 3300025931 Ga0207644_10180611 Ga0207644_101806113 258
175 3300025941 Ga0207711_10000345 Ga0207711_100003456 258
176 3300026095 Ga0207676_10049281 Ga0207676_100492812 258
177 3300044842 Ga0466957_0075295 Ga0466957_0075295_299_1081 258
178 3300046684 Ga0495669_0162547 Ga0495669_0162547_70_852 258
179 3300048910 Ga0496107_0000462 Ga0496107_0000462_5861_6643 258
180 3300048912 Ga0496109_0007972 Ga0496109_0007972_1223_2005 258
181 3300048914 Ga0496111_0000356 Ga0496111_0000356_4152_4934 258
182 3300048915 Ga0496112_0023422 Ga0496112_0023422_1903_2685 258
183 3300048916 Ga0496113_0161863 Ga0496113_0161863_739_1521 258
184 3300005339 Ga0070660_100016929 Ga0070660_1000169295 259
185 3300005614 Ga0068856_100154618 Ga0068856_1001546182 259
186 3300006847 Ga0075431_100025199 Ga0075431_1000251994 259
187 3300013104 Ga0157370_10140594 Ga0157370_101405943 259
188 3300013105 Ga0157369_10290353 Ga0157369_102903532 259
189 3300014326 Ga0157380_10000418 Ga0157380_1000041825 259
190 3300031824 Ga0307413_10014537 Ga0307413_100145373 259
191 3300031852 Ga0307410_10101098 Ga0307410_101010981 259
192 3300032005 Ga0307411_10000441 Ga0307411_100004416 259
193 3300037418 Ga0395900_0200349 Ga0395900_0200349_835_1623 259
194 3300037466 Ga0395898_0555075 Ga0395898_0555075_239_1027 259
195 3300037471 Ga0395905_0252860 Ga0395905_0252860_753_1541 259
196 3300005327 Ga0070658_10063537 Ga0070658_100635372 260
197 3300005331 Ga0070670_100010220 Ga0070670_1000102202 260
198 3300025909 Ga0207705_10206866 Ga0207705_102068662 260
199 3300025917 Ga0207660_10003839 Ga0207660_1000383910 260
200 3300032002 Ga0307416_100468200 Ga0307416_1004682001 260
201 3300037312 Ga0395899_0093554 Ga0395899_0093554_775_1566 260
202 3300037466 Ga0395898_0479473 Ga0395898_0479473_297_1088 260
203 3300037471 Ga0395905_0034635 Ga0395905_0034635_3915_4706 260
204 3300038443 Ga0395901_0175250 Ga0395901_0175250_1028_1819 260
205 3300044684 Ga0466966_0131408 Ga0466966_0131408_664_1461 260
206 3300046500 Ga0495596_0042512 Ga0495596_0042512_753_1544 260
207 3300046539 Ga0495621_0087241 Ga0495621_0087241_328_1119 260
208 3300046691 Ga0495670_0072091 Ga0495670_0072091_123_914 260
209 3300047445 Ga0495677_0046996 Ga0495677_0046996_621_1463 260
210 3300050510 nmdc:mga06r32_34989_c1 nmdc:mga06r32_34989_c1_2271_3062 260
211 3300031731 Ga0307405_10055444 Ga0307405_100554442 261
212 3300031824 Ga0307413_10020540 Ga0307413_100205402 261
213 3300031903 Ga0307407_10102238 Ga0307407_101022381 261
214 3300031995 Ga0307409_100238869 Ga0307409_1002388691 261
215 3300046525 Ga0495663_0011680 Ga0495663_0011680_269_1063 261
216 3300046684 Ga0495669_0036234 Ga0495669_0036234_369_1163 261
217 3300046691 Ga0495670_0157550 Ga0495670_0157550_231_1025 261
218 3300042006 Ga0439432_069660 Ga0439432_069660_115_945 268
219 3300005535 Ga0070684_100401839 Ga0070684_1004018391 270
220 3300005327 Ga0070658_10023413 Ga0070658_100234134 271
221 3300013104 Ga0157370_10233553 Ga0157370_102335532 271
222 3300025919 Ga0207657_10008901 Ga0207657_100089012 271
223 3300037312 Ga0395899_0000244 Ga0395899_0000244_68421_69254 271
224 3300037418 Ga0395900_0000771 Ga0395900_0000771_3071_3904 271
225 3300038443 Ga0395901_0000206 Ga0395901_0000206_69457_70290 271
226 3300037418 Ga0395900_0001848 Ga0395900_0001848_14466_15329 278
227 2162886012 MBSR1b_contig_11873926 MBSR1b_0892.00000640 282
228 3300005293 Ga0065715_10133647 Ga0065715_101336472 282
229 3300005328 Ga0070676_10188816 Ga0070676_101888162 282
230 3300005331 Ga0070670_100130894 Ga0070670_1001308942 282
231 3300005333 Ga0070677_10001101 Ga0070677_100011012 282
232 3300005347 Ga0070668_100242896 Ga0070668_1002428962 282
233 3300005353 Ga0070669_100072678 Ga0070669_1000726782 282
234 3300005354 Ga0070675_100013805 Ga0070675_1000138054 282
235 3300005356 Ga0070674_100238917 Ga0070674_1002389172 282
236 3300005455 Ga0070663_100503236 Ga0070663_1005032361 282
237 3300005456 Ga0070678_100137857 Ga0070678_1001378572 282
238 3300005457 Ga0070662_100056195 Ga0070662_1000561953 282
239 3300005543 Ga0070672_100029262 Ga0070672_1000292623 282
240 3300005840 Ga0068870_10041752 Ga0068870_100417522 282
241 3300014326 Ga0157380_10001794 Ga0157380_100017943 282
242 3300025893 Ga0207682_10002291 Ga0207682_100022915 282
243 3300025901 Ga0207688_10094837 Ga0207688_100948372 282
244 3300025923 Ga0207681_10076584 Ga0207681_100765842 282
245 3300025925 Ga0207650_10011705 Ga0207650_100117054 282
246 3300025926 Ga0207659_10005281 Ga0207659_100052814 282
247 3300025933 Ga0207706_10012864 Ga0207706_100128645 282
248 3300025940 Ga0207691_10052211 Ga0207691_100522113 282
249 3300025945 Ga0207679_10092358 Ga0207679_100923582 282
250 3300025972 Ga0207668_10187319 Ga0207668_101873192 282
251 3300026067 Ga0207678_10427004 Ga0207678_104270042 282
252 3300026121 Ga0207683_10133841 Ga0207683_101338412 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

54

273

0.95

PF12146

Hydrolase_4

Serine aminopeptidase, S33

52

273

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

56

279

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9375 28 278
4dgq-assembly1.cif.gz_C crystal structure of non-heme chloroperoxidase from burkholderia cenocepacia 0.9243 27 278
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9239 25 277
8pi1-assembly1.cif.gz_B bicyclic incypro pseudomonas fluorescens esterase 0.9175 28 277
3fob-assembly1.cif.gz_B crystal structure of bromoperoxidase from bacillus anthracis 0.9154 28 278
ID Description Score Start End Superfamily
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9206 26 278 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9202 28 278 3.40.50.1820
af_Q9LK01_7_272_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.919 38 277 3.40.50.1820
af_A0A1D6LZZ6_1_261_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.912 38 275 3.40.50.1820
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9115 26 279 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7V9I8A7-F1-model_v4 Alpha/beta fold hydrolase 0.9668 26 281 GO:0016020
GO:0016787
AF-A0A258W3Z9-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9522 45 279
AF-A0A327KTV8-F1-model_v4 Lactone hydrolase 0.9513 38 280 GO:0016787
AF-A0A367A2C5-F1-model_v4 3-oxoadipate enol-lactonase 0.9512 26 279
AF-A0A7C8AF80-F1-model_v4 Alpha/beta fold hydrolase 0.9511 110 277 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.15 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map