F362858

General Info

Members Datasets Scaffolds Average Seq Length
251 198 502 389

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006426723
Length 441
Sequence GFRTLTTVQEWGRPVGDANGIHPGGAVPVPLVLVDTDAGLTGVGIGPHAGLAEVFTALEGEDPRCVTALYDRMLRRTFKAGHSGALFGAIGALDTALWDLKAKAAGEPLWRLLGGRVPRVPGYASGLDIGLDDEELAAVYRDYAAHGLRAAKLKGGLDVERDRHRLTLVRDVLSRASPGRRPALMLDANETWSRKQAVRHICELERTLDLTWVEEPVRRWDAEGLAAVGRGVRAAVASGENLTGLEQYRPLLAAGAVDVVQASAVWGVTHFLRVAALAHAHDLPVSPIGNTPVALVHAAASLPNHLVSEVQELRPPAGLHIDLHVGDGAFVLGGSPGLGIHVDEAAIAAAAPAATSPAAPAGDGPAVRPAAAGLRLLAVPGEDTAGPGPGRPDRPAASGGPPRRPGGATGTSTSTGTGTGTGTGTNSVTGTGAGAPYTAHH

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
100 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
101 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
102 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
103 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
104 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
158 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
159 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
160 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
161 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
162 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
163 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
164 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
165 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
166 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
167 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
168 2855683550 Micromonospora sp. RP3T Isolate Unclassified
169 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
170 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
171 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
172 2858882152 Micromonospora noduli MED15 Isolate Nodule
173 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
174 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
175 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
176 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
177 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
178 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
179 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
180 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
181 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
182 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
183 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
184 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
185 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
186 2891562705 Microbispora tritici MT50 Isolate Unclassified
187 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
188 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
189 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
190 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
191 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
192 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
193 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
194 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
195 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
196 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
197 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
198 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.67
Metatranscriptomes 0.8
Isolates 17.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.38
Nodule 1.99
Rhizoplane 2.39
Rhizosphere 77.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005176 3300003203 Bacteria 6050
2 Ga0070676_10018406 3300005328 Bacteria 3871
3 Ga0070683_100002139 3300005329 Bacteria 15616
4 Ga0068869_100026768 3300005334 Bacteria 4016
5 Ga0068868_100002563 3300005338 Bacteria 12621
6 Ga0070660_100055553 3300005339 Bacteria 3060
7 Ga0070660_100066222 3300005339 Bacteria 2812
8 Ga0070661_100002785 3300005344 Bacteria 11996
9 Ga0070661_100011699 3300005344 Bacteria 6119
10 Ga0070668_100000299 3300005347 Bacteria 32488
11 Ga0070668_100004195 3300005347 Bacteria 10683
12 Ga0070675_100000120 3300005354 Bacteria 46215
13 Ga0070667_100005078 3300005367 Bacteria 11017
14 Ga0070667_100011166 3300005367 Bacteria 7431
15 Ga0070710_10000328 3300005437 Bacteria 22654
16 Ga0070700_100008882 3300005441 Bacteria 5495
17 Ga0070700_100165848 3300005441 Bacteria 1525
18 Ga0070663_100000588 3300005455 Bacteria 19349
19 Ga0070678_100070661 3300005456 Bacteria 2611
20 Ga0070662_100119499 3300005457 Bacteria 2018
21 Ga0070681_10108790 3300005458 Bacteria 2712
22 Ga0070679_100012914 3300005530 Bacteria 7998
23 Ga0070684_100044195 3300005535 Bacteria 3852
24 Ga0070664_100043326 3300005564 Bacteria 3797
25 Ga0068857_100018442 3300005577 Bacteria 6122
26 Ga0068857_100026513 3300005577 Bacteria 5108
27 Ga0068857_100261270 3300005577 Bacteria 1589
28 Ga0068856_100044095 3300005614 Bacteria 4388
29 Ga0068852_100024137 3300005616 Bacteria 4909
30 Ga0068852_100027130 3300005616 Bacteria 4664
31 Ga0068859_100042741 3300005617 Bacteria 4553
32 Ga0068859_100120228 3300005617 Bacteria 2693
33 Ga0068864_100063050 3300005618 Bacteria 3212
34 Ga0068863_100277375 3300005841 Bacteria 1623
35 Ga0068858_100080406 3300005842 Bacteria 3028
36 Ga0068860_100000787 3300005843 Bacteria 35457
37 Ga0068862_100016392 3300005844 Bacteria 6167
38 Ga0068862_100123846 3300005844 Bacteria 2281
39 Ga0081455_10000543 3300005937 Bacteria 49007
40 Ga0081539_10001051 3300005985 Bacteria 50562
41 Ga0081539_10005085 3300005985 Bacteria 13786
42 Ga0081539_10010191 3300005985 Bacteria 7696
43 Ga0081539_10011661 3300005985 Bacteria 6912
44 Ga0075365_10086581 3300006038 Bacteria 2130
45 Ga0075368_10037684 3300006042 Bacteria 1891
46 Ga0075364_10064778 3300006051 Bacteria 2399
47 Ga0075364_10154567 3300006051 Bacteria 1547
48 Ga0075362_10015466 3300006177 Bacteria 3103
49 Ga0075428_100004758 3300006844 Bacteria 15027
50 Ga0075428_100114671 3300006844 Bacteria 2935
51 Ga0075430_100002364 3300006846 Bacteria 15675
52 Ga0075430_100015814 3300006846 Bacteria 6426
53 Ga0075431_100017816 3300006847 Bacteria 7221
54 Ga0075429_100012126 3300006880 Bacteria 7469
55 Ga0075429_100019370 3300006880 Bacteria 5894
56 Ga0097620_100042740 3300006931 Bacteria 4553
57 Ga0097620_100120224 3300006931 Bacteria 2693
58 Ga0105240_10251226 3300009093 Bacteria 2045
59 Ga0111539_10014230 3300009094 Bacteria 9935
60 Ga0105245_10000586 3300009098 Bacteria 33044
61 Ga0114129_10007560 3300009147 Bacteria 15477
62 Ga0114129_10007798 3300009147 Bacteria 15233
63 Ga0114129_10067223 3300009147 Bacteria 4999
64 Ga0114129_10070020 3300009147 Bacteria 4890
65 Ga0114129_10113935 3300009147 Bacteria 3728
66 Ga0105241_10196208 3300009174 Bacteria 1683
67 Ga0105248_10023921 3300009177 Bacteria 6790
68 Ga0105237_10049160 3300009545 Bacteria 4240
69 Ga0105237_10174307 3300009545 Bacteria 2151
70 Ga0105239_10100051 3300010375 Bacteria 3206
71 Ga0163162_10294218 3300013306 Bacteria 1755
72 Ga0157380_10284153 3300014326 Bacteria 1516
73 Ga0157377_10022202 3300014745 Bacteria 3348
74 Ga0157379_10004573 3300014968 Bacteria 11871
75 Ga0206356_10029287 3300020070 Bacteria 3658
76 Ga0206353_10316809 3300020082 Bacteria 3457
77 Ga0207692_10000067 3300025898 Bacteria 30359
78 Ga0207688_10029338 3300025901 Bacteria 3028
79 Ga0207654_10007166 3300025911 Bacteria 5615
80 Ga0207657_10098458 3300025919 Bacteria 2430
81 Ga0207649_10013127 3300025920 Bacteria 4621
82 Ga0207694_10222389 3300025924 Bacteria 1540
83 Ga0207650_10076960 3300025925 Bacteria 2521
84 Ga0207659_10031865 3300025926 Bacteria 3612
85 Ga0207687_10001626 3300025927 Bacteria 15483
86 Ga0207700_10094279 3300025928 Bacteria 2371
87 Ga0207690_10013368 3300025932 Bacteria 4933
88 Ga0207706_10092571 3300025933 Bacteria 2658
89 Ga0207704_10040467 3300025938 Bacteria 2725
90 Ga0207689_10034830 3300025942 Bacteria 4181
91 Ga0207661_10010669 3300025944 Bacteria 6622
92 Ga0207661_10036489 3300025944 Bacteria 3837
93 Ga0207679_10074522 3300025945 Bacteria 2572
94 Ga0207679_10078312 3300025945 Bacteria 2518
95 Ga0207668_10016216 3300025972 Bacteria 4645
96 Ga0207658_10114746 3300025986 Bacteria 2136
97 Ga0207677_10007986 3300026023 Bacteria 5885
98 Ga0207677_10286103 3300026023 Bacteria 1355
99 Ga0207678_10001369 3300026067 Bacteria 22479
100 Ga0207708_10000848 3300026075 Bacteria 23028
101 Ga0207708_10181456 3300026075 Bacteria 1671
102 Ga0207641_10254342 3300026088 Bacteria 1642
103 Ga0207676_10243832 3300026095 Bacteria 1614
104 Ga0207674_10024650 3300026116 Bacteria 6424
105 Ga0207674_10316285 3300026116 Bacteria 1510
106 Ga0207675_100202047 3300026118 Bacteria 1909
107 Ga0207698_10019244 3300026142 Bacteria 4671
108 Ga0207698_10026757 3300026142 Bacteria 4085
109 Ga0207428_10033819 3300027907 Bacteria 4193
110 Ga0268265_10013844 3300028380 Bacteria 5491
111 Ga0268265_10337795 3300028380 Bacteria 1370
112 Ga0268264_10000748 3300028381 Bacteria 36682
113 Ga0307515_10119036 3300028794 Bacteria 3008
114 Ga0265325_10011589 3300031241 Bacteria 5065
115 Ga0307513_10003725 3300031456 Bacteria 20611
116 Ga0265313_10023877 3300031595 Bacteria 3283
117 Ga0307516_10002049 3300031730 Bacteria 27469
118 Ga0307405_10014233 3300031731 Bacteria 4271
119 Ga0307410_10017754 3300031852 Bacteria 4281
120 Ga0307412_10052361 3300031911 Bacteria 2703
121 Ga0307409_100000630 3300031995 Bacteria 15504
122 Ga0307409_100046615 3300031995 Bacteria 3283
123 Ga0307416_100002620 3300032002 Bacteria 10398
124 Ga0307416_100069209 3300032002 Bacteria 2920
125 Ga0307416_100174895 3300032002 Bacteria 2004
126 Ga0307415_100000139 3300032126 Bacteria 31946
127 Ga0307415_100001876 3300032126 Bacteria 10318
128 Ga0307415_100039465 3300032126 Bacteria 3121
129 Ga0307415_100040312 3300032126 Bacteria 3093
130 Ga0307415_100053117 3300032126 Bacteria 2759
131 Ga0307415_100056928 3300032126 Bacteria 2684
132 Ga0373927_0080144 3300035695 Bacteria 2116
133 Ga0395901_0214494 3300038443 Bacteria 2013
134 Ga0439436_0038689 3300041404 Bacteria 1371
135 Ga0439439_0010270 3300041406 Bacteria 2236
136 Ga0451853_0045776 3300041512 Bacteria 9052
137 Ga0439457_000398 3300042014 Bacteria 12348
138 Ga0439457_013301 3300042014 Bacteria 1850
139 Ga0450894_000121 3300042131 Bacteria 13492
140 Ga0450896_000882 3300042133 Bacteria 3444
141 Ga0450898_000635 3300042134 Bacteria 4209
142 Ga0450899_000082 3300042135 Bacteria 7995
143 Ga0450906_002568 3300042145 Bacteria 3954
144 Ga0466972_0001663 3300044658 Bacteria 10879
145 Ga0466972_0007582 3300044658 Bacteria 5449
146 Ga0466965_0001027 3300044683 Bacteria 10789
147 Ga0466965_0023142 3300044683 Bacteria 2998
148 Ga0466965_0044550 3300044683 Bacteria 2193
149 Ga0466963_0091358 3300044694 Bacteria 2073
150 Ga0466971_0020040 3300044719 Bacteria 2973
151 Ga0466970_0051744 3300044765 Bacteria 2192
152 Ga0466958_0073085 3300045836 Bacteria 2100
153 Ga0466967_0127992 3300045976 Bacteria 2354
154 Ga0466967_0392589 3300045976 Bacteria 1349
155 Ga0495606_0005888 3300046507 Bacteria 11537
156 Ga0495630_0158377 3300046517 Bacteria 1724
157 Ga0495668_0047275 3300046616 Bacteria 2389
158 Ga0495625_0013070 3300046660 Bacteria 6690
159 Ga0495593_0095454 3300047673 Bacteria 1529
160 Ga0495626_0006112 3300048091 Bacteria 6909
161 Ga0496105_0203542 3300048908 Bacteria 1615
162 Ga0496108_0000363 3300048911 Bacteria 38192
163 Ga0496110_0016675 3300048913 Bacteria 6137
164 Ga0496111_0048846 3300048914 Bacteria 3050
165 Ga0496112_0128747 3300048915 Bacteria 2502
166 Ga0496113_0030111 3300048916 Bacteria 3926
167 Ga0496117_0035486 3300048920 Bacteria 3742
168 Ga0501031_0015093 3300049568 Bacteria 5017
169 Ga0501032_0000214 3300049569 Bacteria 48072
170 Ga0501033_0009812 3300049570 Bacteria 7350
171 Ga0501034_0006565 3300049571 Bacteria 12494
172 Ga0501036_0012281 3300049572 Bacteria 7093
173 Ga0501037_0001221 3300049573 Bacteria 18964
174 Ga0501038_0002191 3300049574 Bacteria 18167
175 Ga0501039_0001192 3300049575 Bacteria 19058
176 Ga0501042_0024205 3300049578 Bacteria 4257
177 Ga0501043_0018204 3300049579 Bacteria 5508
178 Ga0501046_0000272 3300049580 Bacteria 52767
179 Ga0501047_0001457 3300049581 Bacteria 23110
180 Ga0501048_0000782 3300049582 Bacteria 23273
181 Ga0501067_0014669 3300049583 Bacteria 4337
182 Ga0501069_0000691 3300049585 Bacteria 15733
183 Ga0501070_0003204 3300049586 Bacteria 14231
184 Ga0501071_0199344 3300049587 Bacteria 1503
185 Ga0501073_0004694 3300049589 Bacteria 10260
186 Ga0501074_0001235 3300049590 Bacteria 16850
187 Ga0501083_0011017 3300049744 Bacteria 6354
188 Ga0501035_0002520 3300049822 Bacteria 17915
189 Ga0501044_0006057 3300049823 Bacteria 13347
190 nmdc:mga00v17_7294_c1 3300050491 Bacteria 5891
191 nmdc:mga00v17_89065_c1 3300050491 Bacteria 1936
192 nmdc:mga0yw44_121414_c1 3300050492 Bacteria 1683
193 nmdc:mga0yw44_22660_c1 3300050492 Bacteria 3525
194 nmdc:mga06z11_26843_c1 3300050494 Bacteria 2746
195 nmdc:mga05p37_13690_c1 3300050507 Bacteria 9722
196 nmdc:mga05p37_212901_c1 3300050507 Bacteria 2335
197 nmdc:mga05p37_4360_c1 3300050507 Bacteria 16515
198 nmdc:mga05p37_7518_c1 3300050507 Bacteria 12847
199 nmdc:mga09592_4615_c1 3300050508 Bacteria 11158
200 nmdc:mga09592_73361_c1 3300050508 Bacteria 2908
201 nmdc:mga0qj67_1861_c1 3300050509 Bacteria 14960
202 nmdc:mga0qj67_29760_c1 3300050509 Bacteria 4243
203 nmdc:mga06r32_137031_c1 3300050510 Bacteria 2422
204 nmdc:mga06r32_1979_c1 3300050510 Bacteria 18298
205 nmdc:mga08y16_33142_c1 3300050511 Bacteria 5426
206 Ga0500579_053096 3300053143 Bacteria 2463
207 Ga0501084_0002490 3300054114 Bacteria 14821
208 3006426723 3006425503 Bacteria 6491253
209 2676488597 2675903060 Bacteria 10051191
210 2753266473 2751185782 Bacteria 11227053
211 2753270116 2751185782 Bacteria 11227053
212 2772647014 2772190715 Bacteria 6959372
213 2774396651 2773857762 Bacteria 5971770
214 2785346164 2784746763 Bacteria 9783172
215 2791914670 2791354901 Bacteria 8322202
216 2812349492 2811994878 Bacteria 5992952
217 2816423445 2816332119 Bacteria 8120218
218 2855671979 2855670206 Bacteria 7120389
219 2855678098 2855676851 Bacteria 7063653
220 2855689780 2855683550 Bacteria 7134265
221 2856742250 2856741275 Bacteria 8096094
222 2857291611 2857288857 Bacteria 7189066
223 2858849722 2858848962 Bacteria 6963058
224 2858886170 2858882152 Bacteria 7230291
225 2858889478 2858888857 Bacteria 7060307
226 2858898070 2858895516 Bacteria 7378898
227 2863410410 2863404153 Bacteria 9672205
228 2869052255 2869048445 Bacteria 6875584
229 2869065346 2869061728 Bacteria 7112407
230 2869069912 2869068681 Bacteria 7205615
231 2870724858 2870721527 Bacteria 9689237
232 2880492552 2880489317 Bacteria 7096270
233 2880499734 2880495981 Bacteria 7340502
234 2884696823 2884693830 Bacteria 11273186
235 2887479788 2887478801 Bacteria 8972725
236 2891402065 2891395885 Bacteria 9251614
237 2891402121 2891395885 Bacteria 9251614
238 2891560246 2891554331 Bacteria 8812224
239 2891567471 2891562705 Bacteria 8039471
240 2895451587 2895442618 Bacteria 11027144
241 2929228312 2929226422 Bacteria 7248583
242 8001787315 8001781756 Bacteria 9586736
243 8003831332 8003830390 Bacteria 6541657
244 8003871227 8003870546 Bacteria 7396674
245 8033687728 8033684223 Bacteria 6906479
246 8047712303 8047710418 Bacteria 11023148
247 8054710485 8054704163 Bacteria 7247792
248 8054730498 8054727385 Bacteria 7558670
249 8054738626 8054734606 Bacteria 6947278
250 8055073725 8055066027 Bacteria 9479577
251 8055177503 8055172936 Bacteria 9305943
252 JGI25406J46586_10005176
253 Ga0070676_10018406
254 Ga0070683_100002139
255 Ga0068869_100026768
256 Ga0068868_100002563
257 Ga0070660_100055553
258 Ga0070660_100066222
259 Ga0070661_100002785
260 Ga0070661_100011699
261 Ga0070668_100000299
262 Ga0070668_100004195
263 Ga0070675_100000120
264 Ga0070667_100005078
265 Ga0070667_100011166
266 Ga0070710_10000328
267 Ga0070700_100008882
268 Ga0070700_100165848
269 Ga0070663_100000588
270 Ga0070678_100070661
271 Ga0070662_100119499
272 Ga0070681_10108790
273 Ga0070679_100012914
274 Ga0070684_100044195
275 Ga0070664_100043326
276 Ga0068857_100018442
277 Ga0068857_100026513
278 Ga0068857_100261270
279 Ga0068856_100044095
280 Ga0068852_100024137
281 Ga0068852_100027130
282 Ga0068859_100042741
283 Ga0068859_100120228
284 Ga0068864_100063050
285 Ga0068863_100277375
286 Ga0068858_100080406
287 Ga0068860_100000787
288 Ga0068862_100016392
289 Ga0068862_100123846
290 Ga0081455_10000543
291 Ga0081539_10001051
292 Ga0081539_10005085
293 Ga0081539_10010191
294 Ga0081539_10011661
295 Ga0075365_10086581
296 Ga0075368_10037684
297 Ga0075364_10064778
298 Ga0075364_10154567
299 Ga0075362_10015466
300 Ga0075428_100004758
301 Ga0075428_100114671
302 Ga0075430_100002364
303 Ga0075430_100015814
304 Ga0075431_100017816
305 Ga0075429_100012126
306 Ga0075429_100019370
307 Ga0097620_100042740
308 Ga0097620_100120224
309 Ga0105240_10251226
310 Ga0111539_10014230
311 Ga0105245_10000586
312 Ga0114129_10007560
313 Ga0114129_10007798
314 Ga0114129_10067223
315 Ga0114129_10070020
316 Ga0114129_10113935
317 Ga0105241_10196208
318 Ga0105248_10023921
319 Ga0105237_10049160
320 Ga0105237_10174307
321 Ga0105239_10100051
322 Ga0163162_10294218
323 Ga0157380_10284153
324 Ga0157377_10022202
325 Ga0157379_10004573
326 Ga0206356_10029287
327 Ga0206353_10316809
328 Ga0207692_10000067
329 Ga0207688_10029338
330 Ga0207654_10007166
331 Ga0207657_10098458
332 Ga0207649_10013127
333 Ga0207694_10222389
334 Ga0207650_10076960
335 Ga0207659_10031865
336 Ga0207687_10001626
337 Ga0207700_10094279
338 Ga0207690_10013368
339 Ga0207706_10092571
340 Ga0207704_10040467
341 Ga0207689_10034830
342 Ga0207661_10010669
343 Ga0207661_10036489
344 Ga0207679_10074522
345 Ga0207679_10078312
346 Ga0207668_10016216
347 Ga0207658_10114746
348 Ga0207677_10007986
349 Ga0207677_10286103
350 Ga0207678_10001369
351 Ga0207708_10000848
352 Ga0207708_10181456
353 Ga0207641_10254342
354 Ga0207676_10243832
355 Ga0207674_10024650
356 Ga0207674_10316285
357 Ga0207675_100202047
358 Ga0207698_10019244
359 Ga0207698_10026757
360 Ga0207428_10033819
361 Ga0268265_10013844
362 Ga0268265_10337795
363 Ga0268264_10000748
364 Ga0307515_10119036
365 Ga0265325_10011589
366 Ga0307513_10003725
367 Ga0265313_10023877
368 Ga0307516_10002049
369 Ga0307405_10014233
370 Ga0307410_10017754
371 Ga0307412_10052361
372 Ga0307409_100000630
373 Ga0307409_100046615
374 Ga0307416_100002620
375 Ga0307416_100069209
376 Ga0307416_100174895
377 Ga0307415_100000139
378 Ga0307415_100001876
379 Ga0307415_100039465
380 Ga0307415_100040312
381 Ga0307415_100053117
382 Ga0307415_100056928
383 Ga0373927_0080144
384 Ga0395901_0214494
385 Ga0439436_0038689
386 Ga0439439_0010270
387 Ga0451853_0045776
388 Ga0439457_000398
389 Ga0439457_013301
390 Ga0450894_000121
391 Ga0450896_000882
392 Ga0450898_000635
393 Ga0450899_000082
394 Ga0450906_002568
395 Ga0466972_0001663
396 Ga0466972_0007582
397 Ga0466965_0001027
398 Ga0466965_0023142
399 Ga0466965_0044550
400 Ga0466963_0091358
401 Ga0466971_0020040
402 Ga0466970_0051744
403 Ga0466958_0073085
404 Ga0466967_0127992
405 Ga0466967_0392589
406 Ga0495606_0005888
407 Ga0495630_0158377
408 Ga0495668_0047275
409 Ga0495625_0013070
410 Ga0495593_0095454
411 Ga0495626_0006112
412 Ga0496105_0203542
413 Ga0496108_0000363
414 Ga0496110_0016675
415 Ga0496111_0048846
416 Ga0496112_0128747
417 Ga0496113_0030111
418 Ga0496117_0035486
419 Ga0501031_0015093
420 Ga0501032_0000214
421 Ga0501033_0009812
422 Ga0501034_0006565
423 Ga0501036_0012281
424 Ga0501037_0001221
425 Ga0501038_0002191
426 Ga0501039_0001192
427 Ga0501042_0024205
428 Ga0501043_0018204
429 Ga0501046_0000272
430 Ga0501047_0001457
431 Ga0501048_0000782
432 Ga0501067_0014669
433 Ga0501069_0000691
434 Ga0501070_0003204
435 Ga0501071_0199344
436 Ga0501073_0004694
437 Ga0501074_0001235
438 Ga0501083_0011017
439 Ga0501035_0002520
440 Ga0501044_0006057
441 nmdc:mga00v17_7294_c1
442 nmdc:mga00v17_89065_c1
443 nmdc:mga0yw44_121414_c1
444 nmdc:mga0yw44_22660_c1
445 nmdc:mga06z11_26843_c1
446 nmdc:mga05p37_13690_c1
447 nmdc:mga05p37_212901_c1
448 nmdc:mga05p37_4360_c1
449 nmdc:mga05p37_7518_c1
450 nmdc:mga09592_4615_c1
451 nmdc:mga09592_73361_c1
452 nmdc:mga0qj67_1861_c1
453 nmdc:mga0qj67_29760_c1
454 nmdc:mga06r32_137031_c1
455 nmdc:mga06r32_1979_c1
456 nmdc:mga08y16_33142_c1
457 Ga0500579_053096
458 Ga0501084_0002490
459 3006426723
460 2676488597
461 2753266473
462 2753270116
463 2772647014
464 2774396651
465 2785346164
466 2791914670
467 2812349492
468 2816423445
469 2855671979
470 2855678098
471 2855689780
472 2856742250
473 2857291611
474 2858849722
475 2858886170
476 2858889478
477 2858898070
478 2863410410
479 2869052255
480 2869065346
481 2869069912
482 2870724858
483 2880492552
484 2880499734
485 2884696823
486 2887479788
487 2891402065
488 2891402121
489 2891560246
490 2891567471
491 2895451587
492 2929228312
493 8001787315
494 8003831332
495 8003871227
496 8033687728
497 8047712303
498 8054710485
499 8054730498
500 8054738626
501 8055073725
502 8055177503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

20

114

0.9

PF13378

MR_MLE_C

Enolase C-terminal domain-like

135

346

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ck5-assembly1.cif.gz_A crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.8978 3 351
5xd9-assembly1.cif.gz_A-2 crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase 0.8907 2 351
1mra-assembly1.cif.gz_A mandelate racemase mutant d270n co-crystallized with (s)-atrolactate 0.8899 2 351
3cyj-assembly1.cif.gz_A crystal structure of a mandelate racemase/muconate lactonizing enzyme-like protein from rubrobacter xylanophilus 0.8873 1 351
3ck5-assembly2.cif.gz_D crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.8844 3 353
ID Description Score Start End Superfamily
3ck5D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9176 111 346 3.20.20.120
3uxlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9102 111 346 3.20.20.120
3ck5D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9096 111 346 3.20.20.120
3uxlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9028 111 346 3.20.20.120
2oz8A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.8973 111 346 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A4Q3AD76-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.971 1 225 GO:0000287
GO:0016052
GO:0016836
AF-A0A6H9X717-F1-model_v4 deleted 0.9686 139 312
AF-A0A6H9X717-F1-model_v4 deleted 0.9579 139 312
AF-A0A4Q2M1Q6-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9561 1 372 GO:0000287
GO:0016052
GO:0016836
AF-A0A3D2RH81-F1-model_v4 Racemase 0.9523 52 357 GO:0000287
GO:0016052
GO:0016836

Map