F362853

General Info

Members Datasets Scaffolds Average Seq Length
251 163 221 280

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2965320100|2965321506
Length 334
Sequence KKQRKSSSIVQFPRSFVEIGTHYPIRIPDILIQATKSLKKATSVIYNRPNFVPSNTTIMTNSNNKVWFITGTSRGFGRVWTEAALKRGDKVVATARKLDSIRDFSEKYGENVLTLELDVTNADQVKTVLEKGFNHFGRLDIVLNNAGYSLVGTIEEASNDDIKAMYETNVFGPLTVIKTALPLLRKQGFGHILGTSSGLGHTTLPVIGYYCSTKWAFEAIHESLALEVKDFNIKVTIIEPGAYATEFGTQDSLKFAPGMDIYEDFKAEFFNQLQQLEKGNPDATPDAVFAAVDAENPPLRLILGNGNLPWIKKDYAERLAEWEQWADVSNAAQG

Samples

Sample ID Description Type Environment
1 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
2 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
3 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
4 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
8 2738541278 Niastella sp. CF465 Isolate Unclassified
9 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
10 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
13 2818991444 Filimonas endophytica 3197 Isolate Unclassified
14 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
15 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
16 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
17 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
18 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
19 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
20 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
21 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
22 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
23 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
24 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
25 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
26 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
27 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
28 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
29 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
30 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
97 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
98 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
99 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
148 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
149 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
150 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
151 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
152 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
153 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
154 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
155 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
156 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
157 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
158 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
162 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
163 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.05
Metatranscriptomes 0
Isolates 11.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.56
Nodule 0
Rhizoplane 1.59
Rhizosphere 62.55
Stem 0
Stem Tuber 0
Unclassified 26.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000006 3300002067 Bacteria 339303
2 rootH1_10015086 3300003316 Bacteria 2863
3 rootH1_10029800 3300003316 Bacteria 5301
4 rootH1_10050930 3300003316 Bacteria 1359
5 rootH1_10187570 3300003316 Unclassified 1336
6 rootH2_10013175 3300003320 Bacteria 2160
7 rootH2_10048046 3300003320 Bacteria 6273
8 rootH2_10228940 3300003320 Unclassified 1234
9 rootL2_10030141 3300003322 Bacteria 4032
10 rootL2_10045789 3300003322 Bacteria 2092
11 rootL2_10080919 3300003322 Bacteria 11786
12 rootL2_10100018 3300003322 Bacteria 5925
13 rootL2_10216907 3300003322 Unclassified 2086
14 rootL2_10265295 3300003322 Bacteria 2636
15 rootL2_10326353 3300003322 Unclassified 2676
16 rootH1_10001790 3300003323 Bacteria 63047
17 rootH1_10040447 3300003323 Bacteria 11594
18 rootH1_10045208 3300003323 Bacteria 8891
19 rootH1_10089383 3300003323 Bacteria 3472
20 rootH1_10107863 3300003323 Bacteria 5638
21 rootH1_10145361 3300003323 Bacteria 4659
22 rootH1_10308546 3300003323 Bacteria 1684
23 JGI25160J50197_1001462 3300003354 Bacteria 11774
24 Ga0055531_10000209 3300003794 Bacteria 64439
25 Ga0055531_10003213 3300003794 Bacteria 10489
26 Ga0065714_10065202 3300005288 Bacteria 11997
27 Ga0065714_10089838 3300005288 Bacteria 1964
28 Ga0065715_10296521 3300005293 Bacteria 1046
29 Ga0070670_100013104 3300005331 Bacteria 7103
30 Ga0068869_100269216 3300005334 Bacteria 1366
31 Ga0070682_100000822 3300005337 Bacteria 18129
32 Ga0070668_100172990 3300005347 Bacteria 1759
33 Ga0070688_100210655 3300005365 Bacteria 1364
34 Ga0070667_100621978 3300005367 Bacteria 996
35 Ga0070662_100260431 3300005457 Bacteria 1397
36 Ga0068853_100091918 3300005539 Bacteria 2669
37 Ga0068853_100430080 3300005539 Bacteria 1239
38 Ga0070665_100008203 3300005548 Bacteria 10574
39 Ga0068855_100024483 3300005563 Bacteria 7222
40 Ga0068857_100094931 3300005577 Bacteria 2671
41 Ga0068857_100258193 3300005577 Bacteria 1599
42 Ga0068854_100593839 3300005578 Bacteria 944
43 Ga0068856_100052784 3300005614 Bacteria 4010
44 Ga0068856_100151138 3300005614 Bacteria 2331
45 Ga0068851_10055792 3300005834 Bacteria 2013
46 Ga0068860_100000052 3300005843 Bacteria 207351
47 Ga0105244_10024612 3300009036 Bacteria 3283
48 Ga0105240_10000010 3300009093 Bacteria 537830
49 Ga0105240_10000107 3300009093 Bacteria 171629
50 Ga0105240_10000180 3300009093 Bacteria 128683
51 Ga0105240_10010151 3300009093 Bacteria 13258
52 Ga0105240_10031451 3300009093 Bacteria 6883
53 Ga0105240_10065352 3300009093 Bacteria 4516
54 Ga0105240_10708018 3300009093 Unclassified 1099
55 Ga0105241_10048852 3300009174 Bacteria 3221
56 Ga0105241_10168407 3300009174 Bacteria 1807
57 Ga0105237_10001190 3300009545 Bacteria 34836
58 Ga0105237_10009697 3300009545 Bacteria 10301
59 Ga0105237_10071490 3300009545 Bacteria 3464
60 Ga0105237_10237900 3300009545 Bacteria 1822
61 Ga0105237_10258702 3300009545 Bacteria 1743
62 Ga0105237_10456561 3300009545 Unclassified 1284
63 Ga0105237_10806564 3300009545 Bacteria 945
64 Ga0105238_10010754 3300009551 Bacteria 9193
65 Ga0105238_10037569 3300009551 Bacteria 4922
66 Ga0105239_10000011 3300010375 Bacteria 337500
67 Ga0105239_10000137 3300010375 Bacteria 102833
68 Ga0105239_10001971 3300010375 Bacteria 26704
69 Ga0105239_10008948 3300010375 Bacteria 11329
70 Ga0105239_10012557 3300010375 Bacteria 9429
71 Ga0105239_10219787 3300010375 Bacteria 2131
72 Ga0157373_10022175 3300013100 Bacteria 4608
73 Ga0157373_10045674 3300013100 Bacteria 3126
74 Ga0157371_10001868 3300013102 Bacteria 21084
75 Ga0157371_10022518 3300013102 Bacteria 4615
76 Ga0157370_10023182 3300013104 Bacteria 6168
77 Ga0157370_10024176 3300013104 Bacteria 6021
78 Ga0157370_10232803 3300013104 Bacteria 1705
79 Ga0157370_10385312 3300013104 Unclassified 1291
80 Ga0157370_10592504 3300013104 Unclassified 1015
81 Ga0157370_10618142 3300013104 Bacteria 991
82 Ga0157369_10000008 3300013105 Bacteria 309315
83 Ga0157369_10036170 3300013105 Bacteria 5412
84 Ga0157374_10021390 3300013296 Bacteria 5755
85 Ga0157372_10016357 3300013307 Bacteria 7959
86 Ga0157372_10137823 3300013307 Bacteria 2811
87 Ga0157375_10000136 3300013308 Bacteria 72919
88 Ga0182006_1000407 3300015261 Bacteria 34782
89 Ga0182007_10000003 3300015262 Bacteria 548244
90 Ga0182005_1000093 3300015265 Bacteria 67293
91 Ga0183373_1001 3300015682 Bacteria 1410374
92 Ga0163161_10000124 3300017792 Bacteria 72378
93 Ga0163161_10001012 3300017792 Bacteria 21410
94 Ga0163161_10001837 3300017792 Bacteria 15500
95 Ga0163161_10055209 3300017792 Bacteria 2883
96 Ga0163161_10411571 3300017792 Bacteria 1086
97 Ga0213872_10007012 3300021361 Bacteria 5584
98 Ga0213874_10007594 3300021377 Bacteria 2610
99 Ga0209436_104884 3300025208 Bacteria 3210
100 Ga0207427_100198 3300025231 Bacteria 57527
101 Ga0209437_100008 3300025233 Bacteria 921142
102 Ga0209233_1000024 3300025261 Bacteria 695418
103 Ga0207426_1000002 3300025302 Bacteria 1249660
104 Ga0207426_1006142 3300025302 Bacteria 5289
105 Ga0209257_1000001 3300025304 Bacteria 2274655
106 Ga0209257_1000005 3300025304 Bacteria 1592528
107 Ga0207647_10000717 3300025904 Bacteria 25975
108 Ga0207654_10004338 3300025911 Bacteria 7149
109 Ga0207654_10023272 3300025911 Bacteria 3316
110 Ga0207695_10000019 3300025913 Bacteria 732137
111 Ga0207695_10000077 3300025913 Bacteria 307107
112 Ga0207695_10000199 3300025913 Bacteria 166179
113 Ga0207695_10000456 3300025913 Bacteria 89131
114 Ga0207695_10010126 3300025913 Bacteria 11571
115 Ga0207695_10054586 3300025913 Bacteria 4170
116 Ga0207695_10157732 3300025913 Bacteria 2203
117 Ga0207671_10000667 3300025914 Bacteria 44873
118 Ga0207671_10026867 3300025914 Bacteria 4306
119 Ga0207671_10281501 3300025914 Unclassified 1312
120 Ga0207650_10104080 3300025925 Bacteria 2189
121 Ga0207689_10224517 3300025942 Bacteria 1552
122 Ga0207667_10033870 3300025949 Bacteria 5488
123 Ga0207651_10348089 3300025960 Bacteria 1247
124 Ga0207658_10585679 3300025986 Bacteria 1001
125 Ga0207639_10082847 3300026041 Bacteria 2544
126 Ga0207702_10007446 3300026078 Bacteria 9340
127 Ga0207702_10148965 3300026078 Bacteria 2127
128 Ga0207702_10151489 3300026078 Bacteria 2110
129 Ga0207674_10043459 3300026116 Bacteria 4633
130 Ga0207674_10282326 3300026116 Bacteria 1608
131 Ga0268266_10004384 3300028379 Bacteria 13537
132 Ga0268264_10000143 3300028381 Bacteria 170031
133 Ga0307515_10001098 3300028794 Bacteria 62024
134 Ga0316177_1187600 3300030731 Bacteria 15933
135 Ga0316176_1209502 3300030732 Bacteria 16479
136 Ga0316183_1006572 3300030742 Unclassified 1916
137 Ga0316181_1206017 3300030744 Bacteria 21085
138 Ga0265327_10000055 3300031251 Bacteria 247188
139 Ga0307513_10067999 3300031456 Bacteria 3734
140 Ga0307405_10000008 3300031731 Bacteria 264953
141 Ga0307413_10039939 3300031824 Bacteria 2733
142 Ga0307407_10000026 3300031903 Bacteria 108029
143 Ga0307416_100000053 3300032002 Bacteria 108029
144 Ga0307414_10060732 3300032004 Bacteria 2675
145 Ga0307411_10000001 3300032005 Bacteria 931810
146 Ga0307510_10010171 3300033180 Bacteria 11185
147 Ga0436364_0438622 3300037853 Bacteria 1630
148 Ga0436365_1305508 3300039437 Bacteria 12718
149 Ga0436360_0090176 3300039438 Bacteria 1772
150 Ga0436361_0544042 3300039447 Unclassified 1019
151 Ga0436363_1204833 3300039450 Bacteria 3851
152 Ga0439466_0013715 3300041411 Bacteria 2963
153 Ga0451807_1602855 3300041486 Bacteria 1270
154 Ga0439445_0000026 3300042004 Bacteria 19549
155 Ga0439449_0019390 3300042007 Bacteria 2550
156 Ga0466972_0000056 3300044658 Bacteria 111206
157 Ga0466968_0099581 3300044735 Unclassified 1296
158 Ga0466970_0001706 3300044765 Bacteria 10562
159 Ga0466970_0127890 3300044765 Bacteria 1394
160 Ga0466957_0000009 3300044842 Bacteria 76227
161 Ga0466959_0164700 3300045049 Unclassified 1557
162 Ga0495606_0003837 3300046507 Bacteria 15540
163 Ga0495606_0011225 3300046507 Bacteria 7331
164 Ga0495606_0012300 3300046507 Bacteria 6882
165 Ga0495606_0017985 3300046507 Bacteria 5318
166 Ga0495606_0075613 3300046507 Bacteria 2107
167 Ga0495610_0000047 3300046512 Bacteria 151516
168 Ga0495610_0000747 3300046512 Bacteria 30695
169 Ga0495632_0064620 3300046519 Bacteria 1769
170 Ga0495663_0001503 3300046525 Bacteria 7324
171 Ga0495609_0000119 3300046538 Bacteria 88855
172 Ga0495633_0000002 3300046558 Bacteria 488754
173 Ga0495633_0025013 3300046558 Bacteria 2945
174 Ga0495668_0132013 3300046616 Bacteria 1367
175 Ga0495611_0000047 3300046648 Bacteria 85473
176 Ga0495625_0062264 3300046660 Bacteria 2638
177 Ga0495660_0018318 3300046810 Bacteria 4025
178 Ga0495686_0020446 3300047472 Bacteria 4414
179 Ga0495686_0025806 3300047472 Bacteria 3849
180 Ga0496104_0242214 3300048907 Bacteria 1716
181 Ga0496115_0035305 3300048918 Bacteria 3955
182 Ga0496116_0000006 3300048919 Bacteria 811937
183 Ga0496117_0000023 3300048920 Bacteria 438585
184 Ga0496117_0000938 3300048920 Bacteria 44676
185 Ga0496118_0000660 3300048921 Bacteria 56444
186 Ga0496118_0030190 3300048921 Bacteria 4530
187 Ga0496119_0000010 3300048922 Bacteria 438534
188 Ga0496119_0024158 3300048922 Bacteria 4284
189 Ga0496120_0011632 3300048923 Bacteria 6039
190 Ga0496121_0000010 3300048924 Bacteria 793488
191 Ga0496121_0023973 3300048924 Bacteria 5852
192 Ga0496121_0273727 3300048924 Bacteria 1159
193 Ga0496122_0000166 3300048925 Bacteria 157284
194 Ga0496122_0039913 3300048925 Bacteria 3737
195 Ga0496122_0119517 3300048925 Bacteria 1703
196 Ga0496123_0000294 3300048926 Bacteria 97574
197 Ga0496123_0036177 3300048926 Bacteria 3506
198 Ga0496124_0001583 3300048927 Bacteria 32871
199 Ga0496125_0005162 3300048928 Bacteria 14687
200 Ga0496125_0242525 3300048928 Bacteria 1143
201 Ga0496126_0001004 3300048929 Bacteria 48080
202 Ga0496126_0006541 3300048929 Bacteria 12972
203 Ga0496126_0168178 3300048929 Bacteria 1870
204 Ga0501249_004640 3300049679 Bacteria 2792
205 Ga0501257_004803 3300049686 Bacteria 2959
206 Ga0501225_0004131 3300049705 Bacteria 4339
207 Ga0501241_020740 3300049758 Bacteria 1210
208 Ga0501266_000016 3300049763 Bacteria 164181
209 Ga0500578_0000012 3300053086 Bacteria 188658
210 Ga0500646_0016731 3300053090 Bacteria 1917
211 Ga0500583_0013334 3300053092 Bacteria 3176
212 Ga0500569_005569 3300053109 Bacteria 2711
213 Ga0500618_000023 3300053125 Bacteria 152444
214 Ga0500658_0000826 3300053134 Bacteria 12746
215 Ga0500577_0000320 3300053142 Bacteria 12444
216 Ga0500616_0026802 3300053153 Bacteria 3186
217 Ga0500622_0000007 3300053156 Bacteria 425621
218 Ga0500622_0000449 3300053156 Bacteria 39238
219 Ga0500633_0000516 3300053160 Bacteria 6203
220 Ga0500634_0100321 3300053161 Bacteria 1450
221 Ga0500661_001022 3300055283 Bacteria 5269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10228940 rootH2_102289402 265
2 3300003316 rootH1_10050930 rootH1_100509302 268
3 3300041486 Ga0451807_1602855 Ga0451807_1602855_16_834 268
4 iso_pu_bacteria 2818991442 2819573034 268
5 iso_pu_bacteria 2821136567 2821139532 268
6 iso_pu_bacteria 2904467357 2904471835 268
7 iso_pu_bacteria 2929177148 2929180800 268
8 3300005843 Ga0068860_100000052 Ga0068860_100000052162 270
9 3300028381 Ga0268264_10000143 Ga0268264_1000014316 270
10 3300033180 Ga0307510_10010171 Ga0307510_100101716 270
11 3300046507 Ga0495606_0012300 Ga0495606_0012300_5871_6695 270
12 3300046616 Ga0495668_0132013 Ga0495668_0132013_167_991 270
13 3300046648 Ga0495611_0000047 Ga0495611_0000047_68624_69448 270
14 3300053092 Ga0500583_0013334 Ga0500583_0013334_656_1480 270
15 iso_pu_bacteria 2585428115 2587941554 270
16 iso_pu_bacteria 2585428183 2588215134 270
17 iso_pu_bacteria 2585428184 2588218307 270
18 iso_pu_bacteria 2585428185 2588222373 270
19 iso_pu_bacteria 2643221716 2644644401 270
20 iso_pu_bacteria 2818991444 2819587669 270
21 iso_pu_bacteria 2842722452 2842724763 270
22 iso_pu_bacteria 2842909656 2842913211 270
23 3300005614 Ga0068856_100052784 Ga0068856_1000527844 271
24 3300026078 Ga0207702_10148965 Ga0207702_101489652 271
25 3300048925 Ga0496122_0119517 Ga0496122_0119517_128_979 271
26 iso_pu_bacteria 2599185184 2599476822 271
27 iso_pu_bacteria 2738541278 2738726876 271
28 iso_pu_bacteria 2739367857 2740001083 271
29 iso_pu_bacteria 2739367858 2740005899 271
30 iso_pu_bacteria 2818991437 2819549374 271
31 iso_pu_bacteria 2842903701 2842904616 271
32 iso_pu_bacteria 2849281842 2849285515 271
33 iso_pu_bacteria 2857618242 2857618474 271
34 iso_pu_bacteria 2928078545 2928078730 271
35 iso_pu_bacteria 2928147474 2928151591 271
36 iso_pu_bacteria 2932082852 2932084224 271
37 iso_pu_bacteria 2954016120 2954018594 271
38 iso_pu_bacteria 2958512119 2958514568 271
39 3300003316 rootH1_10029800 rootH1_100298005 272
40 3300003322 rootL2_10045789 rootL2_100457892 272
41 3300003323 rootH1_10089383 rootH1_100893832 272
42 3300003323 rootH1_10308546 rootH1_103085462 272
43 3300003794 Ga0055531_10000209 Ga0055531_1000020930 272
44 3300015265 Ga0182005_1000093 Ga0182005_100009358 272
45 3300021361 Ga0213872_10007012 Ga0213872_100070124 272
46 3300021377 Ga0213874_10007594 Ga0213874_100075942 272
47 3300025208 Ga0209436_104884 Ga0209436_1048844 272
48 3300025302 Ga0207426_1006142 Ga0207426_10061426 272
49 3300025304 Ga0209257_1000001 Ga0209257_100000130 272
50 3300037853 Ga0436364_0438622 Ga0436364_0438622_18_848 272
51 3300039437 Ga0436365_1305508 Ga0436365_1305508_8614_9465 272
52 3300039438 Ga0436360_0090176 Ga0436360_0090176_275_1105 272
53 3300039447 Ga0436361_0544042 Ga0436361_0544042_49_879 272
54 3300039450 Ga0436363_1204833 Ga0436363_1204833_2111_2941 272
55 3300044735 Ga0466968_0099581 Ga0466968_0099581_427_1248 272
56 3300048922 Ga0496119_0024158 Ga0496119_0024158_3272_4105 272
57 3300048923 Ga0496120_0011632 Ga0496120_0011632_4519_5352 272
58 3300048924 Ga0496121_0000010 Ga0496121_0000010_491985_492815 272
59 3300048924 Ga0496121_0273727 Ga0496121_0273727_33_866 272
60 3300048928 Ga0496125_0242525 Ga0496125_0242525_120_953 272
61 3300048929 Ga0496126_0006541 Ga0496126_0006541_6405_7226 272
62 3300049758 Ga0501241_020740 Ga0501241_020740_191_1018 272
63 3300053160 Ga0500633_0000516 Ga0500633_0000516_1778_2596 272
64 3300053161 Ga0500634_0100321 Ga0500634_0100321_329_1147 272
65 iso_pu_bacteria 2721755487 2722729574 272
66 iso_pu_bacteria 2945977869 2945983197 272
67 iso_pu_bacteria 2946013367 2946017412 272
68 3300009093 Ga0105240_10000107 Ga0105240_1000010762 273
69 3300009093 Ga0105240_10000180 Ga0105240_1000018030 273
70 3300009545 Ga0105237_10456561 Ga0105237_104565611 273
71 3300025913 Ga0207695_10000077 Ga0207695_1000007779 273
72 3300025913 Ga0207695_10000199 Ga0207695_1000019982 273
73 3300025914 Ga0207671_10281501 Ga0207671_102815011 273
74 3300005337 Ga0070682_100000822 Ga0070682_1000008228 274
75 3300005347 Ga0070668_100172990 Ga0070668_1001729901 274
76 3300013104 Ga0157370_10024176 Ga0157370_100241766 274
77 3300013104 Ga0157370_10232803 Ga0157370_102328033 274
78 3300013308 Ga0157375_10000136 Ga0157375_1000013632 274
79 3300042004 Ga0439445_0000026 Ga0439445_0000026_7407_8237 274
80 3300046538 Ga0495609_0000119 Ga0495609_0000119_73176_74006 274
81 3300046558 Ga0495633_0000002 Ga0495633_0000002_391965_392801 274
82 3300048907 Ga0496104_0242214 Ga0496104_0242214_247_1077 274
83 3300048919 Ga0496116_0000006 Ga0496116_0000006_728193_729023 274
84 3300048920 Ga0496117_0000023 Ga0496117_0000023_278224_279054 274
85 3300048921 Ga0496118_0000660 Ga0496118_0000660_35738_36568 274
86 3300048922 Ga0496119_0000010 Ga0496119_0000010_159538_160368 274
87 3300048924 Ga0496121_0023973 Ga0496121_0023973_3355_4215 274
88 3300048925 Ga0496122_0000166 Ga0496122_0000166_30584_31414 274
89 3300048926 Ga0496123_0000294 Ga0496123_0000294_3244_4074 274
90 3300048927 Ga0496124_0001583 Ga0496124_0001583_17220_18050 274
91 3300048928 Ga0496125_0005162 Ga0496125_0005162_10300_11130 274
92 3300048929 Ga0496126_0001004 Ga0496126_0001004_2749_3576 274
93 3300048929 Ga0496126_0168178 Ga0496126_0168178_729_1556 274
94 iso_pu_bacteria 2919692658 2919692970 274
95 3300002067 JGI24735J21928_10000006 JGI24735J21928_1000000620 275
96 3300003316 rootH1_10015086 rootH1_100150862 275
97 3300003316 rootH1_10187570 rootH1_101875701 275
98 3300003320 rootH2_10013175 rootH2_100131752 275
99 3300003320 rootH2_10048046 rootH2_100480463 275
100 3300003322 rootL2_10030141 rootL2_100301415 275
101 3300003322 rootL2_10080919 rootL2_100809193 275
102 3300003322 rootL2_10100018 rootL2_101000184 275
103 3300003322 rootL2_10216907 rootL2_102169073 275
104 3300003322 rootL2_10265295 rootL2_102652952 275
105 3300003322 rootL2_10326353 rootL2_103263532 275
106 3300003323 rootH1_10001790 rootH1_1000179016 275
107 3300003323 rootH1_10040447 rootH1_100404479 275
108 3300003323 rootH1_10045208 rootH1_100452085 275
109 3300003323 rootH1_10107863 rootH1_101078635 275
110 3300003323 rootH1_10145361 rootH1_101453617 275
111 3300003354 JGI25160J50197_1001462 JGI25160J50197_10014627 275
112 3300003794 Ga0055531_10003213 Ga0055531_1000321310 275
113 3300005288 Ga0065714_10065202 Ga0065714_100652022 275
114 3300005288 Ga0065714_10089838 Ga0065714_100898382 275
115 3300005293 Ga0065715_10296521 Ga0065715_102965211 275
116 3300005331 Ga0070670_100013104 Ga0070670_1000131047 275
117 3300005334 Ga0068869_100269216 Ga0068869_1002692162 275
118 3300005365 Ga0070688_100210655 Ga0070688_1002106552 275
119 3300005367 Ga0070667_100621978 Ga0070667_1006219781 275
120 3300005457 Ga0070662_100260431 Ga0070662_1002604312 275
121 3300005539 Ga0068853_100091918 Ga0068853_1000919182 275
122 3300005539 Ga0068853_100430080 Ga0068853_1004300802 275
123 3300005548 Ga0070665_100008203 Ga0070665_1000082039 275
124 3300005563 Ga0068855_100024483 Ga0068855_1000244832 275
125 3300005577 Ga0068857_100094931 Ga0068857_1000949312 275
126 3300005577 Ga0068857_100258193 Ga0068857_1002581932 275
127 3300005578 Ga0068854_100593839 Ga0068854_1005938391 275
128 3300005614 Ga0068856_100151138 Ga0068856_1001511383 275
129 3300005834 Ga0068851_10055792 Ga0068851_100557922 275
130 3300009036 Ga0105244_10024612 Ga0105244_100246121 275
131 3300009093 Ga0105240_10000010 Ga0105240_10000010298 275
132 3300009093 Ga0105240_10010151 Ga0105240_100101513 275
133 3300009093 Ga0105240_10031451 Ga0105240_100314514 275
134 3300009093 Ga0105240_10065352 Ga0105240_100653521 275
135 3300009093 Ga0105240_10708018 Ga0105240_107080181 275
136 3300009174 Ga0105241_10048852 Ga0105241_100488522 275
137 3300009174 Ga0105241_10168407 Ga0105241_101684072 275
138 3300009545 Ga0105237_10001190 Ga0105237_100011902 275
139 3300009545 Ga0105237_10009697 Ga0105237_1000969710 275
140 3300009545 Ga0105237_10071490 Ga0105237_100714905 275
141 3300009545 Ga0105237_10237900 Ga0105237_102379002 275
142 3300009545 Ga0105237_10258702 Ga0105237_102587022 275
143 3300009545 Ga0105237_10806564 Ga0105237_108065641 275
144 3300009551 Ga0105238_10010754 Ga0105238_100107547 275
145 3300009551 Ga0105238_10037569 Ga0105238_100375695 275
146 3300010375 Ga0105239_10000011 Ga0105239_10000011232 275
147 3300010375 Ga0105239_10000137 Ga0105239_1000013756 275
148 3300010375 Ga0105239_10001971 Ga0105239_1000197113 275
149 3300010375 Ga0105239_10008948 Ga0105239_100089488 275
150 3300010375 Ga0105239_10012557 Ga0105239_1001255711 275
151 3300010375 Ga0105239_10219787 Ga0105239_102197871 275
152 3300013100 Ga0157373_10022175 Ga0157373_100221755 275
153 3300013100 Ga0157373_10045674 Ga0157373_100456743 275
154 3300013102 Ga0157371_10001868 Ga0157371_100018682 275
155 3300013102 Ga0157371_10022518 Ga0157371_100225184 275
156 3300013104 Ga0157370_10023182 Ga0157370_100231825 275
157 3300013104 Ga0157370_10385312 Ga0157370_103853122 275
158 3300013104 Ga0157370_10592504 Ga0157370_105925042 275
159 3300013104 Ga0157370_10618142 Ga0157370_106181421 275
160 3300013105 Ga0157369_10000008 Ga0157369_10000008219 275
161 3300013105 Ga0157369_10036170 Ga0157369_100361703 275
162 3300013296 Ga0157374_10021390 Ga0157374_100213906 275
163 3300013307 Ga0157372_10016357 Ga0157372_100163577 275
164 3300013307 Ga0157372_10137823 Ga0157372_101378233 275
165 3300015261 Ga0182006_1000407 Ga0182006_10004073 275
166 3300015262 Ga0182007_10000003 Ga0182007_1000000340 275
167 3300015682 Ga0183373_1001 Ga0183373_1001929 275
168 3300017792 Ga0163161_10000124 Ga0163161_1000012437 275
169 3300017792 Ga0163161_10001012 Ga0163161_100010122 275
170 3300017792 Ga0163161_10001837 Ga0163161_100018375 275
171 3300017792 Ga0163161_10055209 Ga0163161_100552092 275
172 3300017792 Ga0163161_10411571 Ga0163161_104115712 275
173 3300025231 Ga0207427_100198 Ga0207427_10019847 275
174 3300025233 Ga0209437_100008 Ga0209437_100008338 275
175 3300025261 Ga0209233_1000024 Ga0209233_1000024320 275
176 3300025302 Ga0207426_1000002 Ga0207426_1000002677 275
177 3300025304 Ga0209257_1000005 Ga0209257_10000051048 275
178 3300025904 Ga0207647_10000717 Ga0207647_1000071716 275
179 3300025911 Ga0207654_10004338 Ga0207654_100043382 275
180 3300025911 Ga0207654_10023272 Ga0207654_100232723 275
181 3300025913 Ga0207695_10000019 Ga0207695_10000019157 275
182 3300025913 Ga0207695_10000456 Ga0207695_1000045625 275
183 3300025913 Ga0207695_10010126 Ga0207695_100101269 275
184 3300025913 Ga0207695_10054586 Ga0207695_100545863 275
185 3300025913 Ga0207695_10157732 Ga0207695_101577321 275
186 3300025914 Ga0207671_10000667 Ga0207671_1000066745 275
187 3300025914 Ga0207671_10026867 Ga0207671_100268674 275
188 3300025925 Ga0207650_10104080 Ga0207650_101040802 275
189 3300025942 Ga0207689_10224517 Ga0207689_102245172 275
190 3300025949 Ga0207667_10033870 Ga0207667_100338708 275
191 3300025960 Ga0207651_10348089 Ga0207651_103480892 275
192 3300025986 Ga0207658_10585679 Ga0207658_105856791 275
193 3300026041 Ga0207639_10082847 Ga0207639_100828472 275
194 3300026078 Ga0207702_10007446 Ga0207702_100074464 275
195 3300026078 Ga0207702_10151489 Ga0207702_101514892 275
196 3300026116 Ga0207674_10043459 Ga0207674_100434595 275
197 3300026116 Ga0207674_10282326 Ga0207674_102823262 275
198 3300028379 Ga0268266_10004384 Ga0268266_1000438414 275
199 3300028794 Ga0307515_10001098 Ga0307515_100010988 275
200 3300030731 Ga0316177_1187600 Ga0316177_118760015 275
201 3300030732 Ga0316176_1209502 Ga0316176_12095025 275
202 3300030742 Ga0316183_1006572 Ga0316183_10065722 275
203 3300030744 Ga0316181_1206017 Ga0316181_12060176 275
204 3300031251 Ga0265327_10000055 Ga0265327_1000005561 275
205 3300031456 Ga0307513_10067999 Ga0307513_100679993 275
206 3300031731 Ga0307405_10000008 Ga0307405_10000008248 275
207 3300031824 Ga0307413_10039939 Ga0307413_100399393 275
208 3300031903 Ga0307407_10000026 Ga0307407_1000002680 275
209 3300032002 Ga0307416_100000053 Ga0307416_10000005380 275
210 3300032004 Ga0307414_10060732 Ga0307414_100607322 275
211 3300032005 Ga0307411_10000001 Ga0307411_10000001538 275
212 3300041411 Ga0439466_0013715 Ga0439466_0013715_507_1346 275
213 3300042007 Ga0439449_0019390 Ga0439449_0019390_344_1195 275
214 3300044658 Ga0466972_0000056 Ga0466972_0000056_4600_5442 275
215 3300044765 Ga0466970_0001706 Ga0466970_0001706_8995_9993 275
216 3300044765 Ga0466970_0127890 Ga0466970_0127890_258_1085 275
217 3300044842 Ga0466957_0000009 Ga0466957_0000009_16602_17444 275
218 3300045049 Ga0466959_0164700 Ga0466959_0164700_350_1210 275
219 3300046507 Ga0495606_0003837 Ga0495606_0003837_10473_11324 275
220 3300046507 Ga0495606_0011225 Ga0495606_0011225_3199_4062 275
221 3300046507 Ga0495606_0017985 Ga0495606_0017985_1370_2248 275
222 3300046507 Ga0495606_0075613 Ga0495606_0075613_1003_1845 275
223 3300046512 Ga0495610_0000047 Ga0495610_0000047_147556_148422 275
224 3300046512 Ga0495610_0000747 Ga0495610_0000747_5556_6416 275
225 3300046519 Ga0495632_0064620 Ga0495632_0064620_381_1223 275
226 3300046525 Ga0495663_0001503 Ga0495663_0001503_1761_2639 275
227 3300046558 Ga0495633_0025013 Ga0495633_0025013_1454_2296 275
228 3300046660 Ga0495625_0062264 Ga0495625_0062264_440_1324 275
229 3300046810 Ga0495660_0018318 Ga0495660_0018318_2850_3713 275
230 3300047472 Ga0495686_0020446 Ga0495686_0020446_401_1282 275
231 3300047472 Ga0495686_0025806 Ga0495686_0025806_1180_2022 275
232 3300048918 Ga0496115_0035305 Ga0496115_0035305_61_903 275
233 3300048920 Ga0496117_0000938 Ga0496117_0000938_7267_8109 275
234 3300048921 Ga0496118_0030190 Ga0496118_0030190_2431_3273 275
235 3300048925 Ga0496122_0039913 Ga0496122_0039913_2234_3076 275
236 3300048926 Ga0496123_0036177 Ga0496123_0036177_496_1395 275
237 3300049679 Ga0501249_004640 Ga0501249_004640_1562_2401 275
238 3300049686 Ga0501257_004803 Ga0501257_004803_1380_2246 275
239 3300049705 Ga0501225_0004131 Ga0501225_0004131_1041_1892 275
240 3300049763 Ga0501266_000016 Ga0501266_000016_54951_55790 275
241 3300053086 Ga0500578_0000012 Ga0500578_0000012_119146_119988 275
242 3300053090 Ga0500646_0016731 Ga0500646_0016731_284_1126 275
243 3300053109 Ga0500569_005569 Ga0500569_005569_1156_1998 275
244 3300053125 Ga0500618_000023 Ga0500618_000023_16412_17260 275
245 3300053134 Ga0500658_0000826 Ga0500658_0000826_5886_6728 275
246 3300053142 Ga0500577_0000320 Ga0500577_0000320_1671_2513 275
247 3300053153 Ga0500616_0026802 Ga0500616_0026802_812_1654 275
248 3300053156 Ga0500622_0000007 Ga0500622_0000007_35627_36469 275
249 3300053156 Ga0500622_0000449 Ga0500622_0000449_6936_7778 275
250 3300055283 Ga0500661_001022 Ga0500661_001022_1263_2102 275
251 iso_pu_bacteria 2965320100 2965321506 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

65

254

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

71

264

0.95

PF08659

KR

KR domain

66

235

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zzp-assembly1.cif.gz_B-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and 3-oxovalerate 0.9539 7 183
6zzp-assembly2.cif.gz_D-3 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and 3-oxovalerate 0.9538 7 183
6zzo-assembly1.cif.gz_A-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.9537 7 183
6zzo-assembly1.cif.gz_B crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.947 4 183
6le3-assembly1.cif.gz_E crystal structure of gluconate 5-dehydrogenase from lentibacter algarum 0.932 7 183
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9788 88 183 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9446 7 166 3.40.50.720
af_Q54G79_5_301_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9355 6 275 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9275 7 184 3.40.50.720
af_Q54WA9_4_295_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9246 5 275 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A530M320-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9847 5 184 GO:0016491
AF-A0A4Q6BSI7-F1-model_v4 SDR family oxidoreductase 0.9803 4 184 GO:0016491
AF-A0A1I2KKL1-F1-model_v4 Short-chain dehydrogenase 0.9769 2 183 GO:0016491
AF-A0A4Q6BSI7-F1-model_v4 SDR family oxidoreductase 0.975 4 184 GO:0016491
AF-A0A0N7Z5W0-F1-model_v4 Dehydrogenase 0.9738 3 179 GO:0016491

Feature Viewer

pLDDT pTM Quality
90.66 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map