F362761

General Info

Members Datasets Scaffolds Average Seq Length
251 180 502 98

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0551430|Ga0501042_0551430_182_451
Length 89
Sequence MPSVAEDKLIREAAKSDRDAQPLTAKQLKAMIPMRSVGRPKSENKKLLVSVRYSPEVVSYFKSTGEGWQSRMDSVLRAYVARHSRKSPN

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
132 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
133 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
134 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
165 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
166 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
167 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
168 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
169 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
174 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
177 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
178 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
179 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
180 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 0
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.73
Nodule 0
Rhizoplane 5.18
Rhizosphere 66.53
Stem 0
Stem Tuber 0
Unclassified 23.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0551430 3300049578 Unclassified 838
2 JGI25156J39149_1018440 3300002705 Bacteria 1288
3 Ga0055535_1000229 3300003761 Bacteria 58945
4 Ga0055529_1000064 3300003763 Bacteria 178831
5 Ga0068869_100020241 3300005334 Bacteria 4561
6 Ga0070666_10258657 3300005335 Bacteria 1234
7 Ga0070680_100353928 3300005336 Unclassified 1249
8 Ga0070680_100613353 3300005336 Bacteria 934
9 Ga0070691_10049873 3300005341 Bacteria 1996
10 Ga0070687_100575125 3300005343 Bacteria 770
11 Ga0070692_10049725 3300005345 Bacteria 2175
12 Ga0070668_100538438 3300005347 Unclassified 1015
13 Ga0070674_100210609 3300005356 Bacteria 1506
14 Ga0070701_10056690 3300005438 Bacteria 2051
15 Ga0070711_100000013 3300005439 Bacteria 161148
16 Ga0070705_100451710 3300005440 Bacteria 964
17 Ga0070700_100094728 3300005441 Bacteria 1955
18 Ga0070700_100201579 3300005441 Unclassified 1398
19 Ga0070700_101027317 3300005441 Bacteria 679
20 Ga0070708_100082185 3300005445 Unclassified 2918
21 Ga0070708_100437395 3300005445 Unclassified 1234
22 Ga0070678_100064114 3300005456 Bacteria 2722
23 Ga0070681_10442538 3300005458 Unclassified 1211
24 Ga0070699_100000018 3300005518 Bacteria 190128
25 Ga0070699_100679601 3300005518 Bacteria 940
26 Ga0070679_101569358 3300005530 Unclassified 606
27 Ga0070672_101313309 3300005543 Unclassified 646
28 Ga0070686_100001364 3300005544 Bacteria 13810
29 Ga0070686_100120068 3300005544 Bacteria 1803
30 Ga0070686_100447391 3300005544 Bacteria 992
31 Ga0070696_100000268 3300005546 Bacteria 31326
32 Ga0070693_100185048 3300005547 Archaea 1343
33 Ga0070693_101248841 3300005547 Unclassified 572
34 Ga0070665_100226515 3300005548 Bacteria 1870
35 Ga0070702_101845527 3300005615 Unclassified 506
36 Ga0068859_100297217 3300005617 Unclassified 1708
37 Ga0068864_101388342 3300005618 Bacteria 704
38 Ga0068866_10002362 3300005718 Bacteria 7829
39 Ga0068861_100053747 3300005719 Bacteria 3066
40 Ga0068861_100073674 3300005719 Bacteria 2653
41 Ga0068861_100554062 3300005719 Bacteria 1048
42 Ga0068858_100046518 3300005842 Bacteria 4022
43 Ga0068860_100202556 3300005843 Bacteria 1924
44 Ga0068860_101070023 3300005843 Bacteria 825
45 Ga0068862_100062896 3300005844 Bacteria 3193
46 Ga0068862_100203801 3300005844 Bacteria 1785
47 Ga0068862_100450109 3300005844 Bacteria 1214
48 Ga0081539_10193479 3300005985 Bacteria 945
49 Ga0075365_10064600 3300006038 Bacteria 2452
50 Ga0075368_10012018 3300006042 Bacteria 3161
51 Ga0075363_100071995 3300006048 Bacteria 1879
52 Ga0075364_10072566 3300006051 Bacteria 2268
53 Ga0075362_10028919 3300006177 Bacteria 2384
54 Ga0075362_10568529 3300006177 Bacteria 584
55 Ga0075367_10030192 3300006178 Bacteria 3106
56 Ga0075369_10080132 3300006186 Unclassified 1447
57 Ga0075366_10087812 3300006195 Bacteria 1862
58 Ga0075366_10690530 3300006195 Bacteria 634
59 Ga0075370_10301276 3300006353 Unclassified 953
60 Ga0075433_10968365 3300006852 Unclassified 741
61 Ga0075434_100046084 3300006871 Bacteria 4327
62 Ga0068865_100022904 3300006881 Bacteria 4082
63 Ga0068865_100322437 3300006881 Bacteria 1243
64 Ga0097620_100297221 3300006931 Unclassified 1708
65 Ga0097620_100766016 3300006931 Bacteria 1054
66 Ga0075435_100106336 3300007076 Bacteria 2330
67 Ga0075435_101662629 3300007076 Unclassified 560
68 Ga0105245_10001278 3300009098 Bacteria 22694
69 Ga0105247_10308727 3300009101 Bacteria 1100
70 Ga0114129_12756998 3300009147 Unclassified 585
71 Ga0105243_10001917 3300009148 Bacteria 17737
72 Ga0105242_11126691 3300009176 Bacteria 800
73 Ga0105242_11162370 3300009176 Archaea 789
74 Ga0105248_10198293 3300009177 Bacteria 2262
75 Ga0105248_11019117 3300009177 Unclassified 935
76 Ga0105249_10665591 3300009553 Unclassified 1099
77 Ga0105239_11114249 3300010375 Unclassified 909
78 Ga0105246_10146976 3300011119 Unclassified 1780
79 Ga0105246_11144691 3300011119 Archaea 713
80 Ga0157378_10038631 3300013297 Bacteria 4231
81 Ga0157378_10252071 3300013297 Unclassified 1690
82 Ga0157378_10320647 3300013297 Archaea 1505
83 Ga0157378_12837734 3300013297 Bacteria 537
84 Ga0163162_10261554 3300013306 Bacteria 1862
85 Ga0163162_10320062 3300013306 Unclassified 1684
86 Ga0163162_10483619 3300013306 Bacteria 1369
87 Ga0157375_10173999 3300013308 Bacteria 2302
88 Ga0157375_10187847 3300013308 Bacteria 2220
89 Ga0157375_10921472 3300013308 Archaea 1017
90 Ga0163163_10762758 3300014325 Bacteria 1031
91 Ga0157380_10120491 3300014326 Bacteria 2222
92 Ga0157379_10085076 3300014968 Bacteria 2834
93 Ga0157376_11593113 3300014969 Archaea 687
94 Ga0163161_10408131 3300017792 Bacteria 1090
95 Ga0213872_10010639 3300021361 Bacteria 4372
96 Ga0209672_112151 3300025228 Bacteria 1079
97 Ga0209258_100124 3300025242 Bacteria 178883
98 Ga0209646_1048936 3300025246 Bacteria 508
99 Ga0209148_1017844 3300025254 Bacteria 1199
100 Ga0209759_1000652 3300025256 Bacteria 32306
101 Ga0209455_1000114 3300025272 Bacteria 178883
102 Ga0207710_10234592 3300025900 Bacteria 914
103 Ga0207680_10119680 3300025903 Bacteria 1720
104 Ga0207684_10741851 3300025910 Unclassified 833
105 Ga0207695_10045090 3300025913 Bacteria 4684
106 Ga0207671_10013725 3300025914 Bacteria 6433
107 Ga0207663_10000020 3300025916 Bacteria 137200
108 Ga0207660_10247725 3300025917 Bacteria 1406
109 Ga0207694_10025809 3300025924 Bacteria 4467
110 Ga0207687_10016198 3300025927 Bacteria 4894
111 Ga0207686_10188533 3300025934 Bacteria 1468
112 Ga0207709_10052302 3300025935 Unclassified 2508
113 Ga0207704_10010456 3300025938 Unclassified 4529
114 Ga0207704_10226177 3300025938 Bacteria 1388
115 Ga0207711_10235193 3300025941 Unclassified 1679
116 Ga0207689_10001736 3300025942 Bacteria 20587
117 Ga0207689_11102163 3300025942 Unclassified 669
118 Ga0207712_10410505 3300025961 Bacteria 1140
119 Ga0207712_11182480 3300025961 Bacteria 682
120 Ga0207668_10482623 3300025972 Unclassified 1063
121 Ga0207677_11018221 3300026023 Unclassified 752
122 Ga0207677_11029024 3300026023 Unclassified 748
123 Ga0207703_10058681 3300026035 Bacteria 3141
124 Ga0207639_10308134 3300026041 Bacteria 1402
125 Ga0207708_10000767 3300026075 Bacteria 24167
126 Ga0207708_10208171 3300026075 Unclassified 1562
127 Ga0207676_10516109 3300026095 Unclassified 1137
128 Ga0207675_100002917 3300026118 Bacteria 16822
129 Ga0207675_100084843 3300026118 Bacteria 2972
130 Ga0207675_100530672 3300026118 Bacteria 1174
131 Ga0209813_10031764 3300027866 Bacteria 1561
132 Ga0268266_10145986 3300028379 Bacteria 2127
133 Ga0268265_10155243 3300028380 Bacteria 1936
134 Ga0268264_10096365 3300028381 Bacteria 2562
135 Ga0268264_10299920 3300028381 Unclassified 1512
136 Ga0268264_12681865 3300028381 Archaea 502
137 Ga0265318_10026609 3300028577 Bacteria 2277
138 Ga0265318_10076085 3300028577 Bacteria 1242
139 Ga0265336_10000693 3300028666 Bacteria 18092
140 Ga0307515_10043730 3300028794 Bacteria 6951
141 Ga0307515_10061100 3300028794 Bacteria 5355
142 Ga0307515_10473672 3300028794 Bacteria 865
143 Ga0307515_10585738 3300028794 Bacteria 725
144 Ga0265338_10237455 3300028800 Bacteria 1352
145 Ga0265330_10037656 3300031235 Bacteria 2153
146 Ga0265332_10035150 3300031238 Bacteria 2176
147 Ga0265328_10022636 3300031239 Bacteria 2389
148 Ga0265320_10251444 3300031240 Bacteria 784
149 Ga0265325_10000187 3300031241 Bacteria 44205
150 Ga0265325_10056883 3300031241 Bacteria 1996
151 Ga0265329_10097708 3300031242 Bacteria 933
152 Ga0265331_10020891 3300031250 Bacteria 3355
153 Ga0265331_10210761 3300031250 Unclassified 874
154 Ga0265331_10320051 3300031250 Bacteria 695
155 Ga0265327_10097599 3300031251 Bacteria 1423
156 Ga0265327_10323201 3300031251 Bacteria 676
157 Ga0265316_10280496 3300031344 Bacteria 1217
158 Ga0265316_10556885 3300031344 Unclassified 816
159 Ga0307513_10035218 3300031456 Bacteria 5605
160 Ga0307513_10105597 3300031456 Bacteria 2825
161 Ga0307513_10108920 3300031456 Bacteria 2769
162 Ga0307513_10181778 3300031456 Bacteria 1965
163 Ga0307513_10667299 3300031456 Bacteria 746
164 Ga0307509_10000543 3300031507 Bacteria 64572
165 Ga0265313_10209920 3300031595 Bacteria 807
166 Ga0307514_10240107 3300031649 Bacteria 1086
167 Ga0265314_10228302 3300031711 Bacteria 1081
168 Ga0265342_10189629 3300031712 Bacteria 1122
169 Ga0265342_10246615 3300031712 Unclassified 954
170 Ga0307405_10502335 3300031731 Bacteria 972
171 Ga0307518_10103032 3300031838 Bacteria 2041
172 Ga0307407_11569241 3300031903 Unclassified 522
173 Ga0316583_10011603 3300032133 Bacteria 3177
174 Ga0373941_0439351 3300035115 Bacteria 546
175 Ga0373933_0771528 3300035724 Unclassified 633
176 Ga0373947_0598501 3300035725 Unclassified 751
177 Ga0436361_0034992 3300039447 Bacteria 964
178 Ga0436361_0664428 3300039447 Bacteria 1187
179 Ga0436361_1061851 3300039447 Bacteria 60009
180 Ga0451789_0145920 3300041443 Bacteria 729
181 Ga0451789_0534057 3300041443 Bacteria 1218
182 Ga0451791_0545563 3300041451 Unclassified 523
183 Ga0451793_0036147 3300041452 Bacteria 1293
184 Ga0451795_0690884 3300041456 Bacteria 2597
185 Ga0451798_0715210 3300041458 Bacteria 2405
186 Ga0451798_1106042 3300041458 Bacteria 1280
187 Ga0451800_0432778 3300041459 Bacteria 521
188 Ga0451802_0111324 3300041460 Unclassified 791
189 Ga0451802_0455481 3300041460 Plasmid 2928
190 Ga0451802_1435764 3300041460 Bacteria 970
191 Ga0451804_0336405 3300041463 Bacteria 1013
192 Ga0451807_2623564 3300041486 Unclassified 707
193 Ga0451851_1303551 3300041507 Bacteria 517
194 Ga0451853_0829858 3300041512 Bacteria 3034
195 Ga0451853_1580546 3300041512 Unclassified 714
196 Ga0451853_3256090 3300041512 Bacteria 1030
197 Ga0451577_0003311 3300042876 Bacteria 18111
198 Ga0451577_0120723 3300042876 Bacteria 2347
199 Ga0453683_0260840 3300044673 Bacteria 1105
200 Ga0453684_0052484 3300044712 Bacteria 5330
201 Ga0453684_0100620 3300044712 Bacteria 3537
202 Ga0453684_2507273 3300044712 Unclassified 509
203 Ga0451576_0000042 3300045051 Bacteria 342102
204 Ga0451576_0000390 3300045051 Bacteria 102401
205 Ga0451576_0000781 3300045051 Bacteria 62611
206 Ga0495668_0416269 3300046616 Unclassified 739
207 Ga0496125_0000846 3300048928 Bacteria 49027
208 Ga0501067_0020947 3300049583 Bacteria 3617
209 Ga0501067_0030022 3300049583 Bacteria 3013
210 Ga0501068_0018922 3300049584 Bacteria 3992
211 Ga0501075_0005265 3300049591 Bacteria 8841
212 Ga0501077_0000807 3300049593 Bacteria 18991
213 Ga0501044_1030034 3300049823 Bacteria 694
214 nmdc:mga03683_474509_c1 3300050489 Bacteria 604
215 nmdc:mga03683_51414_c1 3300050489 Unclassified 1720
216 nmdc:mga03n38_274604_c1 3300050490 Bacteria 898
217 nmdc:mga00v17_183356_c1 3300050491 Unclassified 1351
218 nmdc:mga0yw44_408292_c1 3300050492 Unclassified 919
219 nmdc:mga0k408_103937_c1 3300050493 Bacteria 1676
220 nmdc:mga0k408_615666_c1 3300050493 Bacteria 640
221 nmdc:mga06z11_92496_c1 3300050494 Unclassified 1645
222 nmdc:mga04h51_53124_c1 3300050495 Bacteria 1366
223 nmdc:mga07m45_555700_c1 3300050496 Unclassified 664
224 nmdc:mga0n895_44084_c1 3300050512 Bacteria 4350
225 nmdc:mga0rr50_1652371_c1 3300050513 Unclassified 540
226 nmdc:mga0rr50_781514_c1 3300050513 Bacteria 815
227 nmdc:mga0sz30_77908_c1 3300050516 Unclassified 1432
228 Ga0500643_028730 3300053087 Bacteria 1718
229 Ga0500646_0329042 3300053090 Unclassified 553
230 Ga0500583_0224605 3300053092 Bacteria 931
231 Ga0500651_0269415 3300053093 Bacteria 985
232 Ga0500651_0407557 3300053093 Bacteria 762
233 Ga0500569_018183 3300053109 Bacteria 1811
234 Ga0500628_003162 3300053129 Bacteria 2709
235 Ga0500652_000120 3300053131 Bacteria 30196
236 Ga0500655_011121 3300053133 Bacteria 1629
237 Ga0500561_0011266 3300053137 Unclassified 1876
238 Ga0500561_0284173 3300053137 Unclassified 527
239 Ga0500577_0024681 3300053142 Bacteria 2025
240 Ga0500604_0060009 3300053151 Bacteria 1192
241 Ga0500622_0000028 3300053156 Bacteria 218994
242 Ga0500627_0158968 3300053158 Bacteria 1020
243 Ga0500627_0453980 3300053158 Bacteria 539
244 Ga0500570_120823 3300053724 Bacteria 1029
245 Ga0500611_122593 3300053727 Unclassified 694
246 Ga0501082_0000569 3300060353 Bacteria 32850
247 2587736427 2585428058 Bacteria 6853932
248 2643969777 2643221592 Bacteria 6608788
249 2644141362 2643221625 Bacteria 6512927
250 2644256317 2643221646 Bacteria 6433402
251 2644274331 2643221648 Bacteria 6521465
252 Ga0501042_0551430
253 JGI25156J39149_1018440
254 Ga0055535_1000229
255 Ga0055529_1000064
256 Ga0068869_100020241
257 Ga0070666_10258657
258 Ga0070680_100353928
259 Ga0070680_100613353
260 Ga0070691_10049873
261 Ga0070687_100575125
262 Ga0070692_10049725
263 Ga0070668_100538438
264 Ga0070674_100210609
265 Ga0070701_10056690
266 Ga0070711_100000013
267 Ga0070705_100451710
268 Ga0070700_100094728
269 Ga0070700_100201579
270 Ga0070700_101027317
271 Ga0070708_100082185
272 Ga0070708_100437395
273 Ga0070678_100064114
274 Ga0070681_10442538
275 Ga0070699_100000018
276 Ga0070699_100679601
277 Ga0070679_101569358
278 Ga0070672_101313309
279 Ga0070686_100001364
280 Ga0070686_100120068
281 Ga0070686_100447391
282 Ga0070696_100000268
283 Ga0070693_100185048
284 Ga0070693_101248841
285 Ga0070665_100226515
286 Ga0070702_101845527
287 Ga0068859_100297217
288 Ga0068864_101388342
289 Ga0068866_10002362
290 Ga0068861_100053747
291 Ga0068861_100073674
292 Ga0068861_100554062
293 Ga0068858_100046518
294 Ga0068860_100202556
295 Ga0068860_101070023
296 Ga0068862_100062896
297 Ga0068862_100203801
298 Ga0068862_100450109
299 Ga0081539_10193479
300 Ga0075365_10064600
301 Ga0075368_10012018
302 Ga0075363_100071995
303 Ga0075364_10072566
304 Ga0075362_10028919
305 Ga0075362_10568529
306 Ga0075367_10030192
307 Ga0075369_10080132
308 Ga0075366_10087812
309 Ga0075366_10690530
310 Ga0075370_10301276
311 Ga0075433_10968365
312 Ga0075434_100046084
313 Ga0068865_100022904
314 Ga0068865_100322437
315 Ga0097620_100297221
316 Ga0097620_100766016
317 Ga0075435_100106336
318 Ga0075435_101662629
319 Ga0105245_10001278
320 Ga0105247_10308727
321 Ga0114129_12756998
322 Ga0105243_10001917
323 Ga0105242_11126691
324 Ga0105242_11162370
325 Ga0105248_10198293
326 Ga0105248_11019117
327 Ga0105249_10665591
328 Ga0105239_11114249
329 Ga0105246_10146976
330 Ga0105246_11144691
331 Ga0157378_10038631
332 Ga0157378_10252071
333 Ga0157378_10320647
334 Ga0157378_12837734
335 Ga0163162_10261554
336 Ga0163162_10320062
337 Ga0163162_10483619
338 Ga0157375_10173999
339 Ga0157375_10187847
340 Ga0157375_10921472
341 Ga0163163_10762758
342 Ga0157380_10120491
343 Ga0157379_10085076
344 Ga0157376_11593113
345 Ga0163161_10408131
346 Ga0213872_10010639
347 Ga0209672_112151
348 Ga0209258_100124
349 Ga0209646_1048936
350 Ga0209148_1017844
351 Ga0209759_1000652
352 Ga0209455_1000114
353 Ga0207710_10234592
354 Ga0207680_10119680
355 Ga0207684_10741851
356 Ga0207695_10045090
357 Ga0207671_10013725
358 Ga0207663_10000020
359 Ga0207660_10247725
360 Ga0207694_10025809
361 Ga0207687_10016198
362 Ga0207686_10188533
363 Ga0207709_10052302
364 Ga0207704_10010456
365 Ga0207704_10226177
366 Ga0207711_10235193
367 Ga0207689_10001736
368 Ga0207689_11102163
369 Ga0207712_10410505
370 Ga0207712_11182480
371 Ga0207668_10482623
372 Ga0207677_11018221
373 Ga0207677_11029024
374 Ga0207703_10058681
375 Ga0207639_10308134
376 Ga0207708_10000767
377 Ga0207708_10208171
378 Ga0207676_10516109
379 Ga0207675_100002917
380 Ga0207675_100084843
381 Ga0207675_100530672
382 Ga0209813_10031764
383 Ga0268266_10145986
384 Ga0268265_10155243
385 Ga0268264_10096365
386 Ga0268264_10299920
387 Ga0268264_12681865
388 Ga0265318_10026609
389 Ga0265318_10076085
390 Ga0265336_10000693
391 Ga0307515_10043730
392 Ga0307515_10061100
393 Ga0307515_10473672
394 Ga0307515_10585738
395 Ga0265338_10237455
396 Ga0265330_10037656
397 Ga0265332_10035150
398 Ga0265328_10022636
399 Ga0265320_10251444
400 Ga0265325_10000187
401 Ga0265325_10056883
402 Ga0265329_10097708
403 Ga0265331_10020891
404 Ga0265331_10210761
405 Ga0265331_10320051
406 Ga0265327_10097599
407 Ga0265327_10323201
408 Ga0265316_10280496
409 Ga0265316_10556885
410 Ga0307513_10035218
411 Ga0307513_10105597
412 Ga0307513_10108920
413 Ga0307513_10181778
414 Ga0307513_10667299
415 Ga0307509_10000543
416 Ga0265313_10209920
417 Ga0307514_10240107
418 Ga0265314_10228302
419 Ga0265342_10189629
420 Ga0265342_10246615
421 Ga0307405_10502335
422 Ga0307518_10103032
423 Ga0307407_11569241
424 Ga0316583_10011603
425 Ga0373941_0439351
426 Ga0373933_0771528
427 Ga0373947_0598501
428 Ga0436361_0034992
429 Ga0436361_0664428
430 Ga0436361_1061851
431 Ga0451789_0145920
432 Ga0451789_0534057
433 Ga0451791_0545563
434 Ga0451793_0036147
435 Ga0451795_0690884
436 Ga0451798_0715210
437 Ga0451798_1106042
438 Ga0451800_0432778
439 Ga0451802_0111324
440 Ga0451802_0455481
441 Ga0451802_1435764
442 Ga0451804_0336405
443 Ga0451807_2623564
444 Ga0451851_1303551
445 Ga0451853_0829858
446 Ga0451853_1580546
447 Ga0451853_3256090
448 Ga0451577_0003311
449 Ga0451577_0120723
450 Ga0453683_0260840
451 Ga0453684_0052484
452 Ga0453684_0100620
453 Ga0453684_2507273
454 Ga0451576_0000042
455 Ga0451576_0000390
456 Ga0451576_0000781
457 Ga0495668_0416269
458 Ga0496125_0000846
459 Ga0501067_0020947
460 Ga0501067_0030022
461 Ga0501068_0018922
462 Ga0501075_0005265
463 Ga0501077_0000807
464 Ga0501044_1030034
465 nmdc:mga03683_474509_c1
466 nmdc:mga03683_51414_c1
467 nmdc:mga03n38_274604_c1
468 nmdc:mga00v17_183356_c1
469 nmdc:mga0yw44_408292_c1
470 nmdc:mga0k408_103937_c1
471 nmdc:mga0k408_615666_c1
472 nmdc:mga06z11_92496_c1
473 nmdc:mga04h51_53124_c1
474 nmdc:mga07m45_555700_c1
475 nmdc:mga0n895_44084_c1
476 nmdc:mga0rr50_1652371_c1
477 nmdc:mga0rr50_781514_c1
478 nmdc:mga0sz30_77908_c1
479 Ga0500643_028730
480 Ga0500646_0329042
481 Ga0500583_0224605
482 Ga0500651_0269415
483 Ga0500651_0407557
484 Ga0500569_018183
485 Ga0500628_003162
486 Ga0500652_000120
487 Ga0500655_011121
488 Ga0500561_0011266
489 Ga0500561_0284173
490 Ga0500577_0024681
491 Ga0500604_0060009
492 Ga0500622_0000028
493 Ga0500627_0158968
494 Ga0500627_0453980
495 Ga0500570_120823
496 Ga0500611_122593
497 Ga0501082_0000569
498 2587736427
499 2643969777
500 2644141362
501 2644256317
502 2644274331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14384

BrnA_antitoxin

BrnA antitoxin of type II toxin-antitoxin system

11

80

0.89

Map