F362727
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 251 | 195 | 251 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300048917|Ga0496114_0159895|Ga0496114_0159895_699_1244 |
| Length | 181 |
| Sequence | VEAGVRSSELTWERVSSAPEDNAMATVTIRVNGREVPVRAEGDTPLLWVLRDELGLTGTKFGCGKGLCGACTVHVNDAPVRSCSVAIGALSGRSVQTIEGMRGDVVAALRRAWIDESVPQCGYCQVGQVMSASALLRTTPSPNDEQIDAAMRGNICRCGTYPRIRAAIHRAARALASHAER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 21 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 22 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 23 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 25 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 30 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 31 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 33 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 45 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 46 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 71 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 72 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 73 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 74 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 75 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 76 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 77 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 78 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 79 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 80 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 81 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 82 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 83 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 84 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 85 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 86 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 87 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 88 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 89 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 90 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 91 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 92 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 94 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 95 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 96 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 97 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 98 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 99 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 100 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 101 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 102 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 103 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 104 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 105 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 180 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 181 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 182 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 183 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 188 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.21 |
| Metatranscriptomes | 2.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.99 |
| Nodule | 0 |
| Rhizoplane | 3.98 |
| Rhizosphere | 93.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058859_11522584 | 3300004798 | Bacteria | 2871 |
| 2 | Ga0070683_101748396 | 3300005329 | Bacteria | 598 |
| 3 | Ga0068869_100125085 | 3300005334 | Bacteria | 1971 |
| 4 | Ga0070689_100232091 | 3300005340 | Bacteria | 1517 |
| 5 | Ga0070689_100621578 | 3300005340 | Bacteria | 937 |
| 6 | Ga0070668_100278909 | 3300005347 | Bacteria | 1395 |
| 7 | Ga0070669_100998786 | 3300005353 | Bacteria | 718 |
| 8 | Ga0070674_100863356 | 3300005356 | Bacteria | 786 |
| 9 | Ga0070673_100935508 | 3300005364 | Bacteria | 805 |
| 10 | Ga0070659_100038772 | 3300005366 | Bacteria | 3717 |
| 11 | Ga0070659_100148646 | 3300005366 | Bacteria | 1910 |
| 12 | Ga0070713_100210196 | 3300005436 | Bacteria | 1761 |
| 13 | Ga0070710_10110079 | 3300005437 | Bacteria | 1653 |
| 14 | Ga0070711_100002430 | 3300005439 | Bacteria | 10613 |
| 15 | Ga0070700_100165627 | 3300005441 | Bacteria | 1526 |
| 16 | Ga0070694_100288686 | 3300005444 | Bacteria | 1253 |
| 17 | Ga0070708_100027509 | 3300005445 | Bacteria | 4881 |
| 18 | Ga0070708_100051841 | 3300005445 | Unclassified | 3636 |
| 19 | Ga0070708_100093838 | 3300005445 | Bacteria | 2737 |
| 20 | Ga0070706_101048307 | 3300005467 | Unclassified | 751 |
| 21 | Ga0070697_100000769 | 3300005536 | Bacteria | 23994 |
| 22 | Ga0070697_100668115 | 3300005536 | Unclassified | 916 |
| 23 | Ga0070704_100119682 | 3300005549 | Bacteria | 2020 |
| 24 | Ga0068855_100200433 | 3300005563 | Bacteria | 2247 |
| 25 | Ga0068859_100008782 | 3300005617 | Bacteria | 10202 |
| 26 | Ga0068859_100906409 | 3300005617 | Bacteria | 966 |
| 27 | Ga0068861_100000132 | 3300005719 | Bacteria | 38465 |
| 28 | Ga0068861_100194724 | 3300005719 | Bacteria | 1697 |
| 29 | Ga0068860_100039544 | 3300005843 | Bacteria | 4511 |
| 30 | Ga0081455_10078241 | 3300005937 | Bacteria | 2718 |
| 31 | Ga0081538_10013801 | 3300005981 | Bacteria | 6377 |
| 32 | Ga0081538_10350405 | 3300005981 | Bacteria | 535 |
| 33 | Ga0070717_10477866 | 3300006028 | Unclassified | 1125 |
| 34 | Ga0070715_10653929 | 3300006163 | Bacteria | 622 |
| 35 | Ga0070716_100005757 | 3300006173 | Bacteria | 6021 |
| 36 | Ga0070712_100003622 | 3300006175 | Bacteria | 9527 |
| 37 | Ga0075429_101201163 | 3300006880 | Bacteria | 662 |
| 38 | Ga0075436_100009340 | 3300006914 | Bacteria | 6706 |
| 39 | Ga0097620_100008783 | 3300006931 | Bacteria | 10202 |
| 40 | Ga0097620_100906447 | 3300006931 | Bacteria | 966 |
| 41 | Ga0075435_101286459 | 3300007076 | Unclassified | 640 |
| 42 | Ga0099794_10043719 | 3300007265 | Bacteria | 2139 |
| 43 | Ga0099794_10138435 | 3300007265 | Unclassified | 1232 |
| 44 | Ga0099794_10172963 | 3300007265 | Bacteria | 1101 |
| 45 | Ga0099794_10544180 | 3300007265 | Bacteria | 613 |
| 46 | Ga0105240_10004588 | 3300009093 | Bacteria | 20940 |
| 47 | Ga0105243_10241256 | 3300009148 | Bacteria | 1608 |
| 48 | Ga0105248_10004980 | 3300009177 | Bacteria | 14685 |
| 49 | Ga0105248_10005978 | 3300009177 | Bacteria | 13360 |
| 50 | Ga0105238_10070218 | 3300009551 | Bacteria | 3502 |
| 51 | Ga0105238_10312790 | 3300009551 | Bacteria | 1556 |
| 52 | Ga0105239_10088594 | 3300010375 | Bacteria | 3412 |
| 53 | Ga0105239_12298080 | 3300010375 | Bacteria | 627 |
| 54 | Ga0157378_10003357 | 3300013297 | Bacteria | 14241 |
| 55 | Ga0163162_10045428 | 3300013306 | Bacteria | 4400 |
| 56 | Ga0157375_10714465 | 3300013308 | Bacteria | 1155 |
| 57 | Ga0157380_11893733 | 3300014326 | Bacteria | 657 |
| 58 | Ga0157379_10487485 | 3300014968 | Bacteria | 1141 |
| 59 | Ga0213872_10007411 | 3300021361 | Bacteria | 5400 |
| 60 | Ga0213871_10032048 | 3300021441 | Bacteria | 1376 |
| 61 | Ga0207692_10090672 | 3300025898 | Bacteria | 1657 |
| 62 | Ga0207685_10142556 | 3300025905 | Bacteria | 1076 |
| 63 | Ga0207699_10357512 | 3300025906 | Bacteria | 1032 |
| 64 | Ga0207695_10014728 | 3300025913 | Bacteria | 9247 |
| 65 | Ga0207695_10061076 | 3300025913 | Bacteria | 3897 |
| 66 | Ga0207693_10003606 | 3300025915 | Bacteria | 13215 |
| 67 | Ga0207663_10001753 | 3300025916 | Bacteria | 10218 |
| 68 | Ga0207662_10120420 | 3300025918 | Bacteria | 1646 |
| 69 | Ga0207694_10096748 | 3300025924 | Bacteria | 2335 |
| 70 | Ga0207694_10485240 | 3300025924 | Bacteria | 1034 |
| 71 | Ga0207664_10067026 | 3300025929 | Unclassified | 2879 |
| 72 | Ga0207664_11077497 | 3300025929 | Bacteria | 719 |
| 73 | Ga0207690_10118061 | 3300025932 | Bacteria | 1922 |
| 74 | Ga0207690_10385662 | 3300025932 | Bacteria | 1114 |
| 75 | Ga0207686_10228186 | 3300025934 | Bacteria | 1348 |
| 76 | Ga0207709_10150877 | 3300025935 | Bacteria | 1609 |
| 77 | Ga0207670_10185890 | 3300025936 | Bacteria | 1568 |
| 78 | Ga0207665_10000092 | 3300025939 | Bacteria | 58290 |
| 79 | Ga0207711_10003036 | 3300025941 | Bacteria | 14671 |
| 80 | Ga0207689_10146431 | 3300025942 | Bacteria | 1946 |
| 81 | Ga0207661_11305568 | 3300025944 | Bacteria | 667 |
| 82 | Ga0207667_10897583 | 3300025949 | Bacteria | 878 |
| 83 | Ga0207651_11038568 | 3300025960 | Bacteria | 733 |
| 84 | Ga0207641_12137259 | 3300026088 | Bacteria | 560 |
| 85 | Ga0207675_100000071 | 3300026118 | Bacteria | 77575 |
| 86 | Ga0207675_100658116 | 3300026118 | Bacteria | 1054 |
| 87 | Ga0209588_1026893 | 3300027671 | Bacteria | 1829 |
| 88 | Ga0209588_1062029 | 3300027671 | Bacteria | 1209 |
| 89 | Ga0209588_1223903 | 3300027671 | Bacteria | 581 |
| 90 | Ga0209813_10235612 | 3300027866 | Bacteria | 690 |
| 91 | Ga0268264_10515256 | 3300028381 | Bacteria | 1168 |
| 92 | Ga0307408_100259413 | 3300031548 | Bacteria | 1438 |
| 93 | Ga0307408_100351600 | 3300031548 | Bacteria | 1251 |
| 94 | Ga0316575_10372603 | 3300031665 | Bacteria | 610 |
| 95 | Ga0316579_10011108 | 3300031691 | Bacteria | 3822 |
| 96 | Ga0307412_10638287 | 3300031911 | Bacteria | 907 |
| 97 | Ga0307409_100129579 | 3300031995 | Bacteria | 2153 |
| 98 | Ga0307414_10180370 | 3300032004 | Bacteria | 1698 |
| 99 | Ga0307411_12063426 | 3300032005 | Bacteria | 533 |
| 100 | Ga0307415_100180975 | 3300032126 | Bacteria | 1654 |
| 101 | Ga0373949_0000080 | 3300035090 | Bacteria | 35784 |
| 102 | Ga0373923_0086754 | 3300035111 | Bacteria | 1364 |
| 103 | Ga0373936_0462351 | 3300035113 | Bacteria | 587 |
| 104 | Ga0373953_0001525 | 3300035117 | Bacteria | 6727 |
| 105 | Ga0373954_0000189 | 3300035118 | Bacteria | 22316 |
| 106 | Ga0373956_0000794 | 3300035119 | Bacteria | 13119 |
| 107 | Ga0373957_0003434 | 3300035120 | Bacteria | 4683 |
| 108 | Ga0373960_0064213 | 3300035121 | Bacteria | 1120 |
| 109 | Ga0373946_0005493 | 3300035171 | Bacteria | 4574 |
| 110 | Ga0373955_0000598 | 3300035172 | Bacteria | 15387 |
| 111 | Ga0373961_0067504 | 3300035241 | Bacteria | 1099 |
| 112 | Ga0373927_0015095 | 3300035695 | Bacteria | 5107 |
| 113 | Ga0373933_0000275 | 3300035724 | Bacteria | 33474 |
| 114 | Ga0373947_0012202 | 3300035725 | Bacteria | 4920 |
| 115 | Ga0373937_0000123 | 3300036401 | Bacteria | 74156 |
| 116 | Ga0316582_0229734 | 3300036647 | Bacteria | 1270 |
| 117 | Ga0316584_0026171 | 3300036712 | Bacteria | 4286 |
| 118 | Ga0373925_0007175 | 3300037068 | Bacteria | 8144 |
| 119 | Ga0395905_0001477 | 3300037471 | Bacteria | 28144 |
| 120 | Ga0395905_0513905 | 3300037471 | Bacteria | 1098 |
| 121 | Ga0436360_0419454 | 3300039438 | Bacteria | 1328 |
| 122 | Ga0436361_0238025 | 3300039447 | Bacteria | 10372 |
| 123 | Ga0436363_0894292 | 3300039450 | Bacteria | 827 |
| 124 | Ga0436362_0452825 | 3300039453 | Bacteria | 904 |
| 125 | Ga0439450_052990 | 3300042008 | Bacteria | 968 |
| 126 | Ga0439446_0219262 | 3300042156 | Bacteria | 648 |
| 127 | Ga0466958_0243282 | 3300045836 | Bacteria | 1150 |
| 128 | Ga0466967_0654357 | 3300045976 | Bacteria | 1039 |
| 129 | Ga0495592_0069028 | 3300046454 | Bacteria | 2578 |
| 130 | Ga0495590_0275784 | 3300046457 | Bacteria | 629 |
| 131 | Ga0495651_0035782 | 3300046462 | Bacteria | 3866 |
| 132 | Ga0495584_0008163 | 3300046491 | Bacteria | 5437 |
| 133 | Ga0495584_0042541 | 3300046491 | Bacteria | 2293 |
| 134 | Ga0495584_0266967 | 3300046491 | Bacteria | 870 |
| 135 | Ga0495607_0098039 | 3300046501 | Bacteria | 1575 |
| 136 | Ga0495583_0013493 | 3300046506 | Bacteria | 4554 |
| 137 | Ga0495608_0007892 | 3300046511 | Bacteria | 7481 |
| 138 | Ga0495618_0074200 | 3300046514 | Bacteria | 2166 |
| 139 | Ga0495630_0003619 | 3300046517 | Bacteria | 10771 |
| 140 | Ga0495632_0000406 | 3300046519 | Bacteria | 40685 |
| 141 | Ga0495666_0021116 | 3300046526 | Bacteria | 3224 |
| 142 | Ga0495642_0049482 | 3300046528 | Bacteria | 1727 |
| 143 | Ga0495587_0000303 | 3300046536 | Bacteria | 35065 |
| 144 | Ga0495597_0071962 | 3300046542 | Bacteria | 1488 |
| 145 | Ga0495667_0290129 | 3300046559 | Bacteria | 1037 |
| 146 | Ga0495668_0054352 | 3300046616 | Bacteria | 2214 |
| 147 | Ga0495625_0004317 | 3300046660 | Bacteria | 13501 |
| 148 | Ga0495659_0001986 | 3300046664 | Bacteria | 6726 |
| 149 | Ga0495661_0004762 | 3300046665 | Bacteria | 9737 |
| 150 | Ga0495657_0123958 | 3300046675 | Bacteria | 1625 |
| 151 | Ga0495669_0000750 | 3300046684 | Bacteria | 13951 |
| 152 | Ga0495669_0036427 | 3300046684 | Bacteria | 2175 |
| 153 | Ga0495624_0021941 | 3300046690 | Bacteria | 4229 |
| 154 | Ga0495671_0059021 | 3300046692 | Bacteria | 1897 |
| 155 | Ga0495671_0292909 | 3300046692 | Bacteria | 783 |
| 156 | Ga0495649_0002473 | 3300046694 | Bacteria | 12989 |
| 157 | Ga0495589_0402677 | 3300046794 | Bacteria | 628 |
| 158 | Ga0495604_0000176 | 3300047317 | Bacteria | 56911 |
| 159 | Ga0495604_0100677 | 3300047317 | Bacteria | 2124 |
| 160 | Ga0495604_0118233 | 3300047317 | Unclassified | 1921 |
| 161 | Ga0495636_0001659 | 3300047318 | Bacteria | 8481 |
| 162 | Ga0495672_0001365 | 3300047320 | Bacteria | 24188 |
| 163 | Ga0495676_0047525 | 3300047321 | Bacteria | 3469 |
| 164 | Ga0495687_000317 | 3300047443 | Bacteria | 62824 |
| 165 | Ga0495687_014641 | 3300047443 | Bacteria | 4024 |
| 166 | Ga0495677_0002650 | 3300047445 | Bacteria | 6995 |
| 167 | Ga0495685_000943 | 3300047447 | Bacteria | 8806 |
| 168 | Ga0495681_0003109 | 3300047470 | Bacteria | 11645 |
| 169 | Ga0495684_0027365 | 3300047471 | Bacteria | 4378 |
| 170 | Ga0495602_0000362 | 3300048088 | Bacteria | 42468 |
| 171 | Ga0496101_0305137 | 3300048904 | Bacteria | 1247 |
| 172 | Ga0496101_1215242 | 3300048904 | Bacteria | 590 |
| 173 | Ga0496102_0011806 | 3300048905 | Bacteria | 7539 |
| 174 | Ga0496103_0087069 | 3300048906 | Bacteria | 1969 |
| 175 | Ga0496106_0053673 | 3300048909 | Bacteria | 3045 |
| 176 | Ga0496107_0147659 | 3300048910 | Bacteria | 1739 |
| 177 | Ga0496107_0161043 | 3300048910 | Bacteria | 1663 |
| 178 | Ga0496112_0055909 | 3300048915 | Bacteria | 3883 |
| 179 | Ga0496114_0159895 | 3300048917 | Bacteria | 1958 |
| 180 | Ga0496115_0018315 | 3300048918 | Bacteria | 5374 |
| 181 | Ga0501031_0003301 | 3300049568 | Bacteria | 10352 |
| 182 | Ga0501031_0582658 | 3300049568 | Bacteria | 720 |
| 183 | Ga0501033_0326009 | 3300049570 | Bacteria | 1078 |
| 184 | Ga0501034_0003870 | 3300049571 | Bacteria | 16848 |
| 185 | Ga0501036_0046217 | 3300049572 | Bacteria | 3686 |
| 186 | Ga0501036_0080512 | 3300049572 | Bacteria | 2753 |
| 187 | Ga0501037_0008470 | 3300049573 | Bacteria | 7540 |
| 188 | Ga0501038_0018893 | 3300049574 | Bacteria | 6221 |
| 189 | Ga0501038_0045317 | 3300049574 | Bacteria | 3818 |
| 190 | Ga0501039_0000793 | 3300049575 | Bacteria | 22771 |
| 191 | Ga0501039_0101674 | 3300049575 | Bacteria | 2243 |
| 192 | Ga0501040_0020485 | 3300049576 | Bacteria | 4407 |
| 193 | Ga0501041_0006656 | 3300049577 | Bacteria | 6768 |
| 194 | Ga0501042_0022097 | 3300049578 | Bacteria | 4441 |
| 195 | Ga0501043_0080269 | 3300049579 | Bacteria | 2563 |
| 196 | Ga0501043_0144217 | 3300049579 | Bacteria | 1864 |
| 197 | Ga0501046_0001994 | 3300049580 | Bacteria | 19385 |
| 198 | Ga0501046_0019849 | 3300049580 | Bacteria | 5566 |
| 199 | Ga0501047_0129938 | 3300049581 | Bacteria | 2399 |
| 200 | Ga0501048_0018663 | 3300049582 | Bacteria | 5099 |
| 201 | Ga0501048_0029236 | 3300049582 | Bacteria | 3998 |
| 202 | Ga0501067_0428842 | 3300049583 | Bacteria | 738 |
| 203 | Ga0501068_0030823 | 3300049584 | Bacteria | 3183 |
| 204 | Ga0501069_0021182 | 3300049585 | Bacteria | 3527 |
| 205 | Ga0501070_0008650 | 3300049586 | Bacteria | 8603 |
| 206 | Ga0501070_0175429 | 3300049586 | Bacteria | 1765 |
| 207 | Ga0501072_0009040 | 3300049588 | Bacteria | 7573 |
| 208 | Ga0501072_0012791 | 3300049588 | Bacteria | 6415 |
| 209 | Ga0501073_0001699 | 3300049589 | Bacteria | 16315 |
| 210 | Ga0501074_0010366 | 3300049590 | Bacteria | 6761 |
| 211 | Ga0501075_0017673 | 3300049591 | Bacteria | 5150 |
| 212 | Ga0501076_0006568 | 3300049592 | Bacteria | 8436 |
| 213 | Ga0501076_0323195 | 3300049592 | Bacteria | 1265 |
| 214 | Ga0501077_0037808 | 3300049593 | Bacteria | 3073 |
| 215 | Ga0501077_0399653 | 3300049593 | Bacteria | 878 |
| 216 | Ga0501077_0449809 | 3300049593 | Bacteria | 825 |
| 217 | Ga0501079_0002477 | 3300049741 | Bacteria | 13412 |
| 218 | Ga0501079_0043898 | 3300049741 | Bacteria | 3450 |
| 219 | Ga0501079_1300655 | 3300049741 | Bacteria | 572 |
| 220 | Ga0501080_0000034 | 3300049742 | Bacteria | 85093 |
| 221 | Ga0501080_0270940 | 3300049742 | Bacteria | 1545 |
| 222 | Ga0501081_0661914 | 3300049743 | Bacteria | 783 |
| 223 | Ga0501083_0028166 | 3300049744 | Bacteria | 3874 |
| 224 | Ga0501083_0142913 | 3300049744 | Bacteria | 1567 |
| 225 | Ga0501035_0038838 | 3300049822 | Bacteria | 4309 |
| 226 | Ga0501035_0575234 | 3300049822 | Bacteria | 920 |
| 227 | Ga0501044_0045948 | 3300049823 | Bacteria | 4522 |
| 228 | Ga0501045_0009687 | 3300049824 | Bacteria | 6740 |
| 229 | Ga0501045_0296449 | 3300049824 | Bacteria | 1203 |
| 230 | nmdc:mga03683_22807_c1 | 3300050489 | Bacteria | 2430 |
| 231 | nmdc:mga03n38_395501_c1 | 3300050490 | Bacteria | 760 |
| 232 | nmdc:mga0k408_31979_c1 | 3300050493 | Bacteria | 3006 |
| 233 | nmdc:mga07m45_45679_c1 | 3300050496 | Bacteria | 2459 |
| 234 | nmdc:mga08x19_180_c1 | 3300050514 | Bacteria | 50906 |
| 235 | Ga0495601_0070209 | 3300053077 | Bacteria | 2236 |
| 236 | Ga0495619_0016094 | 3300053085 | Bacteria | 4734 |
| 237 | Ga0495619_0268163 | 3300053085 | Unclassified | 1183 |
| 238 | Ga0501084_0001644 | 3300054114 | Bacteria | 17766 |
| 239 | Ga0501084_0023902 | 3300054114 | Bacteria | 5098 |
| 240 | Ga0590071_020396 | 3300059421 | Bacteria | 1561 |
| 241 | Ga0587077_138345 | 3300059493 | Bacteria | 625 |
| 242 | Ga0587067_081629 | 3300059640 | Bacteria | 717 |
| 243 | Ga0587068_051375 | 3300059641 | Bacteria | 772 |
| 244 | Ga0587079_235518 | 3300059647 | Bacteria | 515 |
| 245 | Ga0587119_020787 | 3300059658 | Bacteria | 837 |
| 246 | Ga0587071_152391 | 3300060344 | Bacteria | 576 |
| 247 | Ga0501082_0069892 | 3300060353 | Bacteria | 3023 |
| 248 | Ga0501082_0168754 | 3300060353 | Bacteria | 1902 |
| 249 | Ga0501082_0656678 | 3300060353 | Bacteria | 918 |
| 250 | Ga0530510_0013664 | 3300061734 | Bacteria | 5713 |
| 251 | Ga0530510_0450629 | 3300061734 | Bacteria | 973 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046559 | Ga0495667_0290129 | Ga0495667_0290129_619_1020 | 127 |
| 2 | 3300005340 | Ga0070689_100232091 | Ga0070689_1002320912 | 138 |
| 3 | 3300005340 | Ga0070689_100621578 | Ga0070689_1006215782 | 148 |
| 4 | 3300005356 | Ga0070674_100863356 | Ga0070674_1008633562 | 148 |
| 5 | 3300005563 | Ga0068855_100200433 | Ga0068855_1002004332 | 148 |
| 6 | 3300005617 | Ga0068859_100008782 | Ga0068859_1000087826 | 148 |
| 7 | 3300005719 | Ga0068861_100000132 | Ga0068861_10000013230 | 148 |
| 8 | 3300006931 | Ga0097620_100008783 | Ga0097620_1000087836 | 148 |
| 9 | 3300009093 | Ga0105240_10004588 | Ga0105240_100045882 | 148 |
| 10 | 3300009148 | Ga0105243_10241256 | Ga0105243_102412563 | 148 |
| 11 | 3300009177 | Ga0105248_10004980 | Ga0105248_100049809 | 148 |
| 12 | 3300010375 | Ga0105239_12298080 | Ga0105239_122980802 | 148 |
| 13 | 3300014326 | Ga0157380_11893733 | Ga0157380_118937331 | 148 |
| 14 | 3300014968 | Ga0157379_10487485 | Ga0157379_104874852 | 148 |
| 15 | 3300025913 | Ga0207695_10014728 | Ga0207695_100147282 | 148 |
| 16 | 3300025924 | Ga0207694_10485240 | Ga0207694_104852402 | 148 |
| 17 | 3300025935 | Ga0207709_10150877 | Ga0207709_101508773 | 148 |
| 18 | 3300025941 | Ga0207711_10003036 | Ga0207711_100030369 | 148 |
| 19 | 3300025949 | Ga0207667_10897583 | Ga0207667_108975832 | 148 |
| 20 | 3300026088 | Ga0207641_12137259 | Ga0207641_121372591 | 148 |
| 21 | 3300026118 | Ga0207675_100000071 | Ga0207675_10000007149 | 148 |
| 22 | 3300037471 | Ga0395905_0513905 | Ga0395905_0513905_94_570 | 148 |
| 23 | 3300005329 | Ga0070683_101748396 | Ga0070683_1017483961 | 149 |
| 24 | 3300005334 | Ga0068869_100125085 | Ga0068869_1001250853 | 149 |
| 25 | 3300005437 | Ga0070710_10110079 | Ga0070710_101100792 | 149 |
| 26 | 3300005439 | Ga0070711_100002430 | Ga0070711_1000024307 | 149 |
| 27 | 3300005441 | Ga0070700_100165627 | Ga0070700_1001656272 | 149 |
| 28 | 3300006163 | Ga0070715_10653929 | Ga0070715_106539291 | 149 |
| 29 | 3300006173 | Ga0070716_100005757 | Ga0070716_1000057572 | 149 |
| 30 | 3300006175 | Ga0070712_100003622 | Ga0070712_1000036225 | 149 |
| 31 | 3300021361 | Ga0213872_10007411 | Ga0213872_100074112 | 149 |
| 32 | 3300021441 | Ga0213871_10032048 | Ga0213871_100320482 | 149 |
| 33 | 3300025898 | Ga0207692_10090672 | Ga0207692_100906722 | 149 |
| 34 | 3300025905 | Ga0207685_10142556 | Ga0207685_101425561 | 149 |
| 35 | 3300025915 | Ga0207693_10003606 | Ga0207693_100036065 | 149 |
| 36 | 3300025916 | Ga0207663_10001753 | Ga0207663_100017535 | 149 |
| 37 | 3300025918 | Ga0207662_10120420 | Ga0207662_101204202 | 149 |
| 38 | 3300025936 | Ga0207670_10185890 | Ga0207670_101858902 | 149 |
| 39 | 3300025939 | Ga0207665_10000092 | Ga0207665_100000925 | 149 |
| 40 | 3300025942 | Ga0207689_10146431 | Ga0207689_101464312 | 149 |
| 41 | 3300025944 | Ga0207661_11305568 | Ga0207661_113055682 | 149 |
| 42 | 3300031665 | Ga0316575_10372603 | Ga0316575_103726032 | 149 |
| 43 | 3300031691 | Ga0316579_10011108 | Ga0316579_100111083 | 149 |
| 44 | 3300035090 | Ga0373949_0000080 | Ga0373949_0000080_18071_18571 | 149 |
| 45 | 3300035111 | Ga0373923_0086754 | Ga0373923_0086754_697_1170 | 149 |
| 46 | 3300035113 | Ga0373936_0462351 | Ga0373936_0462351_33_500 | 149 |
| 47 | 3300035117 | Ga0373953_0001525 | Ga0373953_0001525_2419_2892 | 149 |
| 48 | 3300035118 | Ga0373954_0000189 | Ga0373954_0000189_4118_4591 | 149 |
| 49 | 3300035119 | Ga0373956_0000794 | Ga0373956_0000794_111_584 | 149 |
| 50 | 3300035120 | Ga0373957_0003434 | Ga0373957_0003434_3194_3667 | 149 |
| 51 | 3300035172 | Ga0373955_0000598 | Ga0373955_0000598_14047_14520 | 149 |
| 52 | 3300035724 | Ga0373933_0000275 | Ga0373933_0000275_13331_13804 | 149 |
| 53 | 3300036401 | Ga0373937_0000123 | Ga0373937_0000123_28218_28691 | 149 |
| 54 | 3300036647 | Ga0316582_0229734 | Ga0316582_0229734_61_552 | 149 |
| 55 | 3300036712 | Ga0316584_0026171 | Ga0316584_0026171_2868_3359 | 149 |
| 56 | 3300037471 | Ga0395905_0001477 | Ga0395905_0001477_4314_4784 | 149 |
| 57 | 3300039438 | Ga0436360_0419454 | Ga0436360_0419454_380_832 | 149 |
| 58 | 3300039447 | Ga0436361_0238025 | Ga0436361_0238025_6898_7356 | 149 |
| 59 | 3300039453 | Ga0436362_0452825 | Ga0436362_0452825_389_871 | 149 |
| 60 | 3300046454 | Ga0495592_0069028 | Ga0495592_0069028_1383_1856 | 149 |
| 61 | 3300046457 | Ga0495590_0275784 | Ga0495590_0275784_86_556 | 149 |
| 62 | 3300046462 | Ga0495651_0035782 | Ga0495651_0035782_1992_2465 | 149 |
| 63 | 3300046491 | Ga0495584_0008163 | Ga0495584_0008163_1773_2243 | 149 |
| 64 | 3300046491 | Ga0495584_0266967 | Ga0495584_0266967_190_660 | 149 |
| 65 | 3300046501 | Ga0495607_0098039 | Ga0495607_0098039_712_1182 | 149 |
| 66 | 3300046506 | Ga0495583_0013493 | Ga0495583_0013493_343_813 | 149 |
| 67 | 3300046511 | Ga0495608_0007892 | Ga0495608_0007892_2284_2757 | 149 |
| 68 | 3300046519 | Ga0495632_0000406 | Ga0495632_0000406_38779_39249 | 149 |
| 69 | 3300046528 | Ga0495642_0049482 | Ga0495642_0049482_531_1001 | 149 |
| 70 | 3300046536 | Ga0495587_0000303 | Ga0495587_0000303_19002_19475 | 149 |
| 71 | 3300046542 | Ga0495597_0071962 | Ga0495597_0071962_342_812 | 149 |
| 72 | 3300046616 | Ga0495668_0054352 | Ga0495668_0054352_1348_1818 | 149 |
| 73 | 3300046660 | Ga0495625_0004317 | Ga0495625_0004317_4358_4828 | 149 |
| 74 | 3300046664 | Ga0495659_0001986 | Ga0495659_0001986_3153_3623 | 149 |
| 75 | 3300046665 | Ga0495661_0004762 | Ga0495661_0004762_1967_2437 | 149 |
| 76 | 3300046675 | Ga0495657_0123958 | Ga0495657_0123958_426_899 | 149 |
| 77 | 3300046684 | Ga0495669_0000750 | Ga0495669_0000750_3716_4186 | 149 |
| 78 | 3300046692 | Ga0495671_0059021 | Ga0495671_0059021_1298_1768 | 149 |
| 79 | 3300046692 | Ga0495671_0292909 | Ga0495671_0292909_187_657 | 149 |
| 80 | 3300046694 | Ga0495649_0002473 | Ga0495649_0002473_4779_5249 | 149 |
| 81 | 3300046794 | Ga0495589_0402677 | Ga0495589_0402677_141_611 | 149 |
| 82 | 3300047317 | Ga0495604_0000176 | Ga0495604_0000176_40203_40676 | 149 |
| 83 | 3300047318 | Ga0495636_0001659 | Ga0495636_0001659_2776_3246 | 149 |
| 84 | 3300047320 | Ga0495672_0001365 | Ga0495672_0001365_14379_14849 | 149 |
| 85 | 3300047443 | Ga0495687_000317 | Ga0495687_000317_57259_57744 | 149 |
| 86 | 3300047443 | Ga0495687_014641 | Ga0495687_014641_2857_3327 | 149 |
| 87 | 3300047445 | Ga0495677_0002650 | Ga0495677_0002650_3683_4153 | 149 |
| 88 | 3300047447 | Ga0495685_000943 | Ga0495685_000943_5511_5981 | 149 |
| 89 | 3300047470 | Ga0495681_0003109 | Ga0495681_0003109_2929_3399 | 149 |
| 90 | 3300047471 | Ga0495684_0027365 | Ga0495684_0027365_124_597 | 149 |
| 91 | 3300048088 | Ga0495602_0000362 | Ga0495602_0000362_19325_19798 | 149 |
| 92 | 3300053085 | Ga0495619_0268163 | Ga0495619_0268163_634_1107 | 149 |
| 93 | 3300004798 | Ga0058859_11522584 | Ga0058859_115225842 | 150 |
| 94 | 3300005347 | Ga0070668_100278909 | Ga0070668_1002789091 | 150 |
| 95 | 3300005353 | Ga0070669_100998786 | Ga0070669_1009987862 | 150 |
| 96 | 3300005364 | Ga0070673_100935508 | Ga0070673_1009355082 | 150 |
| 97 | 3300005366 | Ga0070659_100038772 | Ga0070659_1000387726 | 150 |
| 98 | 3300005366 | Ga0070659_100148646 | Ga0070659_1001486462 | 150 |
| 99 | 3300005436 | Ga0070713_100210196 | Ga0070713_1002101961 | 150 |
| 100 | 3300005444 | Ga0070694_100288686 | Ga0070694_1002886862 | 150 |
| 101 | 3300005445 | Ga0070708_100027509 | Ga0070708_1000275095 | 150 |
| 102 | 3300005445 | Ga0070708_100051841 | Ga0070708_1000518411 | 150 |
| 103 | 3300005445 | Ga0070708_100093838 | Ga0070708_1000938382 | 150 |
| 104 | 3300005467 | Ga0070706_101048307 | Ga0070706_1010483071 | 150 |
| 105 | 3300005536 | Ga0070697_100000769 | Ga0070697_1000007693 | 150 |
| 106 | 3300005536 | Ga0070697_100668115 | Ga0070697_1006681151 | 150 |
| 107 | 3300005549 | Ga0070704_100119682 | Ga0070704_1001196821 | 150 |
| 108 | 3300005617 | Ga0068859_100906409 | Ga0068859_1009064092 | 150 |
| 109 | 3300005719 | Ga0068861_100194724 | Ga0068861_1001947242 | 150 |
| 110 | 3300005843 | Ga0068860_100039544 | Ga0068860_1000395442 | 150 |
| 111 | 3300005937 | Ga0081455_10078241 | Ga0081455_100782412 | 150 |
| 112 | 3300005981 | Ga0081538_10013801 | Ga0081538_100138012 | 150 |
| 113 | 3300005981 | Ga0081538_10350405 | Ga0081538_103504051 | 150 |
| 114 | 3300006028 | Ga0070717_10477866 | Ga0070717_104778662 | 150 |
| 115 | 3300006880 | Ga0075429_101201163 | Ga0075429_1012011632 | 150 |
| 116 | 3300006914 | Ga0075436_100009340 | Ga0075436_1000093406 | 150 |
| 117 | 3300006931 | Ga0097620_100906447 | Ga0097620_1009064472 | 150 |
| 118 | 3300007076 | Ga0075435_101286459 | Ga0075435_1012864591 | 150 |
| 119 | 3300007265 | Ga0099794_10043719 | Ga0099794_100437192 | 150 |
| 120 | 3300007265 | Ga0099794_10138435 | Ga0099794_101384352 | 150 |
| 121 | 3300007265 | Ga0099794_10172963 | Ga0099794_101729632 | 150 |
| 122 | 3300007265 | Ga0099794_10544180 | Ga0099794_105441801 | 150 |
| 123 | 3300009177 | Ga0105248_10005978 | Ga0105248_100059783 | 150 |
| 124 | 3300009551 | Ga0105238_10070218 | Ga0105238_100702183 | 150 |
| 125 | 3300009551 | Ga0105238_10312790 | Ga0105238_103127902 | 150 |
| 126 | 3300010375 | Ga0105239_10088594 | Ga0105239_100885942 | 150 |
| 127 | 3300013297 | Ga0157378_10003357 | Ga0157378_1000335710 | 150 |
| 128 | 3300013306 | Ga0163162_10045428 | Ga0163162_100454282 | 150 |
| 129 | 3300013308 | Ga0157375_10714465 | Ga0157375_107144652 | 150 |
| 130 | 3300025906 | Ga0207699_10357512 | Ga0207699_103575122 | 150 |
| 131 | 3300025913 | Ga0207695_10061076 | Ga0207695_100610764 | 150 |
| 132 | 3300025924 | Ga0207694_10096748 | Ga0207694_100967482 | 150 |
| 133 | 3300025929 | Ga0207664_10067026 | Ga0207664_100670262 | 150 |
| 134 | 3300025929 | Ga0207664_11077497 | Ga0207664_110774972 | 150 |
| 135 | 3300025932 | Ga0207690_10118061 | Ga0207690_101180612 | 150 |
| 136 | 3300025932 | Ga0207690_10385662 | Ga0207690_103856622 | 150 |
| 137 | 3300025934 | Ga0207686_10228186 | Ga0207686_102281862 | 150 |
| 138 | 3300025960 | Ga0207651_11038568 | Ga0207651_110385682 | 150 |
| 139 | 3300026118 | Ga0207675_100658116 | Ga0207675_1006581162 | 150 |
| 140 | 3300027671 | Ga0209588_1026893 | Ga0209588_10268932 | 150 |
| 141 | 3300027671 | Ga0209588_1062029 | Ga0209588_10620292 | 150 |
| 142 | 3300027671 | Ga0209588_1223903 | Ga0209588_12239031 | 150 |
| 143 | 3300027866 | Ga0209813_10235612 | Ga0209813_102356121 | 150 |
| 144 | 3300028381 | Ga0268264_10515256 | Ga0268264_105152562 | 150 |
| 145 | 3300031548 | Ga0307408_100259413 | Ga0307408_1002594132 | 150 |
| 146 | 3300031548 | Ga0307408_100351600 | Ga0307408_1003516002 | 150 |
| 147 | 3300031911 | Ga0307412_10638287 | Ga0307412_106382871 | 150 |
| 148 | 3300031995 | Ga0307409_100129579 | Ga0307409_1001295792 | 150 |
| 149 | 3300032004 | Ga0307414_10180370 | Ga0307414_101803703 | 150 |
| 150 | 3300032005 | Ga0307411_12063426 | Ga0307411_120634261 | 150 |
| 151 | 3300032126 | Ga0307415_100180975 | Ga0307415_1001809753 | 150 |
| 152 | 3300035121 | Ga0373960_0064213 | Ga0373960_0064213_365_826 | 150 |
| 153 | 3300035171 | Ga0373946_0005493 | Ga0373946_0005493_320_799 | 150 |
| 154 | 3300035241 | Ga0373961_0067504 | Ga0373961_0067504_39_500 | 150 |
| 155 | 3300035695 | Ga0373927_0015095 | Ga0373927_0015095_4486_4965 | 150 |
| 156 | 3300035725 | Ga0373947_0012202 | Ga0373947_0012202_1443_1922 | 150 |
| 157 | 3300037068 | Ga0373925_0007175 | Ga0373925_0007175_4467_4946 | 150 |
| 158 | 3300039450 | Ga0436363_0894292 | Ga0436363_0894292_301_756 | 150 |
| 159 | 3300042008 | Ga0439450_052990 | Ga0439450_052990_306_758 | 150 |
| 160 | 3300042156 | Ga0439446_0219262 | Ga0439446_0219262_89_541 | 150 |
| 161 | 3300045836 | Ga0466958_0243282 | Ga0466958_0243282_12_482 | 150 |
| 162 | 3300045976 | Ga0466967_0654357 | Ga0466967_0654357_497_949 | 150 |
| 163 | 3300046491 | Ga0495584_0042541 | Ga0495584_0042541_185_646 | 150 |
| 164 | 3300046514 | Ga0495618_0074200 | Ga0495618_0074200_817_1296 | 150 |
| 165 | 3300046517 | Ga0495630_0003619 | Ga0495630_0003619_3137_3616 | 150 |
| 166 | 3300046526 | Ga0495666_0021116 | Ga0495666_0021116_659_1138 | 150 |
| 167 | 3300046684 | Ga0495669_0036427 | Ga0495669_0036427_1310_1771 | 150 |
| 168 | 3300046690 | Ga0495624_0021941 | Ga0495624_0021941_1055_1534 | 150 |
| 169 | 3300047317 | Ga0495604_0100677 | Ga0495604_0100677_1481_1960 | 150 |
| 170 | 3300047317 | Ga0495604_0118233 | Ga0495604_0118233_697_1176 | 150 |
| 171 | 3300047321 | Ga0495676_0047525 | Ga0495676_0047525_206_685 | 150 |
| 172 | 3300048904 | Ga0496101_0305137 | Ga0496101_0305137_732_1208 | 150 |
| 173 | 3300048904 | Ga0496101_1215242 | Ga0496101_1215242_62_544 | 150 |
| 174 | 3300048905 | Ga0496102_0011806 | Ga0496102_0011806_3616_4098 | 150 |
| 175 | 3300048906 | Ga0496103_0087069 | Ga0496103_0087069_643_1125 | 150 |
| 176 | 3300048909 | Ga0496106_0053673 | Ga0496106_0053673_104_586 | 150 |
| 177 | 3300048910 | Ga0496107_0147659 | Ga0496107_0147659_428_973 | 150 |
| 178 | 3300048910 | Ga0496107_0161043 | Ga0496107_0161043_80_562 | 150 |
| 179 | 3300048915 | Ga0496112_0055909 | Ga0496112_0055909_2296_2778 | 150 |
| 180 | 3300048917 | Ga0496114_0159895 | Ga0496114_0159895_699_1244 | 150 |
| 181 | 3300048918 | Ga0496115_0018315 | Ga0496115_0018315_1696_2241 | 150 |
| 182 | 3300049568 | Ga0501031_0003301 | Ga0501031_0003301_2954_3409 | 150 |
| 183 | 3300049568 | Ga0501031_0582658 | Ga0501031_0582658_168_620 | 150 |
| 184 | 3300049570 | Ga0501033_0326009 | Ga0501033_0326009_195_647 | 150 |
| 185 | 3300049571 | Ga0501034_0003870 | Ga0501034_0003870_6120_6575 | 150 |
| 186 | 3300049572 | Ga0501036_0046217 | Ga0501036_0046217_1847_2302 | 150 |
| 187 | 3300049572 | Ga0501036_0080512 | Ga0501036_0080512_1433_1885 | 150 |
| 188 | 3300049573 | Ga0501037_0008470 | Ga0501037_0008470_3118_3573 | 150 |
| 189 | 3300049574 | Ga0501038_0018893 | Ga0501038_0018893_915_1370 | 150 |
| 190 | 3300049574 | Ga0501038_0045317 | Ga0501038_0045317_3108_3560 | 150 |
| 191 | 3300049575 | Ga0501039_0000793 | Ga0501039_0000793_6039_6494 | 150 |
| 192 | 3300049575 | Ga0501039_0101674 | Ga0501039_0101674_968_1420 | 150 |
| 193 | 3300049576 | Ga0501040_0020485 | Ga0501040_0020485_3225_3677 | 150 |
| 194 | 3300049577 | Ga0501041_0006656 | Ga0501041_0006656_5374_5826 | 150 |
| 195 | 3300049578 | Ga0501042_0022097 | Ga0501042_0022097_3458_3910 | 150 |
| 196 | 3300049579 | Ga0501043_0080269 | Ga0501043_0080269_1364_1816 | 150 |
| 197 | 3300049579 | Ga0501043_0144217 | Ga0501043_0144217_1184_1639 | 150 |
| 198 | 3300049580 | Ga0501046_0001994 | Ga0501046_0001994_1847_2302 | 150 |
| 199 | 3300049580 | Ga0501046_0019849 | Ga0501046_0019849_298_750 | 150 |
| 200 | 3300049581 | Ga0501047_0129938 | Ga0501047_0129938_98_553 | 150 |
| 201 | 3300049582 | Ga0501048_0018663 | Ga0501048_0018663_4025_4477 | 150 |
| 202 | 3300049582 | Ga0501048_0029236 | Ga0501048_0029236_2905_3360 | 150 |
| 203 | 3300049583 | Ga0501067_0428842 | Ga0501067_0428842_253_714 | 150 |
| 204 | 3300049584 | Ga0501068_0030823 | Ga0501068_0030823_819_1274 | 150 |
| 205 | 3300049585 | Ga0501069_0021182 | Ga0501069_0021182_2055_2510 | 150 |
| 206 | 3300049586 | Ga0501070_0008650 | Ga0501070_0008650_7234_7689 | 150 |
| 207 | 3300049586 | Ga0501070_0175429 | Ga0501070_0175429_52_504 | 150 |
| 208 | 3300049588 | Ga0501072_0009040 | Ga0501072_0009040_3840_4295 | 150 |
| 209 | 3300049588 | Ga0501072_0012791 | Ga0501072_0012791_5244_5696 | 150 |
| 210 | 3300049589 | Ga0501073_0001699 | Ga0501073_0001699_915_1370 | 150 |
| 211 | 3300049590 | Ga0501074_0010366 | Ga0501074_0010366_1847_2302 | 150 |
| 212 | 3300049591 | Ga0501075_0017673 | Ga0501075_0017673_900_1352 | 150 |
| 213 | 3300049592 | Ga0501076_0006568 | Ga0501076_0006568_3669_4121 | 150 |
| 214 | 3300049592 | Ga0501076_0323195 | Ga0501076_0323195_304_759 | 150 |
| 215 | 3300049593 | Ga0501077_0037808 | Ga0501077_0037808_586_1041 | 150 |
| 216 | 3300049593 | Ga0501077_0399653 | Ga0501077_0399653_378_830 | 150 |
| 217 | 3300049593 | Ga0501077_0449809 | Ga0501077_0449809_128_580 | 150 |
| 218 | 3300049741 | Ga0501079_0002477 | Ga0501079_0002477_2981_3433 | 150 |
| 219 | 3300049741 | Ga0501079_0043898 | Ga0501079_0043898_1149_1604 | 150 |
| 220 | 3300049741 | Ga0501079_1300655 | Ga0501079_1300655_10_462 | 150 |
| 221 | 3300049742 | Ga0501080_0000034 | Ga0501080_0000034_21458_21913 | 150 |
| 222 | 3300049742 | Ga0501080_0270940 | Ga0501080_0270940_993_1445 | 150 |
| 223 | 3300049743 | Ga0501081_0661914 | Ga0501081_0661914_132_590 | 150 |
| 224 | 3300049744 | Ga0501083_0028166 | Ga0501083_0028166_2271_2726 | 150 |
| 225 | 3300049744 | Ga0501083_0142913 | Ga0501083_0142913_827_1279 | 150 |
| 226 | 3300049822 | Ga0501035_0038838 | Ga0501035_0038838_1513_1968 | 150 |
| 227 | 3300049822 | Ga0501035_0575234 | Ga0501035_0575234_377_829 | 150 |
| 228 | 3300049823 | Ga0501044_0045948 | Ga0501044_0045948_1847_2302 | 150 |
| 229 | 3300049824 | Ga0501045_0009687 | Ga0501045_0009687_724_1176 | 150 |
| 230 | 3300049824 | Ga0501045_0296449 | Ga0501045_0296449_631_1086 | 150 |
| 231 | 3300050489 | nmdc:mga03683_22807_c1 | nmdc:mga03683_22807_c1_454_906 | 150 |
| 232 | 3300050490 | nmdc:mga03n38_395501_c1 | nmdc:mga03n38_395501_c1_25_477 | 150 |
| 233 | 3300050493 | nmdc:mga0k408_31979_c1 | nmdc:mga0k408_31979_c1_2287_2739 | 150 |
| 234 | 3300050496 | nmdc:mga07m45_45679_c1 | nmdc:mga07m45_45679_c1_1981_2433 | 150 |
| 235 | 3300050514 | nmdc:mga08x19_180_c1 | nmdc:mga08x19_180_c1_47064_47543 | 150 |
| 236 | 3300053077 | Ga0495601_0070209 | Ga0495601_0070209_1502_1981 | 150 |
| 237 | 3300053085 | Ga0495619_0016094 | Ga0495619_0016094_2435_2914 | 150 |
| 238 | 3300054114 | Ga0501084_0001644 | Ga0501084_0001644_3109_3564 | 150 |
| 239 | 3300054114 | Ga0501084_0023902 | Ga0501084_0023902_4534_4986 | 150 |
| 240 | 3300059421 | Ga0590071_020396 | Ga0590071_020396_812_1264 | 150 |
| 241 | 3300059493 | Ga0587077_138345 | Ga0587077_138345_136_588 | 150 |
| 242 | 3300059640 | Ga0587067_081629 | Ga0587067_081629_119_571 | 150 |
| 243 | 3300059641 | Ga0587068_051375 | Ga0587068_051375_23_475 | 150 |
| 244 | 3300059647 | Ga0587079_235518 | Ga0587079_235518_22_474 | 150 |
| 245 | 3300059658 | Ga0587119_020787 | Ga0587119_020787_246_698 | 150 |
| 246 | 3300060344 | Ga0587071_152391 | Ga0587071_152391_89_541 | 150 |
| 247 | 3300060353 | Ga0501082_0069892 | Ga0501082_0069892_1184_1639 | 150 |
| 248 | 3300060353 | Ga0501082_0168754 | Ga0501082_0168754_717_1169 | 150 |
| 249 | 3300060353 | Ga0501082_0656678 | Ga0501082_0656678_39_491 | 150 |
| 250 | 3300061734 | Ga0530510_0013664 | Ga0530510_0013664_763_1215 | 150 |
| 251 | 3300061734 | Ga0530510_0450629 | Ga0530510_0450629_27_479 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9821 | 2 | 149 |
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9629 | 2 | 149 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9558 | 2 | 149 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9547 | 2 | 149 |
| 5y6q-assembly1.cif.gz_A | crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 | 0.9518 | 2 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9716 | 82 | 149 | 1.10.150.120 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9663 | 2 | 74 | 3.10.20.30 |
| 1ffuD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9596 | 82 | 149 | 1.10.150.120 |
| 5y6qA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9465 | 82 | 149 | 1.10.150.120 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9401 | 77 | 149 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7FSL9-F1-model_v4 | (2Fe-2S)-binding protein | 0.994 | 43 | 148 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A0W1RUA3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9935 | 20 | 149 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A191ZHF8-F1-model_v4 | (2Fe-2S)-binding protein | 0.9925 | 2 | 148 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-V5SCH1-F1-model_v4 | (2Fe-2S)-binding protein | 0.9919 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A0Q5ZNZ3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9917 | 1 | 148 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar