F362727

General Info

Members Datasets Scaffolds Average Seq Length
251 195 251 155

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0159895|Ga0496114_0159895_699_1244
Length 181
Sequence VEAGVRSSELTWERVSSAPEDNAMATVTIRVNGREVPVRAEGDTPLLWVLRDELGLTGTKFGCGKGLCGACTVHVNDAPVRSCSVAIGALSGRSVQTIEGMRGDVVAALRRAWIDESVPQCGYCQVGQVMSASALLRTTPSPNDEQIDAAMRGNICRCGTYPRIRAAIHRAARALASHAER

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.21
Metatranscriptomes 2.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 3.98
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11522584 3300004798 Bacteria 2871
2 Ga0070683_101748396 3300005329 Bacteria 598
3 Ga0068869_100125085 3300005334 Bacteria 1971
4 Ga0070689_100232091 3300005340 Bacteria 1517
5 Ga0070689_100621578 3300005340 Bacteria 937
6 Ga0070668_100278909 3300005347 Bacteria 1395
7 Ga0070669_100998786 3300005353 Bacteria 718
8 Ga0070674_100863356 3300005356 Bacteria 786
9 Ga0070673_100935508 3300005364 Bacteria 805
10 Ga0070659_100038772 3300005366 Bacteria 3717
11 Ga0070659_100148646 3300005366 Bacteria 1910
12 Ga0070713_100210196 3300005436 Bacteria 1761
13 Ga0070710_10110079 3300005437 Bacteria 1653
14 Ga0070711_100002430 3300005439 Bacteria 10613
15 Ga0070700_100165627 3300005441 Bacteria 1526
16 Ga0070694_100288686 3300005444 Bacteria 1253
17 Ga0070708_100027509 3300005445 Bacteria 4881
18 Ga0070708_100051841 3300005445 Unclassified 3636
19 Ga0070708_100093838 3300005445 Bacteria 2737
20 Ga0070706_101048307 3300005467 Unclassified 751
21 Ga0070697_100000769 3300005536 Bacteria 23994
22 Ga0070697_100668115 3300005536 Unclassified 916
23 Ga0070704_100119682 3300005549 Bacteria 2020
24 Ga0068855_100200433 3300005563 Bacteria 2247
25 Ga0068859_100008782 3300005617 Bacteria 10202
26 Ga0068859_100906409 3300005617 Bacteria 966
27 Ga0068861_100000132 3300005719 Bacteria 38465
28 Ga0068861_100194724 3300005719 Bacteria 1697
29 Ga0068860_100039544 3300005843 Bacteria 4511
30 Ga0081455_10078241 3300005937 Bacteria 2718
31 Ga0081538_10013801 3300005981 Bacteria 6377
32 Ga0081538_10350405 3300005981 Bacteria 535
33 Ga0070717_10477866 3300006028 Unclassified 1125
34 Ga0070715_10653929 3300006163 Bacteria 622
35 Ga0070716_100005757 3300006173 Bacteria 6021
36 Ga0070712_100003622 3300006175 Bacteria 9527
37 Ga0075429_101201163 3300006880 Bacteria 662
38 Ga0075436_100009340 3300006914 Bacteria 6706
39 Ga0097620_100008783 3300006931 Bacteria 10202
40 Ga0097620_100906447 3300006931 Bacteria 966
41 Ga0075435_101286459 3300007076 Unclassified 640
42 Ga0099794_10043719 3300007265 Bacteria 2139
43 Ga0099794_10138435 3300007265 Unclassified 1232
44 Ga0099794_10172963 3300007265 Bacteria 1101
45 Ga0099794_10544180 3300007265 Bacteria 613
46 Ga0105240_10004588 3300009093 Bacteria 20940
47 Ga0105243_10241256 3300009148 Bacteria 1608
48 Ga0105248_10004980 3300009177 Bacteria 14685
49 Ga0105248_10005978 3300009177 Bacteria 13360
50 Ga0105238_10070218 3300009551 Bacteria 3502
51 Ga0105238_10312790 3300009551 Bacteria 1556
52 Ga0105239_10088594 3300010375 Bacteria 3412
53 Ga0105239_12298080 3300010375 Bacteria 627
54 Ga0157378_10003357 3300013297 Bacteria 14241
55 Ga0163162_10045428 3300013306 Bacteria 4400
56 Ga0157375_10714465 3300013308 Bacteria 1155
57 Ga0157380_11893733 3300014326 Bacteria 657
58 Ga0157379_10487485 3300014968 Bacteria 1141
59 Ga0213872_10007411 3300021361 Bacteria 5400
60 Ga0213871_10032048 3300021441 Bacteria 1376
61 Ga0207692_10090672 3300025898 Bacteria 1657
62 Ga0207685_10142556 3300025905 Bacteria 1076
63 Ga0207699_10357512 3300025906 Bacteria 1032
64 Ga0207695_10014728 3300025913 Bacteria 9247
65 Ga0207695_10061076 3300025913 Bacteria 3897
66 Ga0207693_10003606 3300025915 Bacteria 13215
67 Ga0207663_10001753 3300025916 Bacteria 10218
68 Ga0207662_10120420 3300025918 Bacteria 1646
69 Ga0207694_10096748 3300025924 Bacteria 2335
70 Ga0207694_10485240 3300025924 Bacteria 1034
71 Ga0207664_10067026 3300025929 Unclassified 2879
72 Ga0207664_11077497 3300025929 Bacteria 719
73 Ga0207690_10118061 3300025932 Bacteria 1922
74 Ga0207690_10385662 3300025932 Bacteria 1114
75 Ga0207686_10228186 3300025934 Bacteria 1348
76 Ga0207709_10150877 3300025935 Bacteria 1609
77 Ga0207670_10185890 3300025936 Bacteria 1568
78 Ga0207665_10000092 3300025939 Bacteria 58290
79 Ga0207711_10003036 3300025941 Bacteria 14671
80 Ga0207689_10146431 3300025942 Bacteria 1946
81 Ga0207661_11305568 3300025944 Bacteria 667
82 Ga0207667_10897583 3300025949 Bacteria 878
83 Ga0207651_11038568 3300025960 Bacteria 733
84 Ga0207641_12137259 3300026088 Bacteria 560
85 Ga0207675_100000071 3300026118 Bacteria 77575
86 Ga0207675_100658116 3300026118 Bacteria 1054
87 Ga0209588_1026893 3300027671 Bacteria 1829
88 Ga0209588_1062029 3300027671 Bacteria 1209
89 Ga0209588_1223903 3300027671 Bacteria 581
90 Ga0209813_10235612 3300027866 Bacteria 690
91 Ga0268264_10515256 3300028381 Bacteria 1168
92 Ga0307408_100259413 3300031548 Bacteria 1438
93 Ga0307408_100351600 3300031548 Bacteria 1251
94 Ga0316575_10372603 3300031665 Bacteria 610
95 Ga0316579_10011108 3300031691 Bacteria 3822
96 Ga0307412_10638287 3300031911 Bacteria 907
97 Ga0307409_100129579 3300031995 Bacteria 2153
98 Ga0307414_10180370 3300032004 Bacteria 1698
99 Ga0307411_12063426 3300032005 Bacteria 533
100 Ga0307415_100180975 3300032126 Bacteria 1654
101 Ga0373949_0000080 3300035090 Bacteria 35784
102 Ga0373923_0086754 3300035111 Bacteria 1364
103 Ga0373936_0462351 3300035113 Bacteria 587
104 Ga0373953_0001525 3300035117 Bacteria 6727
105 Ga0373954_0000189 3300035118 Bacteria 22316
106 Ga0373956_0000794 3300035119 Bacteria 13119
107 Ga0373957_0003434 3300035120 Bacteria 4683
108 Ga0373960_0064213 3300035121 Bacteria 1120
109 Ga0373946_0005493 3300035171 Bacteria 4574
110 Ga0373955_0000598 3300035172 Bacteria 15387
111 Ga0373961_0067504 3300035241 Bacteria 1099
112 Ga0373927_0015095 3300035695 Bacteria 5107
113 Ga0373933_0000275 3300035724 Bacteria 33474
114 Ga0373947_0012202 3300035725 Bacteria 4920
115 Ga0373937_0000123 3300036401 Bacteria 74156
116 Ga0316582_0229734 3300036647 Bacteria 1270
117 Ga0316584_0026171 3300036712 Bacteria 4286
118 Ga0373925_0007175 3300037068 Bacteria 8144
119 Ga0395905_0001477 3300037471 Bacteria 28144
120 Ga0395905_0513905 3300037471 Bacteria 1098
121 Ga0436360_0419454 3300039438 Bacteria 1328
122 Ga0436361_0238025 3300039447 Bacteria 10372
123 Ga0436363_0894292 3300039450 Bacteria 827
124 Ga0436362_0452825 3300039453 Bacteria 904
125 Ga0439450_052990 3300042008 Bacteria 968
126 Ga0439446_0219262 3300042156 Bacteria 648
127 Ga0466958_0243282 3300045836 Bacteria 1150
128 Ga0466967_0654357 3300045976 Bacteria 1039
129 Ga0495592_0069028 3300046454 Bacteria 2578
130 Ga0495590_0275784 3300046457 Bacteria 629
131 Ga0495651_0035782 3300046462 Bacteria 3866
132 Ga0495584_0008163 3300046491 Bacteria 5437
133 Ga0495584_0042541 3300046491 Bacteria 2293
134 Ga0495584_0266967 3300046491 Bacteria 870
135 Ga0495607_0098039 3300046501 Bacteria 1575
136 Ga0495583_0013493 3300046506 Bacteria 4554
137 Ga0495608_0007892 3300046511 Bacteria 7481
138 Ga0495618_0074200 3300046514 Bacteria 2166
139 Ga0495630_0003619 3300046517 Bacteria 10771
140 Ga0495632_0000406 3300046519 Bacteria 40685
141 Ga0495666_0021116 3300046526 Bacteria 3224
142 Ga0495642_0049482 3300046528 Bacteria 1727
143 Ga0495587_0000303 3300046536 Bacteria 35065
144 Ga0495597_0071962 3300046542 Bacteria 1488
145 Ga0495667_0290129 3300046559 Bacteria 1037
146 Ga0495668_0054352 3300046616 Bacteria 2214
147 Ga0495625_0004317 3300046660 Bacteria 13501
148 Ga0495659_0001986 3300046664 Bacteria 6726
149 Ga0495661_0004762 3300046665 Bacteria 9737
150 Ga0495657_0123958 3300046675 Bacteria 1625
151 Ga0495669_0000750 3300046684 Bacteria 13951
152 Ga0495669_0036427 3300046684 Bacteria 2175
153 Ga0495624_0021941 3300046690 Bacteria 4229
154 Ga0495671_0059021 3300046692 Bacteria 1897
155 Ga0495671_0292909 3300046692 Bacteria 783
156 Ga0495649_0002473 3300046694 Bacteria 12989
157 Ga0495589_0402677 3300046794 Bacteria 628
158 Ga0495604_0000176 3300047317 Bacteria 56911
159 Ga0495604_0100677 3300047317 Bacteria 2124
160 Ga0495604_0118233 3300047317 Unclassified 1921
161 Ga0495636_0001659 3300047318 Bacteria 8481
162 Ga0495672_0001365 3300047320 Bacteria 24188
163 Ga0495676_0047525 3300047321 Bacteria 3469
164 Ga0495687_000317 3300047443 Bacteria 62824
165 Ga0495687_014641 3300047443 Bacteria 4024
166 Ga0495677_0002650 3300047445 Bacteria 6995
167 Ga0495685_000943 3300047447 Bacteria 8806
168 Ga0495681_0003109 3300047470 Bacteria 11645
169 Ga0495684_0027365 3300047471 Bacteria 4378
170 Ga0495602_0000362 3300048088 Bacteria 42468
171 Ga0496101_0305137 3300048904 Bacteria 1247
172 Ga0496101_1215242 3300048904 Bacteria 590
173 Ga0496102_0011806 3300048905 Bacteria 7539
174 Ga0496103_0087069 3300048906 Bacteria 1969
175 Ga0496106_0053673 3300048909 Bacteria 3045
176 Ga0496107_0147659 3300048910 Bacteria 1739
177 Ga0496107_0161043 3300048910 Bacteria 1663
178 Ga0496112_0055909 3300048915 Bacteria 3883
179 Ga0496114_0159895 3300048917 Bacteria 1958
180 Ga0496115_0018315 3300048918 Bacteria 5374
181 Ga0501031_0003301 3300049568 Bacteria 10352
182 Ga0501031_0582658 3300049568 Bacteria 720
183 Ga0501033_0326009 3300049570 Bacteria 1078
184 Ga0501034_0003870 3300049571 Bacteria 16848
185 Ga0501036_0046217 3300049572 Bacteria 3686
186 Ga0501036_0080512 3300049572 Bacteria 2753
187 Ga0501037_0008470 3300049573 Bacteria 7540
188 Ga0501038_0018893 3300049574 Bacteria 6221
189 Ga0501038_0045317 3300049574 Bacteria 3818
190 Ga0501039_0000793 3300049575 Bacteria 22771
191 Ga0501039_0101674 3300049575 Bacteria 2243
192 Ga0501040_0020485 3300049576 Bacteria 4407
193 Ga0501041_0006656 3300049577 Bacteria 6768
194 Ga0501042_0022097 3300049578 Bacteria 4441
195 Ga0501043_0080269 3300049579 Bacteria 2563
196 Ga0501043_0144217 3300049579 Bacteria 1864
197 Ga0501046_0001994 3300049580 Bacteria 19385
198 Ga0501046_0019849 3300049580 Bacteria 5566
199 Ga0501047_0129938 3300049581 Bacteria 2399
200 Ga0501048_0018663 3300049582 Bacteria 5099
201 Ga0501048_0029236 3300049582 Bacteria 3998
202 Ga0501067_0428842 3300049583 Bacteria 738
203 Ga0501068_0030823 3300049584 Bacteria 3183
204 Ga0501069_0021182 3300049585 Bacteria 3527
205 Ga0501070_0008650 3300049586 Bacteria 8603
206 Ga0501070_0175429 3300049586 Bacteria 1765
207 Ga0501072_0009040 3300049588 Bacteria 7573
208 Ga0501072_0012791 3300049588 Bacteria 6415
209 Ga0501073_0001699 3300049589 Bacteria 16315
210 Ga0501074_0010366 3300049590 Bacteria 6761
211 Ga0501075_0017673 3300049591 Bacteria 5150
212 Ga0501076_0006568 3300049592 Bacteria 8436
213 Ga0501076_0323195 3300049592 Bacteria 1265
214 Ga0501077_0037808 3300049593 Bacteria 3073
215 Ga0501077_0399653 3300049593 Bacteria 878
216 Ga0501077_0449809 3300049593 Bacteria 825
217 Ga0501079_0002477 3300049741 Bacteria 13412
218 Ga0501079_0043898 3300049741 Bacteria 3450
219 Ga0501079_1300655 3300049741 Bacteria 572
220 Ga0501080_0000034 3300049742 Bacteria 85093
221 Ga0501080_0270940 3300049742 Bacteria 1545
222 Ga0501081_0661914 3300049743 Bacteria 783
223 Ga0501083_0028166 3300049744 Bacteria 3874
224 Ga0501083_0142913 3300049744 Bacteria 1567
225 Ga0501035_0038838 3300049822 Bacteria 4309
226 Ga0501035_0575234 3300049822 Bacteria 920
227 Ga0501044_0045948 3300049823 Bacteria 4522
228 Ga0501045_0009687 3300049824 Bacteria 6740
229 Ga0501045_0296449 3300049824 Bacteria 1203
230 nmdc:mga03683_22807_c1 3300050489 Bacteria 2430
231 nmdc:mga03n38_395501_c1 3300050490 Bacteria 760
232 nmdc:mga0k408_31979_c1 3300050493 Bacteria 3006
233 nmdc:mga07m45_45679_c1 3300050496 Bacteria 2459
234 nmdc:mga08x19_180_c1 3300050514 Bacteria 50906
235 Ga0495601_0070209 3300053077 Bacteria 2236
236 Ga0495619_0016094 3300053085 Bacteria 4734
237 Ga0495619_0268163 3300053085 Unclassified 1183
238 Ga0501084_0001644 3300054114 Bacteria 17766
239 Ga0501084_0023902 3300054114 Bacteria 5098
240 Ga0590071_020396 3300059421 Bacteria 1561
241 Ga0587077_138345 3300059493 Bacteria 625
242 Ga0587067_081629 3300059640 Bacteria 717
243 Ga0587068_051375 3300059641 Bacteria 772
244 Ga0587079_235518 3300059647 Bacteria 515
245 Ga0587119_020787 3300059658 Bacteria 837
246 Ga0587071_152391 3300060344 Bacteria 576
247 Ga0501082_0069892 3300060353 Bacteria 3023
248 Ga0501082_0168754 3300060353 Bacteria 1902
249 Ga0501082_0656678 3300060353 Bacteria 918
250 Ga0530510_0013664 3300061734 Bacteria 5713
251 Ga0530510_0450629 3300061734 Bacteria 973

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046559 Ga0495667_0290129 Ga0495667_0290129_619_1020 127
2 3300005340 Ga0070689_100232091 Ga0070689_1002320912 138
3 3300005340 Ga0070689_100621578 Ga0070689_1006215782 148
4 3300005356 Ga0070674_100863356 Ga0070674_1008633562 148
5 3300005563 Ga0068855_100200433 Ga0068855_1002004332 148
6 3300005617 Ga0068859_100008782 Ga0068859_1000087826 148
7 3300005719 Ga0068861_100000132 Ga0068861_10000013230 148
8 3300006931 Ga0097620_100008783 Ga0097620_1000087836 148
9 3300009093 Ga0105240_10004588 Ga0105240_100045882 148
10 3300009148 Ga0105243_10241256 Ga0105243_102412563 148
11 3300009177 Ga0105248_10004980 Ga0105248_100049809 148
12 3300010375 Ga0105239_12298080 Ga0105239_122980802 148
13 3300014326 Ga0157380_11893733 Ga0157380_118937331 148
14 3300014968 Ga0157379_10487485 Ga0157379_104874852 148
15 3300025913 Ga0207695_10014728 Ga0207695_100147282 148
16 3300025924 Ga0207694_10485240 Ga0207694_104852402 148
17 3300025935 Ga0207709_10150877 Ga0207709_101508773 148
18 3300025941 Ga0207711_10003036 Ga0207711_100030369 148
19 3300025949 Ga0207667_10897583 Ga0207667_108975832 148
20 3300026088 Ga0207641_12137259 Ga0207641_121372591 148
21 3300026118 Ga0207675_100000071 Ga0207675_10000007149 148
22 3300037471 Ga0395905_0513905 Ga0395905_0513905_94_570 148
23 3300005329 Ga0070683_101748396 Ga0070683_1017483961 149
24 3300005334 Ga0068869_100125085 Ga0068869_1001250853 149
25 3300005437 Ga0070710_10110079 Ga0070710_101100792 149
26 3300005439 Ga0070711_100002430 Ga0070711_1000024307 149
27 3300005441 Ga0070700_100165627 Ga0070700_1001656272 149
28 3300006163 Ga0070715_10653929 Ga0070715_106539291 149
29 3300006173 Ga0070716_100005757 Ga0070716_1000057572 149
30 3300006175 Ga0070712_100003622 Ga0070712_1000036225 149
31 3300021361 Ga0213872_10007411 Ga0213872_100074112 149
32 3300021441 Ga0213871_10032048 Ga0213871_100320482 149
33 3300025898 Ga0207692_10090672 Ga0207692_100906722 149
34 3300025905 Ga0207685_10142556 Ga0207685_101425561 149
35 3300025915 Ga0207693_10003606 Ga0207693_100036065 149
36 3300025916 Ga0207663_10001753 Ga0207663_100017535 149
37 3300025918 Ga0207662_10120420 Ga0207662_101204202 149
38 3300025936 Ga0207670_10185890 Ga0207670_101858902 149
39 3300025939 Ga0207665_10000092 Ga0207665_100000925 149
40 3300025942 Ga0207689_10146431 Ga0207689_101464312 149
41 3300025944 Ga0207661_11305568 Ga0207661_113055682 149
42 3300031665 Ga0316575_10372603 Ga0316575_103726032 149
43 3300031691 Ga0316579_10011108 Ga0316579_100111083 149
44 3300035090 Ga0373949_0000080 Ga0373949_0000080_18071_18571 149
45 3300035111 Ga0373923_0086754 Ga0373923_0086754_697_1170 149
46 3300035113 Ga0373936_0462351 Ga0373936_0462351_33_500 149
47 3300035117 Ga0373953_0001525 Ga0373953_0001525_2419_2892 149
48 3300035118 Ga0373954_0000189 Ga0373954_0000189_4118_4591 149
49 3300035119 Ga0373956_0000794 Ga0373956_0000794_111_584 149
50 3300035120 Ga0373957_0003434 Ga0373957_0003434_3194_3667 149
51 3300035172 Ga0373955_0000598 Ga0373955_0000598_14047_14520 149
52 3300035724 Ga0373933_0000275 Ga0373933_0000275_13331_13804 149
53 3300036401 Ga0373937_0000123 Ga0373937_0000123_28218_28691 149
54 3300036647 Ga0316582_0229734 Ga0316582_0229734_61_552 149
55 3300036712 Ga0316584_0026171 Ga0316584_0026171_2868_3359 149
56 3300037471 Ga0395905_0001477 Ga0395905_0001477_4314_4784 149
57 3300039438 Ga0436360_0419454 Ga0436360_0419454_380_832 149
58 3300039447 Ga0436361_0238025 Ga0436361_0238025_6898_7356 149
59 3300039453 Ga0436362_0452825 Ga0436362_0452825_389_871 149
60 3300046454 Ga0495592_0069028 Ga0495592_0069028_1383_1856 149
61 3300046457 Ga0495590_0275784 Ga0495590_0275784_86_556 149
62 3300046462 Ga0495651_0035782 Ga0495651_0035782_1992_2465 149
63 3300046491 Ga0495584_0008163 Ga0495584_0008163_1773_2243 149
64 3300046491 Ga0495584_0266967 Ga0495584_0266967_190_660 149
65 3300046501 Ga0495607_0098039 Ga0495607_0098039_712_1182 149
66 3300046506 Ga0495583_0013493 Ga0495583_0013493_343_813 149
67 3300046511 Ga0495608_0007892 Ga0495608_0007892_2284_2757 149
68 3300046519 Ga0495632_0000406 Ga0495632_0000406_38779_39249 149
69 3300046528 Ga0495642_0049482 Ga0495642_0049482_531_1001 149
70 3300046536 Ga0495587_0000303 Ga0495587_0000303_19002_19475 149
71 3300046542 Ga0495597_0071962 Ga0495597_0071962_342_812 149
72 3300046616 Ga0495668_0054352 Ga0495668_0054352_1348_1818 149
73 3300046660 Ga0495625_0004317 Ga0495625_0004317_4358_4828 149
74 3300046664 Ga0495659_0001986 Ga0495659_0001986_3153_3623 149
75 3300046665 Ga0495661_0004762 Ga0495661_0004762_1967_2437 149
76 3300046675 Ga0495657_0123958 Ga0495657_0123958_426_899 149
77 3300046684 Ga0495669_0000750 Ga0495669_0000750_3716_4186 149
78 3300046692 Ga0495671_0059021 Ga0495671_0059021_1298_1768 149
79 3300046692 Ga0495671_0292909 Ga0495671_0292909_187_657 149
80 3300046694 Ga0495649_0002473 Ga0495649_0002473_4779_5249 149
81 3300046794 Ga0495589_0402677 Ga0495589_0402677_141_611 149
82 3300047317 Ga0495604_0000176 Ga0495604_0000176_40203_40676 149
83 3300047318 Ga0495636_0001659 Ga0495636_0001659_2776_3246 149
84 3300047320 Ga0495672_0001365 Ga0495672_0001365_14379_14849 149
85 3300047443 Ga0495687_000317 Ga0495687_000317_57259_57744 149
86 3300047443 Ga0495687_014641 Ga0495687_014641_2857_3327 149
87 3300047445 Ga0495677_0002650 Ga0495677_0002650_3683_4153 149
88 3300047447 Ga0495685_000943 Ga0495685_000943_5511_5981 149
89 3300047470 Ga0495681_0003109 Ga0495681_0003109_2929_3399 149
90 3300047471 Ga0495684_0027365 Ga0495684_0027365_124_597 149
91 3300048088 Ga0495602_0000362 Ga0495602_0000362_19325_19798 149
92 3300053085 Ga0495619_0268163 Ga0495619_0268163_634_1107 149
93 3300004798 Ga0058859_11522584 Ga0058859_115225842 150
94 3300005347 Ga0070668_100278909 Ga0070668_1002789091 150
95 3300005353 Ga0070669_100998786 Ga0070669_1009987862 150
96 3300005364 Ga0070673_100935508 Ga0070673_1009355082 150
97 3300005366 Ga0070659_100038772 Ga0070659_1000387726 150
98 3300005366 Ga0070659_100148646 Ga0070659_1001486462 150
99 3300005436 Ga0070713_100210196 Ga0070713_1002101961 150
100 3300005444 Ga0070694_100288686 Ga0070694_1002886862 150
101 3300005445 Ga0070708_100027509 Ga0070708_1000275095 150
102 3300005445 Ga0070708_100051841 Ga0070708_1000518411 150
103 3300005445 Ga0070708_100093838 Ga0070708_1000938382 150
104 3300005467 Ga0070706_101048307 Ga0070706_1010483071 150
105 3300005536 Ga0070697_100000769 Ga0070697_1000007693 150
106 3300005536 Ga0070697_100668115 Ga0070697_1006681151 150
107 3300005549 Ga0070704_100119682 Ga0070704_1001196821 150
108 3300005617 Ga0068859_100906409 Ga0068859_1009064092 150
109 3300005719 Ga0068861_100194724 Ga0068861_1001947242 150
110 3300005843 Ga0068860_100039544 Ga0068860_1000395442 150
111 3300005937 Ga0081455_10078241 Ga0081455_100782412 150
112 3300005981 Ga0081538_10013801 Ga0081538_100138012 150
113 3300005981 Ga0081538_10350405 Ga0081538_103504051 150
114 3300006028 Ga0070717_10477866 Ga0070717_104778662 150
115 3300006880 Ga0075429_101201163 Ga0075429_1012011632 150
116 3300006914 Ga0075436_100009340 Ga0075436_1000093406 150
117 3300006931 Ga0097620_100906447 Ga0097620_1009064472 150
118 3300007076 Ga0075435_101286459 Ga0075435_1012864591 150
119 3300007265 Ga0099794_10043719 Ga0099794_100437192 150
120 3300007265 Ga0099794_10138435 Ga0099794_101384352 150
121 3300007265 Ga0099794_10172963 Ga0099794_101729632 150
122 3300007265 Ga0099794_10544180 Ga0099794_105441801 150
123 3300009177 Ga0105248_10005978 Ga0105248_100059783 150
124 3300009551 Ga0105238_10070218 Ga0105238_100702183 150
125 3300009551 Ga0105238_10312790 Ga0105238_103127902 150
126 3300010375 Ga0105239_10088594 Ga0105239_100885942 150
127 3300013297 Ga0157378_10003357 Ga0157378_1000335710 150
128 3300013306 Ga0163162_10045428 Ga0163162_100454282 150
129 3300013308 Ga0157375_10714465 Ga0157375_107144652 150
130 3300025906 Ga0207699_10357512 Ga0207699_103575122 150
131 3300025913 Ga0207695_10061076 Ga0207695_100610764 150
132 3300025924 Ga0207694_10096748 Ga0207694_100967482 150
133 3300025929 Ga0207664_10067026 Ga0207664_100670262 150
134 3300025929 Ga0207664_11077497 Ga0207664_110774972 150
135 3300025932 Ga0207690_10118061 Ga0207690_101180612 150
136 3300025932 Ga0207690_10385662 Ga0207690_103856622 150
137 3300025934 Ga0207686_10228186 Ga0207686_102281862 150
138 3300025960 Ga0207651_11038568 Ga0207651_110385682 150
139 3300026118 Ga0207675_100658116 Ga0207675_1006581162 150
140 3300027671 Ga0209588_1026893 Ga0209588_10268932 150
141 3300027671 Ga0209588_1062029 Ga0209588_10620292 150
142 3300027671 Ga0209588_1223903 Ga0209588_12239031 150
143 3300027866 Ga0209813_10235612 Ga0209813_102356121 150
144 3300028381 Ga0268264_10515256 Ga0268264_105152562 150
145 3300031548 Ga0307408_100259413 Ga0307408_1002594132 150
146 3300031548 Ga0307408_100351600 Ga0307408_1003516002 150
147 3300031911 Ga0307412_10638287 Ga0307412_106382871 150
148 3300031995 Ga0307409_100129579 Ga0307409_1001295792 150
149 3300032004 Ga0307414_10180370 Ga0307414_101803703 150
150 3300032005 Ga0307411_12063426 Ga0307411_120634261 150
151 3300032126 Ga0307415_100180975 Ga0307415_1001809753 150
152 3300035121 Ga0373960_0064213 Ga0373960_0064213_365_826 150
153 3300035171 Ga0373946_0005493 Ga0373946_0005493_320_799 150
154 3300035241 Ga0373961_0067504 Ga0373961_0067504_39_500 150
155 3300035695 Ga0373927_0015095 Ga0373927_0015095_4486_4965 150
156 3300035725 Ga0373947_0012202 Ga0373947_0012202_1443_1922 150
157 3300037068 Ga0373925_0007175 Ga0373925_0007175_4467_4946 150
158 3300039450 Ga0436363_0894292 Ga0436363_0894292_301_756 150
159 3300042008 Ga0439450_052990 Ga0439450_052990_306_758 150
160 3300042156 Ga0439446_0219262 Ga0439446_0219262_89_541 150
161 3300045836 Ga0466958_0243282 Ga0466958_0243282_12_482 150
162 3300045976 Ga0466967_0654357 Ga0466967_0654357_497_949 150
163 3300046491 Ga0495584_0042541 Ga0495584_0042541_185_646 150
164 3300046514 Ga0495618_0074200 Ga0495618_0074200_817_1296 150
165 3300046517 Ga0495630_0003619 Ga0495630_0003619_3137_3616 150
166 3300046526 Ga0495666_0021116 Ga0495666_0021116_659_1138 150
167 3300046684 Ga0495669_0036427 Ga0495669_0036427_1310_1771 150
168 3300046690 Ga0495624_0021941 Ga0495624_0021941_1055_1534 150
169 3300047317 Ga0495604_0100677 Ga0495604_0100677_1481_1960 150
170 3300047317 Ga0495604_0118233 Ga0495604_0118233_697_1176 150
171 3300047321 Ga0495676_0047525 Ga0495676_0047525_206_685 150
172 3300048904 Ga0496101_0305137 Ga0496101_0305137_732_1208 150
173 3300048904 Ga0496101_1215242 Ga0496101_1215242_62_544 150
174 3300048905 Ga0496102_0011806 Ga0496102_0011806_3616_4098 150
175 3300048906 Ga0496103_0087069 Ga0496103_0087069_643_1125 150
176 3300048909 Ga0496106_0053673 Ga0496106_0053673_104_586 150
177 3300048910 Ga0496107_0147659 Ga0496107_0147659_428_973 150
178 3300048910 Ga0496107_0161043 Ga0496107_0161043_80_562 150
179 3300048915 Ga0496112_0055909 Ga0496112_0055909_2296_2778 150
180 3300048917 Ga0496114_0159895 Ga0496114_0159895_699_1244 150
181 3300048918 Ga0496115_0018315 Ga0496115_0018315_1696_2241 150
182 3300049568 Ga0501031_0003301 Ga0501031_0003301_2954_3409 150
183 3300049568 Ga0501031_0582658 Ga0501031_0582658_168_620 150
184 3300049570 Ga0501033_0326009 Ga0501033_0326009_195_647 150
185 3300049571 Ga0501034_0003870 Ga0501034_0003870_6120_6575 150
186 3300049572 Ga0501036_0046217 Ga0501036_0046217_1847_2302 150
187 3300049572 Ga0501036_0080512 Ga0501036_0080512_1433_1885 150
188 3300049573 Ga0501037_0008470 Ga0501037_0008470_3118_3573 150
189 3300049574 Ga0501038_0018893 Ga0501038_0018893_915_1370 150
190 3300049574 Ga0501038_0045317 Ga0501038_0045317_3108_3560 150
191 3300049575 Ga0501039_0000793 Ga0501039_0000793_6039_6494 150
192 3300049575 Ga0501039_0101674 Ga0501039_0101674_968_1420 150
193 3300049576 Ga0501040_0020485 Ga0501040_0020485_3225_3677 150
194 3300049577 Ga0501041_0006656 Ga0501041_0006656_5374_5826 150
195 3300049578 Ga0501042_0022097 Ga0501042_0022097_3458_3910 150
196 3300049579 Ga0501043_0080269 Ga0501043_0080269_1364_1816 150
197 3300049579 Ga0501043_0144217 Ga0501043_0144217_1184_1639 150
198 3300049580 Ga0501046_0001994 Ga0501046_0001994_1847_2302 150
199 3300049580 Ga0501046_0019849 Ga0501046_0019849_298_750 150
200 3300049581 Ga0501047_0129938 Ga0501047_0129938_98_553 150
201 3300049582 Ga0501048_0018663 Ga0501048_0018663_4025_4477 150
202 3300049582 Ga0501048_0029236 Ga0501048_0029236_2905_3360 150
203 3300049583 Ga0501067_0428842 Ga0501067_0428842_253_714 150
204 3300049584 Ga0501068_0030823 Ga0501068_0030823_819_1274 150
205 3300049585 Ga0501069_0021182 Ga0501069_0021182_2055_2510 150
206 3300049586 Ga0501070_0008650 Ga0501070_0008650_7234_7689 150
207 3300049586 Ga0501070_0175429 Ga0501070_0175429_52_504 150
208 3300049588 Ga0501072_0009040 Ga0501072_0009040_3840_4295 150
209 3300049588 Ga0501072_0012791 Ga0501072_0012791_5244_5696 150
210 3300049589 Ga0501073_0001699 Ga0501073_0001699_915_1370 150
211 3300049590 Ga0501074_0010366 Ga0501074_0010366_1847_2302 150
212 3300049591 Ga0501075_0017673 Ga0501075_0017673_900_1352 150
213 3300049592 Ga0501076_0006568 Ga0501076_0006568_3669_4121 150
214 3300049592 Ga0501076_0323195 Ga0501076_0323195_304_759 150
215 3300049593 Ga0501077_0037808 Ga0501077_0037808_586_1041 150
216 3300049593 Ga0501077_0399653 Ga0501077_0399653_378_830 150
217 3300049593 Ga0501077_0449809 Ga0501077_0449809_128_580 150
218 3300049741 Ga0501079_0002477 Ga0501079_0002477_2981_3433 150
219 3300049741 Ga0501079_0043898 Ga0501079_0043898_1149_1604 150
220 3300049741 Ga0501079_1300655 Ga0501079_1300655_10_462 150
221 3300049742 Ga0501080_0000034 Ga0501080_0000034_21458_21913 150
222 3300049742 Ga0501080_0270940 Ga0501080_0270940_993_1445 150
223 3300049743 Ga0501081_0661914 Ga0501081_0661914_132_590 150
224 3300049744 Ga0501083_0028166 Ga0501083_0028166_2271_2726 150
225 3300049744 Ga0501083_0142913 Ga0501083_0142913_827_1279 150
226 3300049822 Ga0501035_0038838 Ga0501035_0038838_1513_1968 150
227 3300049822 Ga0501035_0575234 Ga0501035_0575234_377_829 150
228 3300049823 Ga0501044_0045948 Ga0501044_0045948_1847_2302 150
229 3300049824 Ga0501045_0009687 Ga0501045_0009687_724_1176 150
230 3300049824 Ga0501045_0296449 Ga0501045_0296449_631_1086 150
231 3300050489 nmdc:mga03683_22807_c1 nmdc:mga03683_22807_c1_454_906 150
232 3300050490 nmdc:mga03n38_395501_c1 nmdc:mga03n38_395501_c1_25_477 150
233 3300050493 nmdc:mga0k408_31979_c1 nmdc:mga0k408_31979_c1_2287_2739 150
234 3300050496 nmdc:mga07m45_45679_c1 nmdc:mga07m45_45679_c1_1981_2433 150
235 3300050514 nmdc:mga08x19_180_c1 nmdc:mga08x19_180_c1_47064_47543 150
236 3300053077 Ga0495601_0070209 Ga0495601_0070209_1502_1981 150
237 3300053085 Ga0495619_0016094 Ga0495619_0016094_2435_2914 150
238 3300054114 Ga0501084_0001644 Ga0501084_0001644_3109_3564 150
239 3300054114 Ga0501084_0023902 Ga0501084_0023902_4534_4986 150
240 3300059421 Ga0590071_020396 Ga0590071_020396_812_1264 150
241 3300059493 Ga0587077_138345 Ga0587077_138345_136_588 150
242 3300059640 Ga0587067_081629 Ga0587067_081629_119_571 150
243 3300059641 Ga0587068_051375 Ga0587068_051375_23_475 150
244 3300059647 Ga0587079_235518 Ga0587079_235518_22_474 150
245 3300059658 Ga0587119_020787 Ga0587119_020787_246_698 150
246 3300060344 Ga0587071_152391 Ga0587071_152391_89_541 150
247 3300060353 Ga0501082_0069892 Ga0501082_0069892_1184_1639 150
248 3300060353 Ga0501082_0168754 Ga0501082_0168754_717_1169 150
249 3300060353 Ga0501082_0656678 Ga0501082_0656678_39_491 150
250 3300061734 Ga0530510_0013664 Ga0530510_0013664_763_1215 150
251 3300061734 Ga0530510_0450629 Ga0530510_0450629_27_479 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

97

169

0.93

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

29

96

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9821 2 149
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9629 2 149
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9558 2 149
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9547 2 149
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9518 2 149
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9716 82 149 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9663 2 74 3.10.20.30
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9596 82 149 1.10.150.120
5y6qA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9465 82 149 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9401 77 149 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A2V7FSL9-F1-model_v4 (2Fe-2S)-binding protein 0.994 43 148 GO:0016491
GO:0046872
GO:0051537
AF-A0A0W1RUA3-F1-model_v4 (2Fe-2S)-binding protein 0.9935 20 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A191ZHF8-F1-model_v4 (2Fe-2S)-binding protein 0.9925 2 148 GO:0016491
GO:0046872
GO:0051537
AF-V5SCH1-F1-model_v4 (2Fe-2S)-binding protein 0.9919 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A0Q5ZNZ3-F1-model_v4 (2Fe-2S)-binding protein 0.9917 1 148 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
94.9 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map