F362570
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 251 | 172 | 251 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_0528327|Ga0395898_0528327_309_923 |
| Length | 194 |
| Sequence | MRRVSVPGLLILLLATTCAAWAARVGEAAPEFTGTDSHGQTHRLSDYRGKYVVLEWTNNGCPYTLKHYDSGNMQALQKEWTAKGVVWLTILSSHPGAQGYMTAAQENAYMTRVHAAPTAAILDPSGAIGHLYDAKTTKLIYAGAIDNKATTDTADVKDANNYVSAALKEALAGQAVAVSYTRPYGCSVKYRGAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 2 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 48 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 105 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 106 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 107 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 108 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 109 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 111 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 114 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 117 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 118 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 119 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 120 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 121 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 122 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 123 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 124 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 125 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 126 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 127 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 161 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 171 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.01 |
| Metatranscriptomes | 1.99 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 95.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1006583 | 3300002705 | Bacteria | 3150 |
| 2 | Ga0070666_10641203 | 3300005335 | Bacteria | 777 |
| 3 | Ga0070660_100541524 | 3300005339 | Unclassified | 971 |
| 4 | Ga0070668_100569890 | 3300005347 | Bacteria | 987 |
| 5 | Ga0070669_100034202 | 3300005353 | Bacteria | 3680 |
| 6 | Ga0070674_100006437 | 3300005356 | Bacteria | 6854 |
| 7 | Ga0070673_100561968 | 3300005364 | Bacteria | 1037 |
| 8 | Ga0070659_100040486 | 3300005366 | Unclassified | 3642 |
| 9 | Ga0070667_100127736 | 3300005367 | Bacteria | 2217 |
| 10 | Ga0070709_10128796 | 3300005434 | Unclassified | 1725 |
| 11 | Ga0070709_10186576 | 3300005434 | Bacteria | 1460 |
| 12 | Ga0070714_100181383 | 3300005435 | Bacteria | 1916 |
| 13 | Ga0070714_100315592 | 3300005435 | Bacteria | 1460 |
| 14 | Ga0070713_100074553 | 3300005436 | Bacteria | 2875 |
| 15 | Ga0070713_100123410 | 3300005436 | Bacteria | 2275 |
| 16 | Ga0070711_100033820 | 3300005439 | Bacteria | 3406 |
| 17 | Ga0070708_100009427 | 3300005445 | Bacteria | 7872 |
| 18 | Ga0070708_100044065 | 3300005445 | Bacteria | 3922 |
| 19 | Ga0070708_100046585 | 3300005445 | Bacteria | 3826 |
| 20 | Ga0070708_100262715 | 3300005445 | Bacteria | 1623 |
| 21 | Ga0070662_100741816 | 3300005457 | Bacteria | 832 |
| 22 | Ga0068867_100005169 | 3300005459 | Bacteria | 9209 |
| 23 | Ga0068867_100538797 | 3300005459 | Bacteria | 1009 |
| 24 | Ga0070706_100000778 | 3300005467 | Bacteria | 35677 |
| 25 | Ga0070706_100008334 | 3300005467 | Bacteria | 9659 |
| 26 | Ga0070706_100015145 | 3300005467 | Bacteria | 7120 |
| 27 | Ga0070707_100007071 | 3300005468 | Bacteria | 10408 |
| 28 | Ga0070707_100133644 | 3300005468 | Bacteria | 2413 |
| 29 | Ga0070698_100000050 | 3300005471 | Bacteria | 83255 |
| 30 | Ga0070698_100009121 | 3300005471 | Bacteria | 10651 |
| 31 | Ga0070699_100006451 | 3300005518 | Bacteria | 10218 |
| 32 | Ga0070684_100343044 | 3300005535 | Bacteria | 1373 |
| 33 | Ga0070697_100007692 | 3300005536 | Bacteria | 8392 |
| 34 | Ga0070697_100009185 | 3300005536 | Bacteria | 7724 |
| 35 | Ga0070697_100021110 | 3300005536 | Bacteria | 5157 |
| 36 | Ga0070697_100034934 | 3300005536 | Bacteria | 4055 |
| 37 | Ga0070697_100085577 | 3300005536 | Bacteria | 2601 |
| 38 | Ga0070697_100260214 | 3300005536 | Bacteria | 1485 |
| 39 | Ga0068853_100014092 | 3300005539 | Bacteria | 6545 |
| 40 | Ga0068853_100353506 | 3300005539 | Bacteria | 1367 |
| 41 | Ga0070672_100015108 | 3300005543 | Bacteria | 5488 |
| 42 | Ga0070686_100149922 | 3300005544 | Bacteria | 1632 |
| 43 | Ga0070695_100016326 | 3300005545 | Bacteria | 4493 |
| 44 | Ga0070693_100358204 | 3300005547 | Bacteria | 1000 |
| 45 | Ga0068855_100004243 | 3300005563 | Bacteria | 17503 |
| 46 | Ga0068855_100390975 | 3300005563 | Bacteria | 1525 |
| 47 | Ga0068854_100364061 | 3300005578 | Unclassified | 1187 |
| 48 | Ga0068856_100019805 | 3300005614 | Bacteria | 6532 |
| 49 | Ga0068856_100033182 | 3300005614 | Bacteria | 5055 |
| 50 | Ga0068856_100252210 | 3300005614 | Bacteria | 1780 |
| 51 | Ga0068856_100825083 | 3300005614 | Unclassified | 947 |
| 52 | Ga0068852_100002154 | 3300005616 | Bacteria | 13525 |
| 53 | Ga0068859_100046064 | 3300005617 | Bacteria | 4381 |
| 54 | Ga0068866_10181237 | 3300005718 | Bacteria | 1244 |
| 55 | Ga0068861_100002116 | 3300005719 | Bacteria | 12848 |
| 56 | Ga0068860_100004405 | 3300005843 | Bacteria | 14389 |
| 57 | Ga0068860_100521382 | 3300005843 | Bacteria | 1188 |
| 58 | Ga0068862_100006922 | 3300005844 | Bacteria | 9404 |
| 59 | Ga0068862_100214683 | 3300005844 | Bacteria | 1740 |
| 60 | Ga0070717_10008778 | 3300006028 | Bacteria | 7567 |
| 61 | Ga0070715_10389638 | 3300006163 | Unclassified | 771 |
| 62 | Ga0070716_100012297 | 3300006173 | Bacteria | 4335 |
| 63 | Ga0070712_100072787 | 3300006175 | Bacteria | 2463 |
| 64 | Ga0075430_100005048 | 3300006846 | Bacteria | 11109 |
| 65 | Ga0075431_100147316 | 3300006847 | Bacteria | 2425 |
| 66 | Ga0075431_100386219 | 3300006847 | Bacteria | 1403 |
| 67 | Ga0075431_101057537 | 3300006847 | Unclassified | 777 |
| 68 | Ga0075434_100213755 | 3300006871 | Unclassified | 1948 |
| 69 | Ga0068865_100004435 | 3300006881 | Bacteria | 8461 |
| 70 | Ga0075436_100008414 | 3300006914 | Bacteria | 7055 |
| 71 | Ga0097620_100046064 | 3300006931 | Bacteria | 4381 |
| 72 | Ga0099794_10039578 | 3300007265 | Unclassified | 2238 |
| 73 | Ga0099794_10070955 | 3300007265 | Bacteria | 1706 |
| 74 | Ga0099795_10003415 | 3300007788 | Bacteria | 3927 |
| 75 | Ga0105240_10047303 | 3300009093 | Bacteria | 5444 |
| 76 | Ga0105240_10257729 | 3300009093 | Bacteria | 2014 |
| 77 | Ga0114129_10073810 | 3300009147 | Bacteria | 4752 |
| 78 | Ga0105243_10011346 | 3300009148 | Bacteria | 6744 |
| 79 | Ga0105241_10027131 | 3300009174 | Bacteria | 4263 |
| 80 | Ga0105248_10623469 | 3300009177 | Bacteria | 1217 |
| 81 | Ga0105237_10057416 | 3300009545 | Bacteria | 3896 |
| 82 | Ga0105237_10671258 | 3300009545 | Bacteria | 1043 |
| 83 | Ga0105237_10748476 | 3300009545 | Bacteria | 984 |
| 84 | Ga0105238_10012838 | 3300009551 | Bacteria | 8451 |
| 85 | Ga0105238_10190162 | 3300009551 | Unclassified | 2029 |
| 86 | Ga0105239_10050642 | 3300010375 | Bacteria | 4554 |
| 87 | Ga0157371_10378945 | 3300013102 | Unclassified | 1033 |
| 88 | Ga0157369_10165069 | 3300013105 | Bacteria | 2336 |
| 89 | Ga0157369_10656540 | 3300013105 | Unclassified | 1081 |
| 90 | Ga0157369_11049264 | 3300013105 | Unclassified | 834 |
| 91 | Ga0157378_10037436 | 3300013297 | Bacteria | 4296 |
| 92 | Ga0157378_10050729 | 3300013297 | Bacteria | 3692 |
| 93 | Ga0163162_10018672 | 3300013306 | Bacteria | 6794 |
| 94 | Ga0163162_10819340 | 3300013306 | Bacteria | 1047 |
| 95 | Ga0157372_10209228 | 3300013307 | Bacteria | 2260 |
| 96 | Ga0157380_10016528 | 3300014326 | Bacteria | 5443 |
| 97 | Ga0157379_10019615 | 3300014968 | Bacteria | 5972 |
| 98 | Ga0157379_10037065 | 3300014968 | Bacteria | 4348 |
| 99 | Ga0163161_10144938 | 3300017792 | Bacteria | 1801 |
| 100 | Ga0209759_1000660 | 3300025256 | Bacteria | 31995 |
| 101 | Ga0207692_10315328 | 3300025898 | Bacteria | 955 |
| 102 | Ga0207684_10000641 | 3300025910 | Bacteria | 41415 |
| 103 | Ga0207684_10013370 | 3300025910 | Bacteria | 7100 |
| 104 | Ga0207684_10046123 | 3300025910 | Bacteria | 3697 |
| 105 | Ga0207684_10095800 | 3300025910 | Bacteria | 2533 |
| 106 | Ga0207654_10002450 | 3300025911 | Bacteria | 9462 |
| 107 | Ga0207695_10004894 | 3300025913 | Bacteria | 18050 |
| 108 | Ga0207671_10003729 | 3300025914 | Bacteria | 15013 |
| 109 | Ga0207671_10485759 | 3300025914 | Bacteria | 984 |
| 110 | Ga0207693_10027577 | 3300025915 | Bacteria | 4489 |
| 111 | Ga0207693_10071784 | 3300025915 | Bacteria | 2710 |
| 112 | Ga0207693_10094140 | 3300025915 | Unclassified | 2348 |
| 113 | Ga0207663_10091330 | 3300025916 | Bacteria | 2021 |
| 114 | Ga0207657_10451280 | 3300025919 | Unclassified | 1009 |
| 115 | Ga0207649_10297582 | 3300025920 | Unclassified | 1179 |
| 116 | Ga0207646_10000463 | 3300025922 | Bacteria | 54224 |
| 117 | Ga0207646_10005182 | 3300025922 | Bacteria | 13782 |
| 118 | Ga0207646_10882198 | 3300025922 | Bacteria | 794 |
| 119 | Ga0207681_10026678 | 3300025923 | Bacteria | 3729 |
| 120 | Ga0207694_10000084 | 3300025924 | Bacteria | 108906 |
| 121 | Ga0207694_10283141 | 3300025924 | Unclassified | 1362 |
| 122 | Ga0207700_10059585 | 3300025928 | Bacteria | 2888 |
| 123 | Ga0207664_10611185 | 3300025929 | Unclassified | 979 |
| 124 | Ga0207709_10474388 | 3300025935 | Bacteria | 972 |
| 125 | Ga0207669_10058318 | 3300025937 | Bacteria | 2355 |
| 126 | Ga0207704_10033838 | 3300025938 | Bacteria | 2910 |
| 127 | Ga0207665_10053032 | 3300025939 | Bacteria | 2733 |
| 128 | Ga0207665_10076484 | 3300025939 | Archaea | 2295 |
| 129 | Ga0207691_10025827 | 3300025940 | Bacteria | 5512 |
| 130 | Ga0207689_10147110 | 3300025942 | Bacteria | 1941 |
| 131 | Ga0207679_10275829 | 3300025945 | Unclassified | 1440 |
| 132 | Ga0207667_10012696 | 3300025949 | Bacteria | 9681 |
| 133 | Ga0207667_10336064 | 3300025949 | Bacteria | 1542 |
| 134 | Ga0207651_10603009 | 3300025960 | Bacteria | 960 |
| 135 | Ga0207712_10094527 | 3300025961 | Bacteria | 2208 |
| 136 | Ga0207668_10409004 | 3300025972 | Bacteria | 1149 |
| 137 | Ga0207640_10220412 | 3300025981 | Bacteria | 1452 |
| 138 | Ga0207639_10018936 | 3300026041 | Bacteria | 4901 |
| 139 | Ga0207639_10144536 | 3300026041 | Bacteria | 1985 |
| 140 | Ga0207702_10072161 | 3300026078 | Bacteria | 2975 |
| 141 | Ga0207702_10136028 | 3300026078 | Bacteria | 2217 |
| 142 | Ga0207702_10390198 | 3300026078 | Bacteria | 1340 |
| 143 | Ga0207702_10927235 | 3300026078 | Bacteria | 863 |
| 144 | Ga0207641_10010943 | 3300026088 | Bacteria | 7434 |
| 145 | Ga0207648_10001254 | 3300026089 | Bacteria | 28374 |
| 146 | Ga0207675_100000368 | 3300026118 | Bacteria | 43073 |
| 147 | Ga0207675_100744432 | 3300026118 | Bacteria | 991 |
| 148 | Ga0207698_10003724 | 3300026142 | Bacteria | 9222 |
| 149 | Ga0209588_1005290 | 3300027671 | Bacteria | 3690 |
| 150 | Ga0209588_1012569 | 3300027671 | Unclassified | 2571 |
| 151 | Ga0209966_1003309 | 3300027695 | Bacteria | 2709 |
| 152 | Ga0268265_10003321 | 3300028380 | Bacteria | 11641 |
| 153 | Ga0268264_10000501 | 3300028381 | Bacteria | 50746 |
| 154 | Ga0268264_10000850 | 3300028381 | Bacteria | 32562 |
| 155 | Ga0268264_10045206 | 3300028381 | Bacteria | 3656 |
| 156 | Ga0268264_10662382 | 3300028381 | Bacteria | 1034 |
| 157 | Ga0265762_1016650 | 3300030760 | Bacteria | 1336 |
| 158 | Ga0265760_10000064 | 3300031090 | Bacteria | 28923 |
| 159 | Ga0265760_10005396 | 3300031090 | Unclassified | 3669 |
| 160 | Ga0265760_10080391 | 3300031090 | Bacteria | 1009 |
| 161 | Ga0307516_10000897 | 3300031730 | Bacteria | 40914 |
| 162 | Ga0316212_1000363 | 3300033547 | Bacteria | 5373 |
| 163 | Ga0373926_0041064 | 3300035083 | Unclassified | 1652 |
| 164 | Ga0373926_0056558 | 3300035083 | Bacteria | 1424 |
| 165 | Ga0373944_0006159 | 3300035089 | Bacteria | 3180 |
| 166 | Ga0373955_0230936 | 3300035172 | Unclassified | 1107 |
| 167 | Ga0373935_0019210 | 3300035692 | Unclassified | 4168 |
| 168 | Ga0373935_0821005 | 3300035692 | Bacteria | 687 |
| 169 | Ga0373927_0021233 | 3300035695 | Bacteria | 4254 |
| 170 | Ga0373927_0040445 | 3300035695 | Bacteria | 3024 |
| 171 | Ga0373937_0001750 | 3300036401 | Bacteria | 18268 |
| 172 | Ga0373937_0076215 | 3300036401 | Unclassified | 3097 |
| 173 | Ga0373925_0001392 | 3300037068 | Bacteria | 21050 |
| 174 | Ga0395898_0315221 | 3300037466 | Bacteria | 1492 |
| 175 | Ga0395898_0528327 | 3300037466 | Unclassified | 1121 |
| 176 | Ga0436364_1472495 | 3300037853 | Unclassified | 892 |
| 177 | Ga0436365_1126385 | 3300039437 | Bacteria | 2752 |
| 178 | Ga0436365_1728496 | 3300039437 | Bacteria | 3066 |
| 179 | Ga0436363_0198889 | 3300039450 | Unclassified | 1105 |
| 180 | Ga0436363_0674534 | 3300039450 | Bacteria | 2031 |
| 181 | Ga0436363_1048316 | 3300039450 | Bacteria | 1277 |
| 182 | Ga0436362_1044768 | 3300039453 | Unclassified | 2245 |
| 183 | Ga0439453_0007186 | 3300041408 | Bacteria | 1758 |
| 184 | Ga0439441_016622 | 3300042001 | Bacteria | 1314 |
| 185 | Ga0439460_0038463 | 3300042461 | Bacteria | 1395 |
| 186 | Ga0453683_0026951 | 3300044673 | Unclassified | 3648 |
| 187 | Ga0453683_0282301 | 3300044673 | Bacteria | 1061 |
| 188 | Ga0466963_0349122 | 3300044694 | Bacteria | 1042 |
| 189 | Ga0453684_0139676 | 3300044712 | Unclassified | 2895 |
| 190 | Ga0466959_0269425 | 3300045049 | Bacteria | 1171 |
| 191 | Ga0451576_0049659 | 3300045051 | Bacteria | 4403 |
| 192 | Ga0466958_0386242 | 3300045836 | Bacteria | 903 |
| 193 | Ga0495651_0000130 | 3300046462 | Bacteria | 56014 |
| 194 | Ga0495653_0018468 | 3300046463 | Bacteria | 5661 |
| 195 | Ga0495664_0116041 | 3300046477 | Bacteria | 1618 |
| 196 | Ga0495608_0005318 | 3300046511 | Bacteria | 9199 |
| 197 | Ga0495628_0010430 | 3300046516 | Bacteria | 7894 |
| 198 | Ga0495630_0021752 | 3300046517 | Unclassified | 4737 |
| 199 | Ga0495666_0103682 | 3300046526 | Unclassified | 1339 |
| 200 | Ga0495652_0073605 | 3300046529 | Bacteria | 2844 |
| 201 | Ga0495665_0005669 | 3300046531 | Bacteria | 6738 |
| 202 | Ga0495586_0004147 | 3300046535 | Bacteria | 7767 |
| 203 | Ga0495586_0026447 | 3300046535 | Bacteria | 3105 |
| 204 | Ga0495586_0081927 | 3300046535 | Bacteria | 1774 |
| 205 | Ga0495587_0315780 | 3300046536 | Unclassified | 873 |
| 206 | Ga0495645_0104994 | 3300046543 | Bacteria | 2005 |
| 207 | Ga0495667_0056772 | 3300046559 | Unclassified | 2574 |
| 208 | Ga0495667_0134719 | 3300046559 | Bacteria | 1593 |
| 209 | Ga0495667_0606743 | 3300046559 | Unclassified | 682 |
| 210 | Ga0495634_0106973 | 3300046642 | Bacteria | 1802 |
| 211 | Ga0495611_0194045 | 3300046648 | Unclassified | 948 |
| 212 | Ga0495635_0167327 | 3300046663 | Unclassified | 1495 |
| 213 | Ga0495657_0011058 | 3300046675 | Bacteria | 6768 |
| 214 | Ga0495657_0041244 | 3300046675 | Bacteria | 3160 |
| 215 | Ga0495623_0013626 | 3300046679 | Bacteria | 5269 |
| 216 | Ga0495646_0003673 | 3300046680 | Bacteria | 9577 |
| 217 | Ga0495647_0022834 | 3300046681 | Bacteria | 2263 |
| 218 | Ga0495613_0118977 | 3300046689 | Unclassified | 1898 |
| 219 | Ga0495613_0256301 | 3300046689 | Bacteria | 1220 |
| 220 | Ga0495624_0346242 | 3300046690 | Unclassified | 894 |
| 221 | Ga0495589_0106097 | 3300046794 | Bacteria | 1357 |
| 222 | Ga0495600_0292679 | 3300046809 | Unclassified | 1029 |
| 223 | Ga0495604_0105254 | 3300047317 | Bacteria | 2065 |
| 224 | Ga0495636_0014146 | 3300047318 | Bacteria | 3173 |
| 225 | Ga0495674_0035884 | 3300047319 | Bacteria | 4469 |
| 226 | Ga0495674_0069068 | 3300047319 | Bacteria | 3056 |
| 227 | Ga0495680_0000182 | 3300047322 | Bacteria | 66757 |
| 228 | Ga0495675_0049065 | 3300047444 | Bacteria | 2684 |
| 229 | Ga0495675_0055630 | 3300047444 | Unclassified | 2510 |
| 230 | Ga0495684_0008696 | 3300047471 | Bacteria | 7853 |
| 231 | Ga0495684_0008870 | 3300047471 | Bacteria | 7769 |
| 232 | Ga0495684_0462666 | 3300047471 | Unclassified | 879 |
| 233 | Ga0495593_0118187 | 3300047673 | Unclassified | 1350 |
| 234 | Ga0495602_0019623 | 3300048088 | Bacteria | 6706 |
| 235 | Ga0495614_0039375 | 3300048089 | Bacteria | 2028 |
| 236 | Ga0496121_0143639 | 3300048924 | Bacteria | 1767 |
| 237 | Ga0501072_0004281 | 3300049588 | Bacteria | 10831 |
| 238 | Ga0501074_0163040 | 3300049590 | Bacteria | 1592 |
| 239 | nmdc:mga05p37_500144_c1 | 3300050507 | Unclassified | 1395 |
| 240 | nmdc:mga09592_157646_c1 | 3300050508 | Bacteria | 1960 |
| 241 | nmdc:mga0qj67_330922_c1 | 3300050509 | Bacteria | 1233 |
| 242 | nmdc:mga0qj67_332899_c1 | 3300050509 | Unclassified | 1228 |
| 243 | nmdc:mga06r32_354887_c1 | 3300050510 | Bacteria | 1451 |
| 244 | nmdc:mga06r32_836585_c1 | 3300050510 | Unclassified | 879 |
| 245 | nmdc:mga0n895_237423_c1 | 3300050512 | Bacteria | 1850 |
| 246 | nmdc:mga08x19_1377_c1 | 3300050514 | Bacteria | 15040 |
| 247 | nmdc:mga08x19_86576_c1 | 3300050514 | Bacteria | 2063 |
| 248 | Ga0495612_0065310 | 3300053078 | Unclassified | 1511 |
| 249 | Ga0500590_055874 | 3300053148 | Bacteria | 1996 |
| 250 | Ga0501084_0040219 | 3300054114 | Bacteria | 3910 |
| 251 | Ga0587073_0022189 | 3300059492 | Bacteria | 1230 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045049 | Ga0466959_0269425 | Ga0466959_0269425_347_928 | 179 |
| 2 | 3300045836 | Ga0466958_0386242 | Ga0466958_0386242_43_624 | 179 |
| 3 | 3300044694 | Ga0466963_0349122 | Ga0466963_0349122_221_823 | 187 |
| 4 | 3300005435 | Ga0070714_100315592 | Ga0070714_1003155922 | 189 |
| 5 | 3300005436 | Ga0070713_100123410 | Ga0070713_1001234102 | 189 |
| 6 | 3300005563 | Ga0068855_100390975 | Ga0068855_1003909752 | 189 |
| 7 | 3300005614 | Ga0068856_100825083 | Ga0068856_1008250832 | 189 |
| 8 | 3300013105 | Ga0157369_10165069 | Ga0157369_101650691 | 189 |
| 9 | 3300025949 | Ga0207667_10336064 | Ga0207667_103360642 | 189 |
| 10 | 3300026078 | Ga0207702_10072161 | Ga0207702_100721612 | 189 |
| 11 | 3300037466 | Ga0395898_0315221 | Ga0395898_0315221_90_704 | 189 |
| 12 | 3300039437 | Ga0436365_1126385 | Ga0436365_1126385_630_1202 | 189 |
| 13 | 3300005436 | Ga0070713_100074553 | Ga0070713_1000745532 | 190 |
| 14 | 3300025928 | Ga0207700_10059585 | Ga0207700_100595852 | 190 |
| 15 | 3300037466 | Ga0395898_0528327 | Ga0395898_0528327_309_923 | 190 |
| 16 | 3300049588 | Ga0501072_0004281 | Ga0501072_0004281_8374_9018 | 190 |
| 17 | 3300049590 | Ga0501074_0163040 | Ga0501074_0163040_151_795 | 190 |
| 18 | 3300054114 | Ga0501084_0040219 | Ga0501084_0040219_173_817 | 190 |
| 19 | 3300005445 | Ga0070708_100009427 | Ga0070708_1000094278 | 191 |
| 20 | 3300005467 | Ga0070706_100015145 | Ga0070706_1000151458 | 191 |
| 21 | 3300005468 | Ga0070707_100007071 | Ga0070707_10000707112 | 191 |
| 22 | 3300005536 | Ga0070697_100260214 | Ga0070697_1002602142 | 191 |
| 23 | 3300007265 | Ga0099794_10070955 | Ga0099794_100709552 | 191 |
| 24 | 3300025910 | Ga0207684_10013370 | Ga0207684_100133704 | 191 |
| 25 | 3300025922 | Ga0207646_10005182 | Ga0207646_100051822 | 191 |
| 26 | 3300009093 | Ga0105240_10047303 | Ga0105240_100473035 | 193 |
| 27 | 3300009174 | Ga0105241_10027131 | Ga0105241_100271312 | 193 |
| 28 | 3300009545 | Ga0105237_10057416 | Ga0105237_100574162 | 193 |
| 29 | 3300013105 | Ga0157369_10656540 | Ga0157369_106565402 | 193 |
| 30 | 3300006846 | Ga0075430_100005048 | Ga0075430_1000050483 | 196 |
| 31 | 3300006847 | Ga0075431_100147316 | Ga0075431_1001473163 | 196 |
| 32 | 3300006847 | Ga0075431_101057537 | Ga0075431_1010575372 | 196 |
| 33 | 3300050509 | nmdc:mga0qj67_332899_c1 | nmdc:mga0qj67_332899_c1_228_821 | 196 |
| 34 | 3300050510 | nmdc:mga06r32_836585_c1 | nmdc:mga06r32_836585_c1_33_626 | 196 |
| 35 | 3300005445 | Ga0070708_100044065 | Ga0070708_1000440652 | 198 |
| 36 | 3300005536 | Ga0070697_100085577 | Ga0070697_1000855773 | 198 |
| 37 | 3300006173 | Ga0070716_100012297 | Ga0070716_1000122976 | 198 |
| 38 | 3300025939 | Ga0207665_10076484 | Ga0207665_100764842 | 198 |
| 39 | 3300028381 | Ga0268264_10000501 | Ga0268264_1000050151 | 198 |
| 40 | 3300005435 | Ga0070714_100181383 | Ga0070714_1001813832 | 199 |
| 41 | 3300006914 | Ga0075436_100008414 | Ga0075436_1000084145 | 199 |
| 42 | 3300025929 | Ga0207664_10611185 | Ga0207664_106111851 | 199 |
| 43 | 3300050514 | nmdc:mga08x19_1377_c1 | nmdc:mga08x19_1377_c1_10701_11303 | 199 |
| 44 | 3300050514 | nmdc:mga08x19_86576_c1 | nmdc:mga08x19_86576_c1_1422_2024 | 199 |
| 45 | 3300005335 | Ga0070666_10641203 | Ga0070666_106412031 | 200 |
| 46 | 3300005339 | Ga0070660_100541524 | Ga0070660_1005415242 | 200 |
| 47 | 3300005366 | Ga0070659_100040486 | Ga0070659_1000404862 | 200 |
| 48 | 3300005434 | Ga0070709_10128796 | Ga0070709_101287962 | 200 |
| 49 | 3300005445 | Ga0070708_100046585 | Ga0070708_1000465853 | 200 |
| 50 | 3300005467 | Ga0070706_100000778 | Ga0070706_10000077827 | 200 |
| 51 | 3300005471 | Ga0070698_100000050 | Ga0070698_10000005054 | 200 |
| 52 | 3300005518 | Ga0070699_100006451 | Ga0070699_1000064513 | 200 |
| 53 | 3300005536 | Ga0070697_100009185 | Ga0070697_1000091856 | 200 |
| 54 | 3300005536 | Ga0070697_100021110 | Ga0070697_1000211103 | 200 |
| 55 | 3300005536 | Ga0070697_100034934 | Ga0070697_1000349343 | 200 |
| 56 | 3300005545 | Ga0070695_100016326 | Ga0070695_1000163264 | 200 |
| 57 | 3300005578 | Ga0068854_100364061 | Ga0068854_1003640611 | 200 |
| 58 | 3300005614 | Ga0068856_100252210 | Ga0068856_1002522101 | 200 |
| 59 | 3300006847 | Ga0075431_100386219 | Ga0075431_1003862192 | 200 |
| 60 | 3300006871 | Ga0075434_100213755 | Ga0075434_1002137553 | 200 |
| 61 | 3300007265 | Ga0099794_10039578 | Ga0099794_100395782 | 200 |
| 62 | 3300009093 | Ga0105240_10257729 | Ga0105240_102577292 | 200 |
| 63 | 3300009147 | Ga0114129_10073810 | Ga0114129_100738104 | 200 |
| 64 | 3300009177 | Ga0105248_10623469 | Ga0105248_106234691 | 200 |
| 65 | 3300009545 | Ga0105237_10671258 | Ga0105237_106712581 | 200 |
| 66 | 3300009551 | Ga0105238_10190162 | Ga0105238_101901622 | 200 |
| 67 | 3300013102 | Ga0157371_10378945 | Ga0157371_103789452 | 200 |
| 68 | 3300013105 | Ga0157369_11049264 | Ga0157369_110492641 | 200 |
| 69 | 3300013306 | Ga0163162_10819340 | Ga0163162_108193401 | 200 |
| 70 | 3300025910 | Ga0207684_10000641 | Ga0207684_1000064128 | 200 |
| 71 | 3300025910 | Ga0207684_10046123 | Ga0207684_100461231 | 200 |
| 72 | 3300025919 | Ga0207657_10451280 | Ga0207657_104512802 | 200 |
| 73 | 3300025922 | Ga0207646_10000463 | Ga0207646_1000046344 | 200 |
| 74 | 3300025924 | Ga0207694_10283141 | Ga0207694_102831412 | 200 |
| 75 | 3300025939 | Ga0207665_10053032 | Ga0207665_100530322 | 200 |
| 76 | 3300025945 | Ga0207679_10275829 | Ga0207679_102758292 | 200 |
| 77 | 3300025981 | Ga0207640_10220412 | Ga0207640_102204121 | 200 |
| 78 | 3300026078 | Ga0207702_10927235 | Ga0207702_109272352 | 200 |
| 79 | 3300036401 | Ga0373937_0076215 | Ga0373937_0076215_980_1600 | 200 |
| 80 | 3300037853 | Ga0436364_1472495 | Ga0436364_1472495_215_820 | 200 |
| 81 | 3300039437 | Ga0436365_1728496 | Ga0436365_1728496_689_1300 | 200 |
| 82 | 3300039450 | Ga0436363_0198889 | Ga0436363_0198889_83_688 | 200 |
| 83 | 3300039450 | Ga0436363_0674534 | Ga0436363_0674534_638_1249 | 200 |
| 84 | 3300039450 | Ga0436363_1048316 | Ga0436363_1048316_282_887 | 200 |
| 85 | 3300039453 | Ga0436362_1044768 | Ga0436362_1044768_144_755 | 200 |
| 86 | 3300046559 | Ga0495667_0606743 | Ga0495667_0606743_31_651 | 200 |
| 87 | 3300050507 | nmdc:mga05p37_500144_c1 | nmdc:mga05p37_500144_c1_454_1059 | 200 |
| 88 | 3300050512 | nmdc:mga0n895_237423_c1 | nmdc:mga0n895_237423_c1_20_625 | 200 |
| 89 | 3300059492 | Ga0587073_0022189 | Ga0587073_0022189_233_838 | 200 |
| 90 | 3300005467 | Ga0070706_100008334 | Ga0070706_1000083348 | 201 |
| 91 | 3300005536 | Ga0070697_100007692 | Ga0070697_10000769210 | 201 |
| 92 | 3300031090 | Ga0265760_10000064 | Ga0265760_1000006412 | 201 |
| 93 | 3300033547 | Ga0316212_1000363 | Ga0316212_10003635 | 201 |
| 94 | 3300027671 | Ga0209588_1005290 | Ga0209588_10052904 | 202 |
| 95 | 3300005434 | Ga0070709_10186576 | Ga0070709_101865762 | 203 |
| 96 | 3300005439 | Ga0070711_100033820 | Ga0070711_1000338202 | 203 |
| 97 | 3300005445 | Ga0070708_100262715 | Ga0070708_1002627152 | 203 |
| 98 | 3300005457 | Ga0070662_100741816 | Ga0070662_1007418161 | 203 |
| 99 | 3300005468 | Ga0070707_100133644 | Ga0070707_1001336442 | 203 |
| 100 | 3300005471 | Ga0070698_100009121 | Ga0070698_1000091213 | 203 |
| 101 | 3300005843 | Ga0068860_100521382 | Ga0068860_1005213821 | 203 |
| 102 | 3300006163 | Ga0070715_10389638 | Ga0070715_103896381 | 203 |
| 103 | 3300006175 | Ga0070712_100072787 | Ga0070712_1000727872 | 203 |
| 104 | 3300007788 | Ga0099795_10003415 | Ga0099795_100034152 | 203 |
| 105 | 3300009545 | Ga0105237_10748476 | Ga0105237_107484761 | 203 |
| 106 | 3300013297 | Ga0157378_10037436 | Ga0157378_100374365 | 203 |
| 107 | 3300014968 | Ga0157379_10037065 | Ga0157379_100370653 | 203 |
| 108 | 3300025898 | Ga0207692_10315328 | Ga0207692_103153282 | 203 |
| 109 | 3300025910 | Ga0207684_10095800 | Ga0207684_100958002 | 203 |
| 110 | 3300025914 | Ga0207671_10485759 | Ga0207671_104857591 | 203 |
| 111 | 3300025915 | Ga0207693_10027577 | Ga0207693_100275773 | 203 |
| 112 | 3300025915 | Ga0207693_10071784 | Ga0207693_100717842 | 203 |
| 113 | 3300025915 | Ga0207693_10094140 | Ga0207693_100941401 | 203 |
| 114 | 3300025916 | Ga0207663_10091330 | Ga0207663_100913302 | 203 |
| 115 | 3300025922 | Ga0207646_10882198 | Ga0207646_108821982 | 203 |
| 116 | 3300026088 | Ga0207641_10010943 | Ga0207641_100109437 | 203 |
| 117 | 3300027671 | Ga0209588_1012569 | Ga0209588_10125692 | 203 |
| 118 | 3300028381 | Ga0268264_10662382 | Ga0268264_106623822 | 203 |
| 119 | 3300031090 | Ga0265760_10005396 | Ga0265760_100053962 | 203 |
| 120 | 3300031090 | Ga0265760_10080391 | Ga0265760_100803912 | 203 |
| 121 | 3300035083 | Ga0373926_0041064 | Ga0373926_0041064_949_1572 | 203 |
| 122 | 3300035172 | Ga0373955_0230936 | Ga0373955_0230936_66_689 | 203 |
| 123 | 3300035692 | Ga0373935_0019210 | Ga0373935_0019210_2315_2938 | 203 |
| 124 | 3300035695 | Ga0373927_0021233 | Ga0373927_0021233_1475_2098 | 203 |
| 125 | 3300036401 | Ga0373937_0001750 | Ga0373937_0001750_1278_1901 | 203 |
| 126 | 3300044673 | Ga0453683_0026951 | Ga0453683_0026951_354_977 | 203 |
| 127 | 3300044712 | Ga0453684_0139676 | Ga0453684_0139676_30_653 | 203 |
| 128 | 3300045051 | Ga0451576_0049659 | Ga0451576_0049659_3617_4231 | 203 |
| 129 | 3300046462 | Ga0495651_0000130 | Ga0495651_0000130_2546_3169 | 203 |
| 130 | 3300046463 | Ga0495653_0018468 | Ga0495653_0018468_3210_3833 | 203 |
| 131 | 3300046477 | Ga0495664_0116041 | Ga0495664_0116041_448_1071 | 203 |
| 132 | 3300046511 | Ga0495608_0005318 | Ga0495608_0005318_1968_2591 | 203 |
| 133 | 3300046516 | Ga0495628_0010430 | Ga0495628_0010430_5185_5808 | 203 |
| 134 | 3300046517 | Ga0495630_0021752 | Ga0495630_0021752_2064_2687 | 203 |
| 135 | 3300046526 | Ga0495666_0103682 | Ga0495666_0103682_584_1207 | 203 |
| 136 | 3300046529 | Ga0495652_0073605 | Ga0495652_0073605_17_640 | 203 |
| 137 | 3300046531 | Ga0495665_0005669 | Ga0495665_0005669_3034_3657 | 203 |
| 138 | 3300046535 | Ga0495586_0004147 | Ga0495586_0004147_1346_1969 | 203 |
| 139 | 3300046535 | Ga0495586_0081927 | Ga0495586_0081927_661_1284 | 203 |
| 140 | 3300046536 | Ga0495587_0315780 | Ga0495587_0315780_80_703 | 203 |
| 141 | 3300046543 | Ga0495645_0104994 | Ga0495645_0104994_985_1608 | 203 |
| 142 | 3300046559 | Ga0495667_0134719 | Ga0495667_0134719_373_996 | 203 |
| 143 | 3300046642 | Ga0495634_0106973 | Ga0495634_0106973_560_1183 | 203 |
| 144 | 3300046663 | Ga0495635_0167327 | Ga0495635_0167327_229_852 | 203 |
| 145 | 3300046675 | Ga0495657_0041244 | Ga0495657_0041244_553_1176 | 203 |
| 146 | 3300046679 | Ga0495623_0013626 | Ga0495623_0013626_1582_2205 | 203 |
| 147 | 3300046680 | Ga0495646_0003673 | Ga0495646_0003673_1676_2299 | 203 |
| 148 | 3300046689 | Ga0495613_0118977 | Ga0495613_0118977_85_708 | 203 |
| 149 | 3300046690 | Ga0495624_0346242 | Ga0495624_0346242_238_861 | 203 |
| 150 | 3300047317 | Ga0495604_0105254 | Ga0495604_0105254_425_1048 | 203 |
| 151 | 3300047319 | Ga0495674_0035884 | Ga0495674_0035884_2903_3526 | 203 |
| 152 | 3300047319 | Ga0495674_0069068 | Ga0495674_0069068_1021_1644 | 203 |
| 153 | 3300047322 | Ga0495680_0000182 | Ga0495680_0000182_54826_55449 | 203 |
| 154 | 3300047444 | Ga0495675_0049065 | Ga0495675_0049065_838_1461 | 203 |
| 155 | 3300047444 | Ga0495675_0055630 | Ga0495675_0055630_832_1455 | 203 |
| 156 | 3300047471 | Ga0495684_0008870 | Ga0495684_0008870_1450_2073 | 203 |
| 157 | 3300047471 | Ga0495684_0462666 | Ga0495684_0462666_84_707 | 203 |
| 158 | 3300047673 | Ga0495593_0118187 | Ga0495593_0118187_452_1075 | 203 |
| 159 | 3300048088 | Ga0495602_0019623 | Ga0495602_0019623_944_1567 | 203 |
| 160 | 3300048089 | Ga0495614_0039375 | Ga0495614_0039375_319_942 | 203 |
| 161 | 3300053078 | Ga0495612_0065310 | Ga0495612_0065310_528_1151 | 203 |
| 162 | 3300005459 | Ga0068867_100538797 | Ga0068867_1005387971 | 204 |
| 163 | 3300005844 | Ga0068862_100214683 | Ga0068862_1002146832 | 204 |
| 164 | 3300009148 | Ga0105243_10011346 | Ga0105243_100113463 | 204 |
| 165 | 3300025935 | Ga0207709_10474388 | Ga0207709_104743881 | 204 |
| 166 | 3300046559 | Ga0495667_0056772 | Ga0495667_0056772_1620_2246 | 204 |
| 167 | 3300046675 | Ga0495657_0011058 | Ga0495657_0011058_5960_6586 | 204 |
| 168 | 3300046689 | Ga0495613_0256301 | Ga0495613_0256301_33_659 | 204 |
| 169 | 3300046809 | Ga0495600_0292679 | Ga0495600_0292679_109_735 | 204 |
| 170 | 3300047471 | Ga0495684_0008696 | Ga0495684_0008696_1470_2096 | 204 |
| 171 | 3300006028 | Ga0070717_10008778 | Ga0070717_100087788 | 205 |
| 172 | 3300014968 | Ga0157379_10019615 | Ga0157379_100196156 | 205 |
| 173 | 3300025961 | Ga0207712_10094527 | Ga0207712_100945271 | 205 |
| 174 | 3300026118 | Ga0207675_100744432 | Ga0207675_1007444322 | 205 |
| 175 | 3300027695 | Ga0209966_1003309 | Ga0209966_10033093 | 205 |
| 176 | 3300028381 | Ga0268264_10045206 | Ga0268264_100452063 | 205 |
| 177 | 3300041408 | Ga0439453_0007186 | Ga0439453_0007186_277_900 | 205 |
| 178 | 3300042001 | Ga0439441_016622 | Ga0439441_016622_518_1141 | 205 |
| 179 | 3300042461 | Ga0439460_0038463 | Ga0439460_0038463_551_1174 | 205 |
| 180 | 3300044673 | Ga0453683_0282301 | Ga0453683_0282301_266_898 | 205 |
| 181 | 3300046648 | Ga0495611_0194045 | Ga0495611_0194045_257_889 | 205 |
| 182 | 3300050508 | nmdc:mga09592_157646_c1 | nmdc:mga09592_157646_c1_689_1312 | 205 |
| 183 | 3300050509 | nmdc:mga0qj67_330922_c1 | nmdc:mga0qj67_330922_c1_507_1130 | 205 |
| 184 | 3300050510 | nmdc:mga06r32_354887_c1 | nmdc:mga06r32_354887_c1_628_1251 | 205 |
| 185 | 3300005535 | Ga0070684_100343044 | Ga0070684_1003430443 | 206 |
| 186 | 3300005539 | Ga0068853_100014092 | Ga0068853_1000140924 | 206 |
| 187 | 3300005563 | Ga0068855_100004243 | Ga0068855_1000042434 | 206 |
| 188 | 3300005614 | Ga0068856_100033182 | Ga0068856_1000331825 | 206 |
| 189 | 3300005616 | Ga0068852_100002154 | Ga0068852_10000215410 | 206 |
| 190 | 3300009551 | Ga0105238_10012838 | Ga0105238_100128384 | 206 |
| 191 | 3300010375 | Ga0105239_10050642 | Ga0105239_100506422 | 206 |
| 192 | 3300013307 | Ga0157372_10209228 | Ga0157372_102092281 | 206 |
| 193 | 3300025911 | Ga0207654_10002450 | Ga0207654_100024505 | 206 |
| 194 | 3300025913 | Ga0207695_10004894 | Ga0207695_100048944 | 206 |
| 195 | 3300025914 | Ga0207671_10003729 | Ga0207671_100037299 | 206 |
| 196 | 3300025920 | Ga0207649_10297582 | Ga0207649_102975823 | 206 |
| 197 | 3300025924 | Ga0207694_10000084 | Ga0207694_1000008448 | 206 |
| 198 | 3300025949 | Ga0207667_10012696 | Ga0207667_100126965 | 206 |
| 199 | 3300026041 | Ga0207639_10018936 | Ga0207639_100189364 | 206 |
| 200 | 3300026078 | Ga0207702_10136028 | Ga0207702_101360284 | 206 |
| 201 | 3300026142 | Ga0207698_10003724 | Ga0207698_100037245 | 206 |
| 202 | 3300048924 | Ga0496121_0143639 | Ga0496121_0143639_479_1102 | 206 |
| 203 | 3300005347 | Ga0070668_100569890 | Ga0070668_1005698901 | 207 |
| 204 | 3300005353 | Ga0070669_100034202 | Ga0070669_1000342021 | 207 |
| 205 | 3300005356 | Ga0070674_100006437 | Ga0070674_1000064371 | 207 |
| 206 | 3300005364 | Ga0070673_100561968 | Ga0070673_1005619681 | 207 |
| 207 | 3300005367 | Ga0070667_100127736 | Ga0070667_1001277362 | 207 |
| 208 | 3300005459 | Ga0068867_100005169 | Ga0068867_1000051694 | 207 |
| 209 | 3300005539 | Ga0068853_100353506 | Ga0068853_1003535063 | 207 |
| 210 | 3300005543 | Ga0070672_100015108 | Ga0070672_1000151083 | 207 |
| 211 | 3300005544 | Ga0070686_100149922 | Ga0070686_1001499222 | 207 |
| 212 | 3300005547 | Ga0070693_100358204 | Ga0070693_1003582041 | 207 |
| 213 | 3300005617 | Ga0068859_100046064 | Ga0068859_1000460644 | 207 |
| 214 | 3300005718 | Ga0068866_10181237 | Ga0068866_101812371 | 207 |
| 215 | 3300005719 | Ga0068861_100002116 | Ga0068861_10000211615 | 207 |
| 216 | 3300005843 | Ga0068860_100004405 | Ga0068860_10000440516 | 207 |
| 217 | 3300005844 | Ga0068862_100006922 | Ga0068862_1000069226 | 207 |
| 218 | 3300006881 | Ga0068865_100004435 | Ga0068865_1000044356 | 207 |
| 219 | 3300006931 | Ga0097620_100046064 | Ga0097620_1000460644 | 207 |
| 220 | 3300017792 | Ga0163161_10144938 | Ga0163161_101449383 | 207 |
| 221 | 3300025923 | Ga0207681_10026678 | Ga0207681_100266786 | 207 |
| 222 | 3300025937 | Ga0207669_10058318 | Ga0207669_100583181 | 207 |
| 223 | 3300025938 | Ga0207704_10033838 | Ga0207704_100338383 | 207 |
| 224 | 3300025940 | Ga0207691_10025827 | Ga0207691_100258278 | 207 |
| 225 | 3300025942 | Ga0207689_10147110 | Ga0207689_101471103 | 207 |
| 226 | 3300025960 | Ga0207651_10603009 | Ga0207651_106030091 | 207 |
| 227 | 3300025972 | Ga0207668_10409004 | Ga0207668_104090041 | 207 |
| 228 | 3300026041 | Ga0207639_10144536 | Ga0207639_101445361 | 207 |
| 229 | 3300026089 | Ga0207648_10001254 | Ga0207648_1000125424 | 207 |
| 230 | 3300026118 | Ga0207675_100000368 | Ga0207675_10000036813 | 207 |
| 231 | 3300028380 | Ga0268265_10003321 | Ga0268265_1000332112 | 207 |
| 232 | 3300028381 | Ga0268264_10000850 | Ga0268264_1000085016 | 207 |
| 233 | 3300030760 | Ga0265762_1016650 | Ga0265762_10166502 | 207 |
| 234 | 3300035692 | Ga0373935_0821005 | Ga0373935_0821005_42_674 | 207 |
| 235 | 3300046535 | Ga0495586_0026447 | Ga0495586_0026447_1788_2420 | 207 |
| 236 | 3300046794 | Ga0495589_0106097 | Ga0495589_0106097_239_868 | 207 |
| 237 | 3300013297 | Ga0157378_10050729 | Ga0157378_100507294 | 208 |
| 238 | 3300013306 | Ga0163162_10018672 | Ga0163162_100186726 | 208 |
| 239 | 3300014326 | Ga0157380_10016528 | Ga0157380_100165285 | 208 |
| 240 | 3300031730 | Ga0307516_10000897 | Ga0307516_1000089730 | 208 |
| 241 | 3300035083 | Ga0373926_0056558 | Ga0373926_0056558_402_1088 | 208 |
| 242 | 3300035089 | Ga0373944_0006159 | Ga0373944_0006159_840_1526 | 208 |
| 243 | 3300035695 | Ga0373927_0040445 | Ga0373927_0040445_1285_1971 | 208 |
| 244 | 3300037068 | Ga0373925_0001392 | Ga0373925_0001392_1834_2520 | 208 |
| 245 | 3300046681 | Ga0495647_0022834 | Ga0495647_0022834_487_1173 | 208 |
| 246 | 3300047318 | Ga0495636_0014146 | Ga0495636_0014146_2327_3013 | 208 |
| 247 | 3300053148 | Ga0500590_055874 | Ga0500590_055874_173_817 | 208 |
| 248 | 3300002705 | JGI25156J39149_1006583 | JGI25156J39149_10065833 | 209 |
| 249 | 3300005614 | Ga0068856_100019805 | Ga0068856_1000198052 | 209 |
| 250 | 3300025256 | Ga0209759_1000660 | Ga0209759_100066016 | 209 |
| 251 | 3300026078 | Ga0207702_10390198 | Ga0207702_103901982 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gl3-assembly1.cif.gz_A | crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum | 0.8645 | 29 | 161 |
| 4nmu-assembly2.cif.gz_B | crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' | 0.851 | 29 | 159 |
| 1lu4-assembly1.cif.gz_A | 1.1 angstrom resolution crystal structure of a secreted mycobacterium tuberculosis disulfide oxidoreductase homologous to e. coli dsbe: implications for functions | 0.8462 | 39 | 156 |
| 2ywi-assembly2.cif.gz_B | crystal structure of uncharacterized conserved protein from geobacillus kaustophilus | 0.8457 | 31 | 208 |
| 2b1k-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8414 | 28 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71990_1_182_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8421 | 31 | 205 | 3.40.30.10 |
| 2b1kA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8415 | 28 | 161 | 3.40.30.10 |
| 3hdcA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8402 | 39 | 161 | 3.40.30.10 |
| 2ywoA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8387 | 28 | 208 | 3.40.30.10 |
| 1st9A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8225 | 33 | 177 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3R9YUX2-F1-model_v4 | Redoxin domain-containing protein | 0.9831 | 23 | 209 |
GO:0016209
GO:0016491 |
| AF-A0A4V1SBC6-F1-model_v4 | Redoxin domain-containing protein | 0.9811 | 31 | 207 |
GO:0016209
GO:0016491 |
| AF-A0A1G2WN12-F1-model_v4 | deleted | 0.9785 | 42 | 207 |
|
| AF-A0A7V9ETZ2-F1-model_v4 | Thioredoxin family protein | 0.9783 | 41 | 209 |
GO:0016209
GO:0016491 |
| AF-A0A246IY80-F1-model_v4 | Thioredoxin family protein | 0.9777 | 22 | 209 |
GO:0016209
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar