F362570

General Info

Members Datasets Scaffolds Average Seq Length
251 172 251 205

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0528327|Ga0395898_0528327_309_923
Length 194
Sequence MRRVSVPGLLILLLATTCAAWAARVGEAAPEFTGTDSHGQTHRLSDYRGKYVVLEWTNNGCPYTLKHYDSGNMQALQKEWTAKGVVWLTILSSHPGAQGYMTAAQENAYMTRVHAAPTAAILDPSGAIGHLYDAKTTKLIYAGAIDNKATTDTADVKDANNYVSAALKEALAGQAVAVSYTRPYGCSVKYRGAD

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
119 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 1.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 0
Rhizosphere 95.22
Stem 0
Stem Tuber 0
Unclassified 4.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1006583 3300002705 Bacteria 3150
2 Ga0070666_10641203 3300005335 Bacteria 777
3 Ga0070660_100541524 3300005339 Unclassified 971
4 Ga0070668_100569890 3300005347 Bacteria 987
5 Ga0070669_100034202 3300005353 Bacteria 3680
6 Ga0070674_100006437 3300005356 Bacteria 6854
7 Ga0070673_100561968 3300005364 Bacteria 1037
8 Ga0070659_100040486 3300005366 Unclassified 3642
9 Ga0070667_100127736 3300005367 Bacteria 2217
10 Ga0070709_10128796 3300005434 Unclassified 1725
11 Ga0070709_10186576 3300005434 Bacteria 1460
12 Ga0070714_100181383 3300005435 Bacteria 1916
13 Ga0070714_100315592 3300005435 Bacteria 1460
14 Ga0070713_100074553 3300005436 Bacteria 2875
15 Ga0070713_100123410 3300005436 Bacteria 2275
16 Ga0070711_100033820 3300005439 Bacteria 3406
17 Ga0070708_100009427 3300005445 Bacteria 7872
18 Ga0070708_100044065 3300005445 Bacteria 3922
19 Ga0070708_100046585 3300005445 Bacteria 3826
20 Ga0070708_100262715 3300005445 Bacteria 1623
21 Ga0070662_100741816 3300005457 Bacteria 832
22 Ga0068867_100005169 3300005459 Bacteria 9209
23 Ga0068867_100538797 3300005459 Bacteria 1009
24 Ga0070706_100000778 3300005467 Bacteria 35677
25 Ga0070706_100008334 3300005467 Bacteria 9659
26 Ga0070706_100015145 3300005467 Bacteria 7120
27 Ga0070707_100007071 3300005468 Bacteria 10408
28 Ga0070707_100133644 3300005468 Bacteria 2413
29 Ga0070698_100000050 3300005471 Bacteria 83255
30 Ga0070698_100009121 3300005471 Bacteria 10651
31 Ga0070699_100006451 3300005518 Bacteria 10218
32 Ga0070684_100343044 3300005535 Bacteria 1373
33 Ga0070697_100007692 3300005536 Bacteria 8392
34 Ga0070697_100009185 3300005536 Bacteria 7724
35 Ga0070697_100021110 3300005536 Bacteria 5157
36 Ga0070697_100034934 3300005536 Bacteria 4055
37 Ga0070697_100085577 3300005536 Bacteria 2601
38 Ga0070697_100260214 3300005536 Bacteria 1485
39 Ga0068853_100014092 3300005539 Bacteria 6545
40 Ga0068853_100353506 3300005539 Bacteria 1367
41 Ga0070672_100015108 3300005543 Bacteria 5488
42 Ga0070686_100149922 3300005544 Bacteria 1632
43 Ga0070695_100016326 3300005545 Bacteria 4493
44 Ga0070693_100358204 3300005547 Bacteria 1000
45 Ga0068855_100004243 3300005563 Bacteria 17503
46 Ga0068855_100390975 3300005563 Bacteria 1525
47 Ga0068854_100364061 3300005578 Unclassified 1187
48 Ga0068856_100019805 3300005614 Bacteria 6532
49 Ga0068856_100033182 3300005614 Bacteria 5055
50 Ga0068856_100252210 3300005614 Bacteria 1780
51 Ga0068856_100825083 3300005614 Unclassified 947
52 Ga0068852_100002154 3300005616 Bacteria 13525
53 Ga0068859_100046064 3300005617 Bacteria 4381
54 Ga0068866_10181237 3300005718 Bacteria 1244
55 Ga0068861_100002116 3300005719 Bacteria 12848
56 Ga0068860_100004405 3300005843 Bacteria 14389
57 Ga0068860_100521382 3300005843 Bacteria 1188
58 Ga0068862_100006922 3300005844 Bacteria 9404
59 Ga0068862_100214683 3300005844 Bacteria 1740
60 Ga0070717_10008778 3300006028 Bacteria 7567
61 Ga0070715_10389638 3300006163 Unclassified 771
62 Ga0070716_100012297 3300006173 Bacteria 4335
63 Ga0070712_100072787 3300006175 Bacteria 2463
64 Ga0075430_100005048 3300006846 Bacteria 11109
65 Ga0075431_100147316 3300006847 Bacteria 2425
66 Ga0075431_100386219 3300006847 Bacteria 1403
67 Ga0075431_101057537 3300006847 Unclassified 777
68 Ga0075434_100213755 3300006871 Unclassified 1948
69 Ga0068865_100004435 3300006881 Bacteria 8461
70 Ga0075436_100008414 3300006914 Bacteria 7055
71 Ga0097620_100046064 3300006931 Bacteria 4381
72 Ga0099794_10039578 3300007265 Unclassified 2238
73 Ga0099794_10070955 3300007265 Bacteria 1706
74 Ga0099795_10003415 3300007788 Bacteria 3927
75 Ga0105240_10047303 3300009093 Bacteria 5444
76 Ga0105240_10257729 3300009093 Bacteria 2014
77 Ga0114129_10073810 3300009147 Bacteria 4752
78 Ga0105243_10011346 3300009148 Bacteria 6744
79 Ga0105241_10027131 3300009174 Bacteria 4263
80 Ga0105248_10623469 3300009177 Bacteria 1217
81 Ga0105237_10057416 3300009545 Bacteria 3896
82 Ga0105237_10671258 3300009545 Bacteria 1043
83 Ga0105237_10748476 3300009545 Bacteria 984
84 Ga0105238_10012838 3300009551 Bacteria 8451
85 Ga0105238_10190162 3300009551 Unclassified 2029
86 Ga0105239_10050642 3300010375 Bacteria 4554
87 Ga0157371_10378945 3300013102 Unclassified 1033
88 Ga0157369_10165069 3300013105 Bacteria 2336
89 Ga0157369_10656540 3300013105 Unclassified 1081
90 Ga0157369_11049264 3300013105 Unclassified 834
91 Ga0157378_10037436 3300013297 Bacteria 4296
92 Ga0157378_10050729 3300013297 Bacteria 3692
93 Ga0163162_10018672 3300013306 Bacteria 6794
94 Ga0163162_10819340 3300013306 Bacteria 1047
95 Ga0157372_10209228 3300013307 Bacteria 2260
96 Ga0157380_10016528 3300014326 Bacteria 5443
97 Ga0157379_10019615 3300014968 Bacteria 5972
98 Ga0157379_10037065 3300014968 Bacteria 4348
99 Ga0163161_10144938 3300017792 Bacteria 1801
100 Ga0209759_1000660 3300025256 Bacteria 31995
101 Ga0207692_10315328 3300025898 Bacteria 955
102 Ga0207684_10000641 3300025910 Bacteria 41415
103 Ga0207684_10013370 3300025910 Bacteria 7100
104 Ga0207684_10046123 3300025910 Bacteria 3697
105 Ga0207684_10095800 3300025910 Bacteria 2533
106 Ga0207654_10002450 3300025911 Bacteria 9462
107 Ga0207695_10004894 3300025913 Bacteria 18050
108 Ga0207671_10003729 3300025914 Bacteria 15013
109 Ga0207671_10485759 3300025914 Bacteria 984
110 Ga0207693_10027577 3300025915 Bacteria 4489
111 Ga0207693_10071784 3300025915 Bacteria 2710
112 Ga0207693_10094140 3300025915 Unclassified 2348
113 Ga0207663_10091330 3300025916 Bacteria 2021
114 Ga0207657_10451280 3300025919 Unclassified 1009
115 Ga0207649_10297582 3300025920 Unclassified 1179
116 Ga0207646_10000463 3300025922 Bacteria 54224
117 Ga0207646_10005182 3300025922 Bacteria 13782
118 Ga0207646_10882198 3300025922 Bacteria 794
119 Ga0207681_10026678 3300025923 Bacteria 3729
120 Ga0207694_10000084 3300025924 Bacteria 108906
121 Ga0207694_10283141 3300025924 Unclassified 1362
122 Ga0207700_10059585 3300025928 Bacteria 2888
123 Ga0207664_10611185 3300025929 Unclassified 979
124 Ga0207709_10474388 3300025935 Bacteria 972
125 Ga0207669_10058318 3300025937 Bacteria 2355
126 Ga0207704_10033838 3300025938 Bacteria 2910
127 Ga0207665_10053032 3300025939 Bacteria 2733
128 Ga0207665_10076484 3300025939 Archaea 2295
129 Ga0207691_10025827 3300025940 Bacteria 5512
130 Ga0207689_10147110 3300025942 Bacteria 1941
131 Ga0207679_10275829 3300025945 Unclassified 1440
132 Ga0207667_10012696 3300025949 Bacteria 9681
133 Ga0207667_10336064 3300025949 Bacteria 1542
134 Ga0207651_10603009 3300025960 Bacteria 960
135 Ga0207712_10094527 3300025961 Bacteria 2208
136 Ga0207668_10409004 3300025972 Bacteria 1149
137 Ga0207640_10220412 3300025981 Bacteria 1452
138 Ga0207639_10018936 3300026041 Bacteria 4901
139 Ga0207639_10144536 3300026041 Bacteria 1985
140 Ga0207702_10072161 3300026078 Bacteria 2975
141 Ga0207702_10136028 3300026078 Bacteria 2217
142 Ga0207702_10390198 3300026078 Bacteria 1340
143 Ga0207702_10927235 3300026078 Bacteria 863
144 Ga0207641_10010943 3300026088 Bacteria 7434
145 Ga0207648_10001254 3300026089 Bacteria 28374
146 Ga0207675_100000368 3300026118 Bacteria 43073
147 Ga0207675_100744432 3300026118 Bacteria 991
148 Ga0207698_10003724 3300026142 Bacteria 9222
149 Ga0209588_1005290 3300027671 Bacteria 3690
150 Ga0209588_1012569 3300027671 Unclassified 2571
151 Ga0209966_1003309 3300027695 Bacteria 2709
152 Ga0268265_10003321 3300028380 Bacteria 11641
153 Ga0268264_10000501 3300028381 Bacteria 50746
154 Ga0268264_10000850 3300028381 Bacteria 32562
155 Ga0268264_10045206 3300028381 Bacteria 3656
156 Ga0268264_10662382 3300028381 Bacteria 1034
157 Ga0265762_1016650 3300030760 Bacteria 1336
158 Ga0265760_10000064 3300031090 Bacteria 28923
159 Ga0265760_10005396 3300031090 Unclassified 3669
160 Ga0265760_10080391 3300031090 Bacteria 1009
161 Ga0307516_10000897 3300031730 Bacteria 40914
162 Ga0316212_1000363 3300033547 Bacteria 5373
163 Ga0373926_0041064 3300035083 Unclassified 1652
164 Ga0373926_0056558 3300035083 Bacteria 1424
165 Ga0373944_0006159 3300035089 Bacteria 3180
166 Ga0373955_0230936 3300035172 Unclassified 1107
167 Ga0373935_0019210 3300035692 Unclassified 4168
168 Ga0373935_0821005 3300035692 Bacteria 687
169 Ga0373927_0021233 3300035695 Bacteria 4254
170 Ga0373927_0040445 3300035695 Bacteria 3024
171 Ga0373937_0001750 3300036401 Bacteria 18268
172 Ga0373937_0076215 3300036401 Unclassified 3097
173 Ga0373925_0001392 3300037068 Bacteria 21050
174 Ga0395898_0315221 3300037466 Bacteria 1492
175 Ga0395898_0528327 3300037466 Unclassified 1121
176 Ga0436364_1472495 3300037853 Unclassified 892
177 Ga0436365_1126385 3300039437 Bacteria 2752
178 Ga0436365_1728496 3300039437 Bacteria 3066
179 Ga0436363_0198889 3300039450 Unclassified 1105
180 Ga0436363_0674534 3300039450 Bacteria 2031
181 Ga0436363_1048316 3300039450 Bacteria 1277
182 Ga0436362_1044768 3300039453 Unclassified 2245
183 Ga0439453_0007186 3300041408 Bacteria 1758
184 Ga0439441_016622 3300042001 Bacteria 1314
185 Ga0439460_0038463 3300042461 Bacteria 1395
186 Ga0453683_0026951 3300044673 Unclassified 3648
187 Ga0453683_0282301 3300044673 Bacteria 1061
188 Ga0466963_0349122 3300044694 Bacteria 1042
189 Ga0453684_0139676 3300044712 Unclassified 2895
190 Ga0466959_0269425 3300045049 Bacteria 1171
191 Ga0451576_0049659 3300045051 Bacteria 4403
192 Ga0466958_0386242 3300045836 Bacteria 903
193 Ga0495651_0000130 3300046462 Bacteria 56014
194 Ga0495653_0018468 3300046463 Bacteria 5661
195 Ga0495664_0116041 3300046477 Bacteria 1618
196 Ga0495608_0005318 3300046511 Bacteria 9199
197 Ga0495628_0010430 3300046516 Bacteria 7894
198 Ga0495630_0021752 3300046517 Unclassified 4737
199 Ga0495666_0103682 3300046526 Unclassified 1339
200 Ga0495652_0073605 3300046529 Bacteria 2844
201 Ga0495665_0005669 3300046531 Bacteria 6738
202 Ga0495586_0004147 3300046535 Bacteria 7767
203 Ga0495586_0026447 3300046535 Bacteria 3105
204 Ga0495586_0081927 3300046535 Bacteria 1774
205 Ga0495587_0315780 3300046536 Unclassified 873
206 Ga0495645_0104994 3300046543 Bacteria 2005
207 Ga0495667_0056772 3300046559 Unclassified 2574
208 Ga0495667_0134719 3300046559 Bacteria 1593
209 Ga0495667_0606743 3300046559 Unclassified 682
210 Ga0495634_0106973 3300046642 Bacteria 1802
211 Ga0495611_0194045 3300046648 Unclassified 948
212 Ga0495635_0167327 3300046663 Unclassified 1495
213 Ga0495657_0011058 3300046675 Bacteria 6768
214 Ga0495657_0041244 3300046675 Bacteria 3160
215 Ga0495623_0013626 3300046679 Bacteria 5269
216 Ga0495646_0003673 3300046680 Bacteria 9577
217 Ga0495647_0022834 3300046681 Bacteria 2263
218 Ga0495613_0118977 3300046689 Unclassified 1898
219 Ga0495613_0256301 3300046689 Bacteria 1220
220 Ga0495624_0346242 3300046690 Unclassified 894
221 Ga0495589_0106097 3300046794 Bacteria 1357
222 Ga0495600_0292679 3300046809 Unclassified 1029
223 Ga0495604_0105254 3300047317 Bacteria 2065
224 Ga0495636_0014146 3300047318 Bacteria 3173
225 Ga0495674_0035884 3300047319 Bacteria 4469
226 Ga0495674_0069068 3300047319 Bacteria 3056
227 Ga0495680_0000182 3300047322 Bacteria 66757
228 Ga0495675_0049065 3300047444 Bacteria 2684
229 Ga0495675_0055630 3300047444 Unclassified 2510
230 Ga0495684_0008696 3300047471 Bacteria 7853
231 Ga0495684_0008870 3300047471 Bacteria 7769
232 Ga0495684_0462666 3300047471 Unclassified 879
233 Ga0495593_0118187 3300047673 Unclassified 1350
234 Ga0495602_0019623 3300048088 Bacteria 6706
235 Ga0495614_0039375 3300048089 Bacteria 2028
236 Ga0496121_0143639 3300048924 Bacteria 1767
237 Ga0501072_0004281 3300049588 Bacteria 10831
238 Ga0501074_0163040 3300049590 Bacteria 1592
239 nmdc:mga05p37_500144_c1 3300050507 Unclassified 1395
240 nmdc:mga09592_157646_c1 3300050508 Bacteria 1960
241 nmdc:mga0qj67_330922_c1 3300050509 Bacteria 1233
242 nmdc:mga0qj67_332899_c1 3300050509 Unclassified 1228
243 nmdc:mga06r32_354887_c1 3300050510 Bacteria 1451
244 nmdc:mga06r32_836585_c1 3300050510 Unclassified 879
245 nmdc:mga0n895_237423_c1 3300050512 Bacteria 1850
246 nmdc:mga08x19_1377_c1 3300050514 Bacteria 15040
247 nmdc:mga08x19_86576_c1 3300050514 Bacteria 2063
248 Ga0495612_0065310 3300053078 Unclassified 1511
249 Ga0500590_055874 3300053148 Bacteria 1996
250 Ga0501084_0040219 3300054114 Bacteria 3910
251 Ga0587073_0022189 3300059492 Bacteria 1230

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0269425 Ga0466959_0269425_347_928 179
2 3300045836 Ga0466958_0386242 Ga0466958_0386242_43_624 179
3 3300044694 Ga0466963_0349122 Ga0466963_0349122_221_823 187
4 3300005435 Ga0070714_100315592 Ga0070714_1003155922 189
5 3300005436 Ga0070713_100123410 Ga0070713_1001234102 189
6 3300005563 Ga0068855_100390975 Ga0068855_1003909752 189
7 3300005614 Ga0068856_100825083 Ga0068856_1008250832 189
8 3300013105 Ga0157369_10165069 Ga0157369_101650691 189
9 3300025949 Ga0207667_10336064 Ga0207667_103360642 189
10 3300026078 Ga0207702_10072161 Ga0207702_100721612 189
11 3300037466 Ga0395898_0315221 Ga0395898_0315221_90_704 189
12 3300039437 Ga0436365_1126385 Ga0436365_1126385_630_1202 189
13 3300005436 Ga0070713_100074553 Ga0070713_1000745532 190
14 3300025928 Ga0207700_10059585 Ga0207700_100595852 190
15 3300037466 Ga0395898_0528327 Ga0395898_0528327_309_923 190
16 3300049588 Ga0501072_0004281 Ga0501072_0004281_8374_9018 190
17 3300049590 Ga0501074_0163040 Ga0501074_0163040_151_795 190
18 3300054114 Ga0501084_0040219 Ga0501084_0040219_173_817 190
19 3300005445 Ga0070708_100009427 Ga0070708_1000094278 191
20 3300005467 Ga0070706_100015145 Ga0070706_1000151458 191
21 3300005468 Ga0070707_100007071 Ga0070707_10000707112 191
22 3300005536 Ga0070697_100260214 Ga0070697_1002602142 191
23 3300007265 Ga0099794_10070955 Ga0099794_100709552 191
24 3300025910 Ga0207684_10013370 Ga0207684_100133704 191
25 3300025922 Ga0207646_10005182 Ga0207646_100051822 191
26 3300009093 Ga0105240_10047303 Ga0105240_100473035 193
27 3300009174 Ga0105241_10027131 Ga0105241_100271312 193
28 3300009545 Ga0105237_10057416 Ga0105237_100574162 193
29 3300013105 Ga0157369_10656540 Ga0157369_106565402 193
30 3300006846 Ga0075430_100005048 Ga0075430_1000050483 196
31 3300006847 Ga0075431_100147316 Ga0075431_1001473163 196
32 3300006847 Ga0075431_101057537 Ga0075431_1010575372 196
33 3300050509 nmdc:mga0qj67_332899_c1 nmdc:mga0qj67_332899_c1_228_821 196
34 3300050510 nmdc:mga06r32_836585_c1 nmdc:mga06r32_836585_c1_33_626 196
35 3300005445 Ga0070708_100044065 Ga0070708_1000440652 198
36 3300005536 Ga0070697_100085577 Ga0070697_1000855773 198
37 3300006173 Ga0070716_100012297 Ga0070716_1000122976 198
38 3300025939 Ga0207665_10076484 Ga0207665_100764842 198
39 3300028381 Ga0268264_10000501 Ga0268264_1000050151 198
40 3300005435 Ga0070714_100181383 Ga0070714_1001813832 199
41 3300006914 Ga0075436_100008414 Ga0075436_1000084145 199
42 3300025929 Ga0207664_10611185 Ga0207664_106111851 199
43 3300050514 nmdc:mga08x19_1377_c1 nmdc:mga08x19_1377_c1_10701_11303 199
44 3300050514 nmdc:mga08x19_86576_c1 nmdc:mga08x19_86576_c1_1422_2024 199
45 3300005335 Ga0070666_10641203 Ga0070666_106412031 200
46 3300005339 Ga0070660_100541524 Ga0070660_1005415242 200
47 3300005366 Ga0070659_100040486 Ga0070659_1000404862 200
48 3300005434 Ga0070709_10128796 Ga0070709_101287962 200
49 3300005445 Ga0070708_100046585 Ga0070708_1000465853 200
50 3300005467 Ga0070706_100000778 Ga0070706_10000077827 200
51 3300005471 Ga0070698_100000050 Ga0070698_10000005054 200
52 3300005518 Ga0070699_100006451 Ga0070699_1000064513 200
53 3300005536 Ga0070697_100009185 Ga0070697_1000091856 200
54 3300005536 Ga0070697_100021110 Ga0070697_1000211103 200
55 3300005536 Ga0070697_100034934 Ga0070697_1000349343 200
56 3300005545 Ga0070695_100016326 Ga0070695_1000163264 200
57 3300005578 Ga0068854_100364061 Ga0068854_1003640611 200
58 3300005614 Ga0068856_100252210 Ga0068856_1002522101 200
59 3300006847 Ga0075431_100386219 Ga0075431_1003862192 200
60 3300006871 Ga0075434_100213755 Ga0075434_1002137553 200
61 3300007265 Ga0099794_10039578 Ga0099794_100395782 200
62 3300009093 Ga0105240_10257729 Ga0105240_102577292 200
63 3300009147 Ga0114129_10073810 Ga0114129_100738104 200
64 3300009177 Ga0105248_10623469 Ga0105248_106234691 200
65 3300009545 Ga0105237_10671258 Ga0105237_106712581 200
66 3300009551 Ga0105238_10190162 Ga0105238_101901622 200
67 3300013102 Ga0157371_10378945 Ga0157371_103789452 200
68 3300013105 Ga0157369_11049264 Ga0157369_110492641 200
69 3300013306 Ga0163162_10819340 Ga0163162_108193401 200
70 3300025910 Ga0207684_10000641 Ga0207684_1000064128 200
71 3300025910 Ga0207684_10046123 Ga0207684_100461231 200
72 3300025919 Ga0207657_10451280 Ga0207657_104512802 200
73 3300025922 Ga0207646_10000463 Ga0207646_1000046344 200
74 3300025924 Ga0207694_10283141 Ga0207694_102831412 200
75 3300025939 Ga0207665_10053032 Ga0207665_100530322 200
76 3300025945 Ga0207679_10275829 Ga0207679_102758292 200
77 3300025981 Ga0207640_10220412 Ga0207640_102204121 200
78 3300026078 Ga0207702_10927235 Ga0207702_109272352 200
79 3300036401 Ga0373937_0076215 Ga0373937_0076215_980_1600 200
80 3300037853 Ga0436364_1472495 Ga0436364_1472495_215_820 200
81 3300039437 Ga0436365_1728496 Ga0436365_1728496_689_1300 200
82 3300039450 Ga0436363_0198889 Ga0436363_0198889_83_688 200
83 3300039450 Ga0436363_0674534 Ga0436363_0674534_638_1249 200
84 3300039450 Ga0436363_1048316 Ga0436363_1048316_282_887 200
85 3300039453 Ga0436362_1044768 Ga0436362_1044768_144_755 200
86 3300046559 Ga0495667_0606743 Ga0495667_0606743_31_651 200
87 3300050507 nmdc:mga05p37_500144_c1 nmdc:mga05p37_500144_c1_454_1059 200
88 3300050512 nmdc:mga0n895_237423_c1 nmdc:mga0n895_237423_c1_20_625 200
89 3300059492 Ga0587073_0022189 Ga0587073_0022189_233_838 200
90 3300005467 Ga0070706_100008334 Ga0070706_1000083348 201
91 3300005536 Ga0070697_100007692 Ga0070697_10000769210 201
92 3300031090 Ga0265760_10000064 Ga0265760_1000006412 201
93 3300033547 Ga0316212_1000363 Ga0316212_10003635 201
94 3300027671 Ga0209588_1005290 Ga0209588_10052904 202
95 3300005434 Ga0070709_10186576 Ga0070709_101865762 203
96 3300005439 Ga0070711_100033820 Ga0070711_1000338202 203
97 3300005445 Ga0070708_100262715 Ga0070708_1002627152 203
98 3300005457 Ga0070662_100741816 Ga0070662_1007418161 203
99 3300005468 Ga0070707_100133644 Ga0070707_1001336442 203
100 3300005471 Ga0070698_100009121 Ga0070698_1000091213 203
101 3300005843 Ga0068860_100521382 Ga0068860_1005213821 203
102 3300006163 Ga0070715_10389638 Ga0070715_103896381 203
103 3300006175 Ga0070712_100072787 Ga0070712_1000727872 203
104 3300007788 Ga0099795_10003415 Ga0099795_100034152 203
105 3300009545 Ga0105237_10748476 Ga0105237_107484761 203
106 3300013297 Ga0157378_10037436 Ga0157378_100374365 203
107 3300014968 Ga0157379_10037065 Ga0157379_100370653 203
108 3300025898 Ga0207692_10315328 Ga0207692_103153282 203
109 3300025910 Ga0207684_10095800 Ga0207684_100958002 203
110 3300025914 Ga0207671_10485759 Ga0207671_104857591 203
111 3300025915 Ga0207693_10027577 Ga0207693_100275773 203
112 3300025915 Ga0207693_10071784 Ga0207693_100717842 203
113 3300025915 Ga0207693_10094140 Ga0207693_100941401 203
114 3300025916 Ga0207663_10091330 Ga0207663_100913302 203
115 3300025922 Ga0207646_10882198 Ga0207646_108821982 203
116 3300026088 Ga0207641_10010943 Ga0207641_100109437 203
117 3300027671 Ga0209588_1012569 Ga0209588_10125692 203
118 3300028381 Ga0268264_10662382 Ga0268264_106623822 203
119 3300031090 Ga0265760_10005396 Ga0265760_100053962 203
120 3300031090 Ga0265760_10080391 Ga0265760_100803912 203
121 3300035083 Ga0373926_0041064 Ga0373926_0041064_949_1572 203
122 3300035172 Ga0373955_0230936 Ga0373955_0230936_66_689 203
123 3300035692 Ga0373935_0019210 Ga0373935_0019210_2315_2938 203
124 3300035695 Ga0373927_0021233 Ga0373927_0021233_1475_2098 203
125 3300036401 Ga0373937_0001750 Ga0373937_0001750_1278_1901 203
126 3300044673 Ga0453683_0026951 Ga0453683_0026951_354_977 203
127 3300044712 Ga0453684_0139676 Ga0453684_0139676_30_653 203
128 3300045051 Ga0451576_0049659 Ga0451576_0049659_3617_4231 203
129 3300046462 Ga0495651_0000130 Ga0495651_0000130_2546_3169 203
130 3300046463 Ga0495653_0018468 Ga0495653_0018468_3210_3833 203
131 3300046477 Ga0495664_0116041 Ga0495664_0116041_448_1071 203
132 3300046511 Ga0495608_0005318 Ga0495608_0005318_1968_2591 203
133 3300046516 Ga0495628_0010430 Ga0495628_0010430_5185_5808 203
134 3300046517 Ga0495630_0021752 Ga0495630_0021752_2064_2687 203
135 3300046526 Ga0495666_0103682 Ga0495666_0103682_584_1207 203
136 3300046529 Ga0495652_0073605 Ga0495652_0073605_17_640 203
137 3300046531 Ga0495665_0005669 Ga0495665_0005669_3034_3657 203
138 3300046535 Ga0495586_0004147 Ga0495586_0004147_1346_1969 203
139 3300046535 Ga0495586_0081927 Ga0495586_0081927_661_1284 203
140 3300046536 Ga0495587_0315780 Ga0495587_0315780_80_703 203
141 3300046543 Ga0495645_0104994 Ga0495645_0104994_985_1608 203
142 3300046559 Ga0495667_0134719 Ga0495667_0134719_373_996 203
143 3300046642 Ga0495634_0106973 Ga0495634_0106973_560_1183 203
144 3300046663 Ga0495635_0167327 Ga0495635_0167327_229_852 203
145 3300046675 Ga0495657_0041244 Ga0495657_0041244_553_1176 203
146 3300046679 Ga0495623_0013626 Ga0495623_0013626_1582_2205 203
147 3300046680 Ga0495646_0003673 Ga0495646_0003673_1676_2299 203
148 3300046689 Ga0495613_0118977 Ga0495613_0118977_85_708 203
149 3300046690 Ga0495624_0346242 Ga0495624_0346242_238_861 203
150 3300047317 Ga0495604_0105254 Ga0495604_0105254_425_1048 203
151 3300047319 Ga0495674_0035884 Ga0495674_0035884_2903_3526 203
152 3300047319 Ga0495674_0069068 Ga0495674_0069068_1021_1644 203
153 3300047322 Ga0495680_0000182 Ga0495680_0000182_54826_55449 203
154 3300047444 Ga0495675_0049065 Ga0495675_0049065_838_1461 203
155 3300047444 Ga0495675_0055630 Ga0495675_0055630_832_1455 203
156 3300047471 Ga0495684_0008870 Ga0495684_0008870_1450_2073 203
157 3300047471 Ga0495684_0462666 Ga0495684_0462666_84_707 203
158 3300047673 Ga0495593_0118187 Ga0495593_0118187_452_1075 203
159 3300048088 Ga0495602_0019623 Ga0495602_0019623_944_1567 203
160 3300048089 Ga0495614_0039375 Ga0495614_0039375_319_942 203
161 3300053078 Ga0495612_0065310 Ga0495612_0065310_528_1151 203
162 3300005459 Ga0068867_100538797 Ga0068867_1005387971 204
163 3300005844 Ga0068862_100214683 Ga0068862_1002146832 204
164 3300009148 Ga0105243_10011346 Ga0105243_100113463 204
165 3300025935 Ga0207709_10474388 Ga0207709_104743881 204
166 3300046559 Ga0495667_0056772 Ga0495667_0056772_1620_2246 204
167 3300046675 Ga0495657_0011058 Ga0495657_0011058_5960_6586 204
168 3300046689 Ga0495613_0256301 Ga0495613_0256301_33_659 204
169 3300046809 Ga0495600_0292679 Ga0495600_0292679_109_735 204
170 3300047471 Ga0495684_0008696 Ga0495684_0008696_1470_2096 204
171 3300006028 Ga0070717_10008778 Ga0070717_100087788 205
172 3300014968 Ga0157379_10019615 Ga0157379_100196156 205
173 3300025961 Ga0207712_10094527 Ga0207712_100945271 205
174 3300026118 Ga0207675_100744432 Ga0207675_1007444322 205
175 3300027695 Ga0209966_1003309 Ga0209966_10033093 205
176 3300028381 Ga0268264_10045206 Ga0268264_100452063 205
177 3300041408 Ga0439453_0007186 Ga0439453_0007186_277_900 205
178 3300042001 Ga0439441_016622 Ga0439441_016622_518_1141 205
179 3300042461 Ga0439460_0038463 Ga0439460_0038463_551_1174 205
180 3300044673 Ga0453683_0282301 Ga0453683_0282301_266_898 205
181 3300046648 Ga0495611_0194045 Ga0495611_0194045_257_889 205
182 3300050508 nmdc:mga09592_157646_c1 nmdc:mga09592_157646_c1_689_1312 205
183 3300050509 nmdc:mga0qj67_330922_c1 nmdc:mga0qj67_330922_c1_507_1130 205
184 3300050510 nmdc:mga06r32_354887_c1 nmdc:mga06r32_354887_c1_628_1251 205
185 3300005535 Ga0070684_100343044 Ga0070684_1003430443 206
186 3300005539 Ga0068853_100014092 Ga0068853_1000140924 206
187 3300005563 Ga0068855_100004243 Ga0068855_1000042434 206
188 3300005614 Ga0068856_100033182 Ga0068856_1000331825 206
189 3300005616 Ga0068852_100002154 Ga0068852_10000215410 206
190 3300009551 Ga0105238_10012838 Ga0105238_100128384 206
191 3300010375 Ga0105239_10050642 Ga0105239_100506422 206
192 3300013307 Ga0157372_10209228 Ga0157372_102092281 206
193 3300025911 Ga0207654_10002450 Ga0207654_100024505 206
194 3300025913 Ga0207695_10004894 Ga0207695_100048944 206
195 3300025914 Ga0207671_10003729 Ga0207671_100037299 206
196 3300025920 Ga0207649_10297582 Ga0207649_102975823 206
197 3300025924 Ga0207694_10000084 Ga0207694_1000008448 206
198 3300025949 Ga0207667_10012696 Ga0207667_100126965 206
199 3300026041 Ga0207639_10018936 Ga0207639_100189364 206
200 3300026078 Ga0207702_10136028 Ga0207702_101360284 206
201 3300026142 Ga0207698_10003724 Ga0207698_100037245 206
202 3300048924 Ga0496121_0143639 Ga0496121_0143639_479_1102 206
203 3300005347 Ga0070668_100569890 Ga0070668_1005698901 207
204 3300005353 Ga0070669_100034202 Ga0070669_1000342021 207
205 3300005356 Ga0070674_100006437 Ga0070674_1000064371 207
206 3300005364 Ga0070673_100561968 Ga0070673_1005619681 207
207 3300005367 Ga0070667_100127736 Ga0070667_1001277362 207
208 3300005459 Ga0068867_100005169 Ga0068867_1000051694 207
209 3300005539 Ga0068853_100353506 Ga0068853_1003535063 207
210 3300005543 Ga0070672_100015108 Ga0070672_1000151083 207
211 3300005544 Ga0070686_100149922 Ga0070686_1001499222 207
212 3300005547 Ga0070693_100358204 Ga0070693_1003582041 207
213 3300005617 Ga0068859_100046064 Ga0068859_1000460644 207
214 3300005718 Ga0068866_10181237 Ga0068866_101812371 207
215 3300005719 Ga0068861_100002116 Ga0068861_10000211615 207
216 3300005843 Ga0068860_100004405 Ga0068860_10000440516 207
217 3300005844 Ga0068862_100006922 Ga0068862_1000069226 207
218 3300006881 Ga0068865_100004435 Ga0068865_1000044356 207
219 3300006931 Ga0097620_100046064 Ga0097620_1000460644 207
220 3300017792 Ga0163161_10144938 Ga0163161_101449383 207
221 3300025923 Ga0207681_10026678 Ga0207681_100266786 207
222 3300025937 Ga0207669_10058318 Ga0207669_100583181 207
223 3300025938 Ga0207704_10033838 Ga0207704_100338383 207
224 3300025940 Ga0207691_10025827 Ga0207691_100258278 207
225 3300025942 Ga0207689_10147110 Ga0207689_101471103 207
226 3300025960 Ga0207651_10603009 Ga0207651_106030091 207
227 3300025972 Ga0207668_10409004 Ga0207668_104090041 207
228 3300026041 Ga0207639_10144536 Ga0207639_101445361 207
229 3300026089 Ga0207648_10001254 Ga0207648_1000125424 207
230 3300026118 Ga0207675_100000368 Ga0207675_10000036813 207
231 3300028380 Ga0268265_10003321 Ga0268265_1000332112 207
232 3300028381 Ga0268264_10000850 Ga0268264_1000085016 207
233 3300030760 Ga0265762_1016650 Ga0265762_10166502 207
234 3300035692 Ga0373935_0821005 Ga0373935_0821005_42_674 207
235 3300046535 Ga0495586_0026447 Ga0495586_0026447_1788_2420 207
236 3300046794 Ga0495589_0106097 Ga0495589_0106097_239_868 207
237 3300013297 Ga0157378_10050729 Ga0157378_100507294 208
238 3300013306 Ga0163162_10018672 Ga0163162_100186726 208
239 3300014326 Ga0157380_10016528 Ga0157380_100165285 208
240 3300031730 Ga0307516_10000897 Ga0307516_1000089730 208
241 3300035083 Ga0373926_0056558 Ga0373926_0056558_402_1088 208
242 3300035089 Ga0373944_0006159 Ga0373944_0006159_840_1526 208
243 3300035695 Ga0373927_0040445 Ga0373927_0040445_1285_1971 208
244 3300037068 Ga0373925_0001392 Ga0373925_0001392_1834_2520 208
245 3300046681 Ga0495647_0022834 Ga0495647_0022834_487_1173 208
246 3300047318 Ga0495636_0014146 Ga0495636_0014146_2327_3013 208
247 3300053148 Ga0500590_055874 Ga0500590_055874_173_817 208
248 3300002705 JGI25156J39149_1006583 JGI25156J39149_10065833 209
249 3300005614 Ga0068856_100019805 Ga0068856_1000198052 209
250 3300025256 Ga0209759_1000660 Ga0209759_100066016 209
251 3300026078 Ga0207702_10390198 Ga0207702_103901982 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

25

164

0.86

PF08534

Redoxin

Redoxin

24

174

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gl3-assembly1.cif.gz_A crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum 0.8645 29 161
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.851 29 159
1lu4-assembly1.cif.gz_A 1.1 angstrom resolution crystal structure of a secreted mycobacterium tuberculosis disulfide oxidoreductase homologous to e. coli dsbe: implications for functions 0.8462 39 156
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.8457 31 208
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8414 28 161
ID Description Score Start End Superfamily
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8421 31 205 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8415 28 161 3.40.30.10
3hdcA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8402 39 161 3.40.30.10
2ywoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8387 28 208 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8225 33 177 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3R9YUX2-F1-model_v4 Redoxin domain-containing protein 0.9831 23 209 GO:0016209
GO:0016491
AF-A0A4V1SBC6-F1-model_v4 Redoxin domain-containing protein 0.9811 31 207 GO:0016209
GO:0016491
AF-A0A1G2WN12-F1-model_v4 deleted 0.9785 42 207
AF-A0A7V9ETZ2-F1-model_v4 Thioredoxin family protein 0.9783 41 209 GO:0016209
GO:0016491
AF-A0A246IY80-F1-model_v4 Thioredoxin family protein 0.9777 22 209 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
89.57 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map