F362255

General Info

Members Datasets Scaffolds Average Seq Length
251 188 502 248

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100015822|Ga0068853_1000158223
Length 285
Sequence MGLLAALYGGIVYAIFLATFVYAIGFVGNLLVPKSVDLGLPPGASGEPLLLSLLIDVLLLGIFAIQHSVMARPAFKRWWTRIVPPVIERSTFVLLASMALLLLFSGWRPLAGTEWDFRGTLFGCMLAAVCALGWMLVLLASFQIDHFELFGLKQVWRQLCGQPEAPAEFRVPGLYRHVRHPIYLGFMLAFWSTPLMSVGHLLFAAMTSGYILIGIAFEERDLIAQFGERYRLYRRQVGMLLPRLGTTTIERAGPSDTRRYRMDRRGTRTLSDTAKSPTSPSIRRR

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
180 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
181 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
185 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
186 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
187 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
188 2919462493 Variovorax sp. 3319 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.76
Nodule 0
Rhizoplane 1.2
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100015822 3300005539 Bacteria 6195
2 JGI25153J46596_10042628 3300003215 Bacteria 1383
3 rootH1_10119284 3300003323 Bacteria 1605
4 Ga0055540_1010588 3300003792 Bacteria 3055
5 Ga0070658_10007539 3300005327 Bacteria 8780
6 Ga0070690_100032223 3300005330 Bacteria 3271
7 Ga0070690_100042465 3300005330 Bacteria 2880
8 Ga0070690_100177557 3300005330 Bacteria 1470
9 Ga0068869_100022522 3300005334 Bacteria 4342
10 Ga0070666_10005935 3300005335 Bacteria 7499
11 Ga0070680_100083923 3300005336 Bacteria 2631
12 Ga0070682_100013440 3300005337 Bacteria 4710
13 Ga0068868_100001055 3300005338 Bacteria 18854
14 Ga0070689_100039656 3300005340 Bacteria 3607
15 Ga0070689_100183509 3300005340 Bacteria 1701
16 Ga0070687_100116447 3300005343 Bacteria 1521
17 Ga0070668_100411045 3300005347 Bacteria 1157
18 Ga0070669_100150886 3300005353 Bacteria 1799
19 Ga0070675_100009250 3300005354 Bacteria 7654
20 Ga0070671_100017325 3300005355 Bacteria 5834
21 Ga0070673_100001034 3300005364 Bacteria 15776
22 Ga0070688_100088307 3300005365 Bacteria 2021
23 Ga0070667_100017600 3300005367 Bacteria 5921
24 Ga0070709_10033199 3300005434 Bacteria 3119
25 Ga0070713_100049640 3300005436 Bacteria 3463
26 Ga0070678_100021109 3300005456 Bacteria 4288
27 Ga0070662_100045881 3300005457 Bacteria 3138
28 Ga0070681_10004557 3300005458 Bacteria 13221
29 Ga0068867_100038426 3300005459 Bacteria 3485
30 Ga0070685_10012353 3300005466 Bacteria 4486
31 Ga0070684_100190041 3300005535 Bacteria 1868
32 Ga0070697_100154578 3300005536 Bacteria 1935
33 Ga0068853_100325681 3300005539 Bacteria 1425
34 Ga0068853_100403379 3300005539 Bacteria 1280
35 Ga0070672_100112301 3300005543 Bacteria 2223
36 Ga0070686_100017090 3300005544 Bacteria 4234
37 Ga0070686_100076256 3300005544 Bacteria 2207
38 Ga0070695_100225403 3300005545 Bacteria 1352
39 Ga0070696_100096862 3300005546 Bacteria 2109
40 Ga0070696_100288019 3300005546 Bacteria 1254
41 Ga0070665_100713332 3300005548 Bacteria 1016
42 Ga0068854_100177409 3300005578 Bacteria 1662
43 Ga0068854_100180961 3300005578 Bacteria 1647
44 Ga0068856_100048302 3300005614 Bacteria 4193
45 Ga0070702_100225496 3300005615 Bacteria 1256
46 Ga0068859_100050331 3300005617 Bacteria 4185
47 Ga0068859_100548428 3300005617 Bacteria 1251
48 Ga0068864_100000464 3300005618 Bacteria 35141
49 Ga0068866_10122100 3300005718 Bacteria 1469
50 Ga0068861_100130515 3300005719 Bacteria 2039
51 Ga0068851_10042861 3300005834 Bacteria 2279
52 Ga0068863_100190423 3300005841 Bacteria 1971
53 Ga0068858_100001151 3300005842 Bacteria 27341
54 Ga0068858_100185870 3300005842 Bacteria 1963
55 Ga0068860_100058322 3300005843 Bacteria 3670
56 Ga0068860_100361691 3300005843 Bacteria 1430
57 Ga0068862_100017949 3300005844 Bacteria 5893
58 Ga0081455_10018096 3300005937 Bacteria 6727
59 Ga0081455_10069929 3300005937 Bacteria 2916
60 Ga0075362_10133092 3300006177 Bacteria 1184
61 Ga0075367_10173945 3300006178 Bacteria 1341
62 Ga0075366_10013206 3300006195 Bacteria 4698
63 Ga0075366_10199621 3300006195 Bacteria 1216
64 Ga0075366_10282541 3300006195 Bacteria 1014
65 Ga0097621_100015214 3300006237 Bacteria 5782
66 Ga0097621_100020006 3300006237 Bacteria 5152
67 Ga0075370_10022429 3300006353 Bacteria 3468
68 Ga0075370_10038690 3300006353 Bacteria 2685
69 Ga0068871_100002037 3300006358 Bacteria 13697
70 Ga0068871_100005828 3300006358 Bacteria 8658
71 Ga0068871_100031122 3300006358 Bacteria 4205
72 Ga0068871_100032979 3300006358 Bacteria 4095
73 Ga0068865_100307016 3300006881 Bacteria 1272
74 Ga0097620_100050332 3300006931 Bacteria 4185
75 Ga0097620_100548357 3300006931 Bacteria 1251
76 Ga0111539_10018788 3300009094 Bacteria 8554
77 Ga0105245_10025217 3300009098 Bacteria 5227
78 Ga0105245_10051927 3300009098 Bacteria 3676
79 Ga0105243_10021100 3300009148 Bacteria 4944
80 Ga0105243_10180742 3300009148 Bacteria 1834
81 Ga0105243_10226436 3300009148 Bacteria 1656
82 Ga0105242_10125882 3300009176 Bacteria 2205
83 Ga0105248_10095878 3300009177 Bacteria 3340
84 Ga0105249_10529082 3300009553 Bacteria 1227
85 Ga0157374_10202204 3300013296 Bacteria 1945
86 Ga0157374_10291624 3300013296 Bacteria 1613
87 Ga0157378_10308546 3300013297 Bacteria 1534
88 Ga0163162_10006914 3300013306 Bacteria 10999
89 Ga0157375_10041618 3300013308 Bacteria 4438
90 Ga0157375_10077014 3300013308 Bacteria 3364
91 Ga0163163_10002467 3300014325 Bacteria 15632
92 Ga0157379_10002968 3300014968 Bacteria 14312
93 Ga0157379_10250990 3300014968 Bacteria 1606
94 Ga0157376_10124754 3300014969 Bacteria 2288
95 Ga0157376_10329618 3300014969 Bacteria 1454
96 Ga0163161_10253683 3300017792 Bacteria 1372
97 Ga0209675_1002161 3300025291 Bacteria 10361
98 Ga0209758_1002650 3300025297 Bacteria 17728
99 Ga0209051_1001918 3300025303 Bacteria 16139
100 Ga0207682_10019976 3300025893 Bacteria 2627
101 Ga0207680_10029447 3300025903 Bacteria 3085
102 Ga0207645_10026890 3300025907 Bacteria 3718
103 Ga0207695_10003519 3300025913 Bacteria 21935
104 Ga0207671_10003283 3300025914 Bacteria 16277
105 Ga0207671_10144265 3300025914 Bacteria 1836
106 Ga0207652_10463475 3300025921 Bacteria 1142
107 Ga0207652_10541022 3300025921 Bacteria 1047
108 Ga0207681_10113202 3300025923 Bacteria 1978
109 Ga0207659_10003971 3300025926 Bacteria 8925
110 Ga0207644_10020605 3300025931 Bacteria 4486
111 Ga0207706_10054405 3300025933 Bacteria 3532
112 Ga0207709_10131245 3300025935 Bacteria 1708
113 Ga0207670_10050871 3300025936 Bacteria 2779
114 Ga0207704_10493488 3300025938 Bacteria 985
115 Ga0207704_10560517 3300025938 Bacteria 930
116 Ga0207691_10038932 3300025940 Bacteria 4399
117 Ga0207711_10021684 3300025941 Bacteria 5366
118 Ga0207689_10360855 3300025942 Bacteria 1208
119 Ga0207651_10031338 3300025960 Bacteria 3397
120 Ga0207640_10165783 3300025981 Bacteria 1640
121 Ga0207640_10620843 3300025981 Bacteria 917
122 Ga0207658_10018851 3300025986 Bacteria 4772
123 Ga0207658_10330173 3300025986 Bacteria 1323
124 Ga0207658_10535265 3300025986 Bacteria 1047
125 Ga0207677_10002714 3300026023 Bacteria 9336
126 Ga0207677_10476074 3300026023 Bacteria 1075
127 Ga0207703_10000731 3300026035 Bacteria 32297
128 Ga0207703_10548104 3300026035 Bacteria 1090
129 Ga0207639_10007941 3300026041 Bacteria 7249
130 Ga0207639_10188049 3300026041 Bacteria 1762
131 Ga0207708_10108677 3300026075 Bacteria 2151
132 Ga0207702_10257446 3300026078 Bacteria 1642
133 Ga0207641_10724534 3300026088 Bacteria 980
134 Ga0207648_10060794 3300026089 Bacteria 3295
135 Ga0207648_10110857 3300026089 Bacteria 2409
136 Ga0207676_10023979 3300026095 Bacteria 4510
137 Ga0207683_10006275 3300026121 Bacteria 10189
138 Ga0207683_10493421 3300026121 Bacteria 1131
139 Ga0209813_10065490 3300027866 Bacteria 1170
140 Ga0207428_10019484 3300027907 Bacteria 5784
141 Ga0268264_10043260 3300028381 Bacteria 3731
142 Ga0268264_10265962 3300028381 Bacteria 1600
143 Ga0265334_10010116 3300028573 Bacteria 3982
144 Ga0307515_10002157 3300028794 Bacteria 43195
145 Ga0307515_10060863 3300028794 Bacteria 5373
146 Ga0307515_10134052 3300028794 Bacteria 2706
147 Ga0307515_10292060 3300028794 Bacteria 1324
148 Ga0265339_10038968 3300031249 Bacteria 2648
149 Ga0307513_10000072 3300031456 Bacteria 138840
150 Ga0307513_10008409 3300031456 Bacteria 13215
151 Ga0307513_10064931 3300031456 Bacteria 3842
152 Ga0307408_100016374 3300031548 Bacteria 4947
153 Ga0307514_10001928 3300031649 Bacteria 22724
154 Ga0307412_10071463 3300031911 Bacteria 2369
155 Ga0307409_100634810 3300031995 Bacteria 1060
156 Ga0373939_0010312 3300035114 Bacteria 2334
157 Ga0373955_0033266 3300035172 Bacteria 2714
158 Ga0373935_0076699 3300035692 Bacteria 2165
159 Ga0373935_0196474 3300035692 Bacteria 1392
160 Ga0373937_0015680 3300036401 Bacteria 6709
161 Ga0373937_0158008 3300036401 Bacteria 2125
162 Ga0373925_0056787 3300037068 Bacteria 2933
163 Ga0436363_1325016 3300039450 Bacteria 5069
164 Ga0439435_0107705 3300042436 Bacteria 862
165 Ga0451577_0582591 3300042876 Bacteria 1015
166 Ga0466972_0089328 3300044658 Bacteria 1462
167 Ga0466966_0064693 3300044684 Bacteria 2301
168 Ga0466966_0395143 3300044684 Bacteria 831
169 Ga0466961_0011520 3300044693 Bacteria 5654
170 Ga0453684_0229393 3300044712 Bacteria 2145
171 Ga0466970_0296022 3300044765 Bacteria 912
172 Ga0466959_0009860 3300045049 Bacteria 6807
173 Ga0451576_0245381 3300045051 Bacteria 1871
174 Ga0451576_0425703 3300045051 Bacteria 1393
175 Ga0495592_0055325 3300046454 Bacteria 2936
176 Ga0495629_0148913 3300046459 Bacteria 1627
177 Ga0495651_0111731 3300046462 Bacteria 2019
178 Ga0495653_0162064 3300046463 Bacteria 1551
179 Ga0495653_0165324 3300046463 Bacteria 1532
180 Ga0495650_0005048 3300046471 Bacteria 8743
181 Ga0495662_0125127 3300046476 Bacteria 1263
182 Ga0495608_0004612 3300046511 Bacteria 9841
183 Ga0495608_0226815 3300046511 Bacteria 1170
184 Ga0495618_0054928 3300046514 Bacteria 2521
185 Ga0495628_0042622 3300046516 Bacteria 3619
186 Ga0495630_0009714 3300046517 Bacteria 6921
187 Ga0495643_0149453 3300046522 Bacteria 1158
188 Ga0495652_0079309 3300046529 Bacteria 2715
189 Ga0495652_0301880 3300046529 Bacteria 1163
190 Ga0495640_0001742 3300046533 Bacteria 17244
191 Ga0495640_0130983 3300046533 Bacteria 1623
192 Ga0495586_0005436 3300046535 Bacteria 6812
193 Ga0495587_0017609 3300046536 Bacteria 4438
194 Ga0495587_0033440 3300046536 Bacteria 3105
195 Ga0495597_0002141 3300046542 Bacteria 13072
196 Ga0495645_0015767 3300046543 Bacteria 5379
197 Ga0495667_0005604 3300046559 Bacteria 8484
198 Ga0495667_0134947 3300046559 Bacteria 1591
199 Ga0495634_0067059 3300046642 Bacteria 2374
200 Ga0495635_0019248 3300046663 Bacteria 4761
201 Ga0495635_0199250 3300046663 Bacteria 1358
202 Ga0495599_0001643 3300046678 Bacteria 12895
203 Ga0495599_0141027 3300046678 Bacteria 1495
204 Ga0495624_0137878 3300046690 Bacteria 1495
205 Ga0495600_0005488 3300046809 Bacteria 7651
206 Ga0495604_0005932 3300047317 Bacteria 9689
207 Ga0495674_0394613 3300047319 Bacteria 1118
208 Ga0495680_0007971 3300047322 Bacteria 9658
209 Ga0495680_0112474 3300047322 Bacteria 2017
210 Ga0495680_0580547 3300047322 Bacteria 752
211 Ga0495687_000761 3300047443 Bacteria 34838
212 Ga0495684_0204958 3300047471 Bacteria 1453
213 Ga0495684_0283990 3300047471 Bacteria 1193
214 Ga0495686_0003359 3300047472 Bacteria 13945
215 Ga0496106_0039470 3300048909 Bacteria 3536
216 Ga0496108_0048603 3300048911 Bacteria 3547
217 Ga0496109_0068759 3300048912 Bacteria 3246
218 Ga0501068_0133274 3300049584 Bacteria 1555
219 Ga0501070_0082738 3300049586 Bacteria 2657
220 Ga0501073_0009473 3300049589 Bacteria 7189
221 Ga0501074_0011515 3300049590 Bacteria 6430
222 Ga0501079_0309105 3300049741 Bacteria 1237
223 Ga0501080_0019627 3300049742 Bacteria 6261
224 Ga0501080_0022467 3300049742 Bacteria 5843
225 Ga0501035_0027428 3300049822 Bacteria 5206
226 Ga0501044_0009396 3300049823 Bacteria 10653
227 nmdc:mga03683_72025_c1 3300050489 Bacteria 1479
228 nmdc:mga0k408_229367_c1 3300050493 Bacteria 1109
229 nmdc:mga0k408_35268_c1 3300050493 Bacteria 2869
230 nmdc:mga07m45_1817_c1 3300050496 Bacteria 9840
231 nmdc:mga09592_239794_c1 3300050508 Bacteria 1571
232 nmdc:mga08y16_33920_c1 3300050511 Bacteria 5362
233 nmdc:mga0n895_221046_c1 3300050512 Bacteria 1923
234 nmdc:mga0rr50_200262_c2 3300050513 Bacteria 1255
235 nmdc:mga0a205_195741_c1 3300050515 Bacteria 1912
236 Ga0495601_0059416 3300053077 Bacteria 2424
237 Ga0495601_0099720 3300053077 Bacteria 1875
238 Ga0495595_0075862 3300053084 Bacteria 1595
239 Ga0495619_0117427 3300053085 Bacteria 1822
240 Ga0500644_0001451 3300053088 Bacteria 6255
241 Ga0500642_0042713 3300053130 Bacteria 1966
242 Ga0500586_011926 3300053145 Bacteria 2509
243 Ga0500604_0072637 3300053151 Bacteria 1099
244 Ga0500622_0024471 3300053156 Bacteria 3192
245 Ga0501082_0088249 3300060353 Bacteria 2676
246 Ga0466962_0095562 3300061719 Bacteria 1425
247 Ga0466962_0142720 3300061719 Bacteria 1160
248 2588291816 2588253510 Bacteria 6901809
249 2644304967 2643221654 Bacteria 5273570
250 2808943122 2808606379 Bacteria 5022697
251 2919467895 2919462493 Bacteria 5817112
252 Ga0068853_100015822
253 JGI25153J46596_10042628
254 rootH1_10119284
255 Ga0055540_1010588
256 Ga0070658_10007539
257 Ga0070690_100032223
258 Ga0070690_100042465
259 Ga0070690_100177557
260 Ga0068869_100022522
261 Ga0070666_10005935
262 Ga0070680_100083923
263 Ga0070682_100013440
264 Ga0068868_100001055
265 Ga0070689_100039656
266 Ga0070689_100183509
267 Ga0070687_100116447
268 Ga0070668_100411045
269 Ga0070669_100150886
270 Ga0070675_100009250
271 Ga0070671_100017325
272 Ga0070673_100001034
273 Ga0070688_100088307
274 Ga0070667_100017600
275 Ga0070709_10033199
276 Ga0070713_100049640
277 Ga0070678_100021109
278 Ga0070662_100045881
279 Ga0070681_10004557
280 Ga0068867_100038426
281 Ga0070685_10012353
282 Ga0070684_100190041
283 Ga0070697_100154578
284 Ga0068853_100325681
285 Ga0068853_100403379
286 Ga0070672_100112301
287 Ga0070686_100017090
288 Ga0070686_100076256
289 Ga0070695_100225403
290 Ga0070696_100096862
291 Ga0070696_100288019
292 Ga0070665_100713332
293 Ga0068854_100177409
294 Ga0068854_100180961
295 Ga0068856_100048302
296 Ga0070702_100225496
297 Ga0068859_100050331
298 Ga0068859_100548428
299 Ga0068864_100000464
300 Ga0068866_10122100
301 Ga0068861_100130515
302 Ga0068851_10042861
303 Ga0068863_100190423
304 Ga0068858_100001151
305 Ga0068858_100185870
306 Ga0068860_100058322
307 Ga0068860_100361691
308 Ga0068862_100017949
309 Ga0081455_10018096
310 Ga0081455_10069929
311 Ga0075362_10133092
312 Ga0075367_10173945
313 Ga0075366_10013206
314 Ga0075366_10199621
315 Ga0075366_10282541
316 Ga0097621_100015214
317 Ga0097621_100020006
318 Ga0075370_10022429
319 Ga0075370_10038690
320 Ga0068871_100002037
321 Ga0068871_100005828
322 Ga0068871_100031122
323 Ga0068871_100032979
324 Ga0068865_100307016
325 Ga0097620_100050332
326 Ga0097620_100548357
327 Ga0111539_10018788
328 Ga0105245_10025217
329 Ga0105245_10051927
330 Ga0105243_10021100
331 Ga0105243_10180742
332 Ga0105243_10226436
333 Ga0105242_10125882
334 Ga0105248_10095878
335 Ga0105249_10529082
336 Ga0157374_10202204
337 Ga0157374_10291624
338 Ga0157378_10308546
339 Ga0163162_10006914
340 Ga0157375_10041618
341 Ga0157375_10077014
342 Ga0163163_10002467
343 Ga0157379_10002968
344 Ga0157379_10250990
345 Ga0157376_10124754
346 Ga0157376_10329618
347 Ga0163161_10253683
348 Ga0209675_1002161
349 Ga0209758_1002650
350 Ga0209051_1001918
351 Ga0207682_10019976
352 Ga0207680_10029447
353 Ga0207645_10026890
354 Ga0207695_10003519
355 Ga0207671_10003283
356 Ga0207671_10144265
357 Ga0207652_10463475
358 Ga0207652_10541022
359 Ga0207681_10113202
360 Ga0207659_10003971
361 Ga0207644_10020605
362 Ga0207706_10054405
363 Ga0207709_10131245
364 Ga0207670_10050871
365 Ga0207704_10493488
366 Ga0207704_10560517
367 Ga0207691_10038932
368 Ga0207711_10021684
369 Ga0207689_10360855
370 Ga0207651_10031338
371 Ga0207640_10165783
372 Ga0207640_10620843
373 Ga0207658_10018851
374 Ga0207658_10330173
375 Ga0207658_10535265
376 Ga0207677_10002714
377 Ga0207677_10476074
378 Ga0207703_10000731
379 Ga0207703_10548104
380 Ga0207639_10007941
381 Ga0207639_10188049
382 Ga0207708_10108677
383 Ga0207702_10257446
384 Ga0207641_10724534
385 Ga0207648_10060794
386 Ga0207648_10110857
387 Ga0207676_10023979
388 Ga0207683_10006275
389 Ga0207683_10493421
390 Ga0209813_10065490
391 Ga0207428_10019484
392 Ga0268264_10043260
393 Ga0268264_10265962
394 Ga0265334_10010116
395 Ga0307515_10002157
396 Ga0307515_10060863
397 Ga0307515_10134052
398 Ga0307515_10292060
399 Ga0265339_10038968
400 Ga0307513_10000072
401 Ga0307513_10008409
402 Ga0307513_10064931
403 Ga0307408_100016374
404 Ga0307514_10001928
405 Ga0307412_10071463
406 Ga0307409_100634810
407 Ga0373939_0010312
408 Ga0373955_0033266
409 Ga0373935_0076699
410 Ga0373935_0196474
411 Ga0373937_0015680
412 Ga0373937_0158008
413 Ga0373925_0056787
414 Ga0436363_1325016
415 Ga0439435_0107705
416 Ga0451577_0582591
417 Ga0466972_0089328
418 Ga0466966_0064693
419 Ga0466966_0395143
420 Ga0466961_0011520
421 Ga0453684_0229393
422 Ga0466970_0296022
423 Ga0466959_0009860
424 Ga0451576_0245381
425 Ga0451576_0425703
426 Ga0495592_0055325
427 Ga0495629_0148913
428 Ga0495651_0111731
429 Ga0495653_0162064
430 Ga0495653_0165324
431 Ga0495650_0005048
432 Ga0495662_0125127
433 Ga0495608_0004612
434 Ga0495608_0226815
435 Ga0495618_0054928
436 Ga0495628_0042622
437 Ga0495630_0009714
438 Ga0495643_0149453
439 Ga0495652_0079309
440 Ga0495652_0301880
441 Ga0495640_0001742
442 Ga0495640_0130983
443 Ga0495586_0005436
444 Ga0495587_0017609
445 Ga0495587_0033440
446 Ga0495597_0002141
447 Ga0495645_0015767
448 Ga0495667_0005604
449 Ga0495667_0134947
450 Ga0495634_0067059
451 Ga0495635_0019248
452 Ga0495635_0199250
453 Ga0495599_0001643
454 Ga0495599_0141027
455 Ga0495624_0137878
456 Ga0495600_0005488
457 Ga0495604_0005932
458 Ga0495674_0394613
459 Ga0495680_0007971
460 Ga0495680_0112474
461 Ga0495680_0580547
462 Ga0495687_000761
463 Ga0495684_0204958
464 Ga0495684_0283990
465 Ga0495686_0003359
466 Ga0496106_0039470
467 Ga0496108_0048603
468 Ga0496109_0068759
469 Ga0501068_0133274
470 Ga0501070_0082738
471 Ga0501073_0009473
472 Ga0501074_0011515
473 Ga0501079_0309105
474 Ga0501080_0019627
475 Ga0501080_0022467
476 Ga0501035_0027428
477 Ga0501044_0009396
478 nmdc:mga03683_72025_c1
479 nmdc:mga0k408_229367_c1
480 nmdc:mga0k408_35268_c1
481 nmdc:mga07m45_1817_c1
482 nmdc:mga09592_239794_c1
483 nmdc:mga08y16_33920_c1
484 nmdc:mga0n895_221046_c1
485 nmdc:mga0rr50_200262_c2
486 nmdc:mga0a205_195741_c1
487 Ga0495601_0059416
488 Ga0495601_0099720
489 Ga0495595_0075862
490 Ga0495619_0117427
491 Ga0500644_0001451
492 Ga0500642_0042713
493 Ga0500586_011926
494 Ga0500604_0072637
495 Ga0500622_0024471
496 Ga0501082_0088249
497 Ga0466962_0095562
498 Ga0466962_0142720
499 2588291816
500 2644304967
501 2808943122
502 2919467895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06966

DUF1295

Protein of unknown function (DUF1295)

85

237

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.4116 117 235
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.387 7 233
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.362 7 233
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.3197 10 231
1gqa-assembly1.cif.gz_D cytochrome c' from rhodobacter spheriodes 0.316 44 153
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9749 49 235 1.20.120.1630
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9402 49 235 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8357 50 206 1.20.120.1630
af_Q54JG5_70_234_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8325 50 205 1.20.120.1630
af_Q6MG14_62_250_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8142 50 203 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A6M1T1B5-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9842 1 232 GO:0008168
GO:0016020
GO:0032259
AF-A0A2E7EH00-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9842 2 233 GO:0008168
GO:0016020
GO:0032259
AF-A0A4V0I8P4-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9838 3 233 GO:0008168
GO:0016020
GO:0032259
AF-A0A1Q8Y060-F1-model_v4 deleted 0.9832 3 233
AF-C6XRI9-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9831 4 233 GO:0008168
GO:0016020
GO:0032259

Map