F362210

General Info

Members Datasets Scaffolds Average Seq Length
251 171 502 99

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10397932|Ga0070709_103979322
Length 119
Sequence MLLIECPYCGKRPELEFSHGGQAHVVRARNPADVSTQEWTDFLYMRSNIKGVHAERWRHTHGCGRFFNALRDTTTDHFLATYKAGEPRPAIGGQAPGVPGSAGVAGLPDGSAFDPQVRS

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 3.98
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10397932 3300005434 Bacteria 1028
2 Ga0070676_10435646 3300005328 Bacteria 919
3 Ga0070690_100369480 3300005330 Bacteria 1046
4 Ga0070680_100090527 3300005336 Bacteria 2533
5 Ga0070680_101087626 3300005336 Bacteria 691
6 Ga0070689_100609195 3300005340 Bacteria 946
7 Ga0070689_102149608 3300005340 Bacteria 511
8 Ga0070687_101275375 3300005343 Bacteria 545
9 Ga0070668_100028245 3300005347 Bacteria 4259
10 Ga0070669_100240612 3300005353 Bacteria 1438
11 Ga0070669_101009786 3300005353 Bacteria 714
12 Ga0070675_100147163 3300005354 Bacteria 2018
13 Ga0070671_100620319 3300005355 Bacteria 935
14 Ga0070674_100124323 3300005356 Bacteria 1914
15 Ga0070667_100288088 3300005367 Bacteria 1476
16 Ga0070709_10002859 3300005434 Bacteria 9332
17 Ga0070709_11414649 3300005434 Bacteria 563
18 Ga0070714_100006647 3300005435 Bacteria 8949
19 Ga0070714_100572593 3300005435 Bacteria 1083
20 Ga0070713_100063751 3300005436 Bacteria 3091
21 Ga0070713_100080423 3300005436 Bacteria 2779
22 Ga0070713_100653177 3300005436 Bacteria 1002
23 Ga0070713_100732341 3300005436 Bacteria 945
24 Ga0070710_10037931 3300005437 Bacteria 2644
25 Ga0070701_11027246 3300005438 Bacteria 576
26 Ga0070711_100085854 3300005439 Bacteria 2255
27 Ga0070705_101627038 3300005440 Bacteria 544
28 Ga0070694_100235600 3300005444 Bacteria 1379
29 Ga0070678_100482411 3300005456 Bacteria 1091
30 Ga0070662_100774104 3300005457 Bacteria 815
31 Ga0070685_10349073 3300005466 Bacteria 1011
32 Ga0070679_100569564 3300005530 Bacteria 1076
33 Ga0068853_101960240 3300005539 Bacteria 568
34 Ga0070672_100348704 3300005543 Bacteria 1262
35 Ga0070672_100890190 3300005543 Bacteria 786
36 Ga0070686_101412160 3300005544 Bacteria 584
37 Ga0070695_100506044 3300005545 Bacteria 935
38 Ga0070696_100000300 3300005546 Bacteria 29886
39 Ga0070665_100000295 3300005548 Bacteria 78617
40 Ga0070665_100154438 3300005548 Bacteria 2297
41 Ga0070704_101518381 3300005549 Bacteria 616
42 Ga0068855_100003665 3300005563 Bacteria 18787
43 Ga0068855_100339267 3300005563 Bacteria 1657
44 Ga0068855_100485369 3300005563 Bacteria 1344
45 Ga0068855_100815449 3300005563 Bacteria 991
46 Ga0070664_102145373 3300005564 Bacteria 530
47 Ga0068857_100420431 3300005577 Bacteria 1246
48 Ga0068857_101382547 3300005577 Unclassified 684
49 Ga0068859_100137854 3300005617 Bacteria 2513
50 Ga0068859_101215504 3300005617 Bacteria 830
51 Ga0068864_101426329 3300005618 Bacteria 694
52 Ga0068861_100839337 3300005719 Bacteria 865
53 Ga0068863_101407997 3300005841 Bacteria 705
54 Ga0068858_100679874 3300005842 Bacteria 1001
55 Ga0068858_100737243 3300005842 Bacteria 959
56 Ga0068860_102649026 3300005843 Unclassified 520
57 Ga0068862_100054429 3300005844 Bacteria 3426
58 Ga0070717_10001293 3300006028 Bacteria 17117
59 Ga0070717_11477349 3300006028 Bacteria 617
60 Ga0070715_10609438 3300006163 Bacteria 641
61 Ga0070716_100076471 3300006173 Bacteria 1984
62 Ga0070712_100130824 3300006175 Bacteria 1901
63 Ga0075428_100698548 3300006844 Bacteria 1081
64 Ga0075428_101039288 3300006844 Bacteria 866
65 Ga0075430_100157284 3300006846 Bacteria 1892
66 Ga0075431_101217245 3300006847 Bacteria 715
67 Ga0075433_10598476 3300006852 Bacteria 968
68 Ga0075434_100426607 3300006871 Bacteria 1347
69 Ga0075434_102355835 3300006871 Bacteria 535
70 Ga0075436_100158114 3300006914 Bacteria 1597
71 Ga0075436_100431408 3300006914 Bacteria 958
72 Ga0097620_100137857 3300006931 Bacteria 2513
73 Ga0097620_101215374 3300006931 Bacteria 830
74 Ga0075435_100082421 3300007076 Bacteria 2644
75 Ga0099794_10023375 3300007265 Bacteria 2826
76 Ga0099795_10000210 3300007788 Bacteria 10049
77 Ga0099795_10422205 3300007788 Bacteria 609
78 Ga0105240_10000743 3300009093 Bacteria 59524
79 Ga0105240_10007617 3300009093 Bacteria 15679
80 Ga0105240_10017163 3300009093 Bacteria 9770
81 Ga0105240_10083273 3300009093 Bacteria 3926
82 Ga0105240_10228940 3300009093 Bacteria 2161
83 Ga0105240_11570951 3300009093 Bacteria 689
84 Ga0111539_10337785 3300009094 Bacteria 1753
85 Ga0111539_11976258 3300009094 Bacteria 676
86 Ga0111539_12555224 3300009094 Bacteria 592
87 Ga0105247_10133883 3300009101 Bacteria 1618
88 Ga0105247_11761512 3300009101 Bacteria 514
89 Ga0105243_10042811 3300009148 Bacteria 3546
90 Ga0105243_11803526 3300009148 Bacteria 643
91 Ga0105237_10013864 3300009545 Bacteria 8435
92 Ga0105237_10047127 3300009545 Bacteria 4334
93 Ga0105237_10165517 3300009545 Bacteria 2210
94 Ga0105238_10361694 3300009551 Bacteria 1441
95 Ga0105249_10144175 3300009553 Bacteria 2287
96 Ga0105249_10480362 3300009553 Bacteria 1285
97 Ga0099796_10033157 3300010159 Bacteria 1698
98 Ga0099796_10330656 3300010159 Bacteria 653
99 Ga0105239_10685335 3300010375 Bacteria 1171
100 Ga0157370_10247146 3300013104 Bacteria 1650
101 Ga0157370_10333264 3300013104 Bacteria 1399
102 Ga0157370_10390291 3300013104 Bacteria 1282
103 Ga0157369_10013463 3300013105 Bacteria 9244
104 Ga0157369_10325618 3300013105 Bacteria 1597
105 Ga0157369_10878705 3300013105 Bacteria 920
106 Ga0157374_10370829 3300013296 Bacteria 1425
107 Ga0163162_11843513 3300013306 Bacteria 692
108 Ga0163162_13145648 3300013306 Bacteria 530
109 Ga0157372_10025776 3300013307 Bacteria 6395
110 Ga0157372_10429151 3300013307 Bacteria 1540
111 Ga0163163_11858642 3300014325 Bacteria 662
112 Ga0157380_10010294 3300014326 Bacteria 6722
113 Ga0157380_11163845 3300014326 Bacteria 813
114 Ga0157380_13088235 3300014326 Bacteria 531
115 Ga0157377_10404262 3300014745 Bacteria 931
116 Ga0157379_10127571 3300014968 Bacteria 2289
117 Ga0157379_10166232 3300014968 Bacteria 1991
118 Ga0206356_10464472 3300020070 Unclassified 519
119 Ga0207692_10047907 3300025898 Bacteria 2148
120 Ga0207710_10247913 3300025900 Bacteria 890
121 Ga0207685_10109632 3300025905 Bacteria 1194
122 Ga0207699_10011485 3300025906 Bacteria 4475
123 Ga0207699_10877004 3300025906 Bacteria 661
124 Ga0207645_10345021 3300025907 Bacteria 996
125 Ga0207645_10921408 3300025907 Bacteria 593
126 Ga0207707_10054840 3300025912 Bacteria 3469
127 Ga0207707_10197086 3300025912 Bacteria 1756
128 Ga0207695_10019327 3300025913 Bacteria 7845
129 Ga0207695_10041769 3300025913 Bacteria 4906
130 Ga0207695_10042013 3300025913 Bacteria 4888
131 Ga0207695_10044209 3300025913 Bacteria 4740
132 Ga0207695_10048285 3300025913 Bacteria 4497
133 Ga0207695_10464408 3300025913 Bacteria 1149
134 Ga0207695_11062383 3300025913 Bacteria 689
135 Ga0207693_10185990 3300025915 Bacteria 1635
136 Ga0207663_10258673 3300025916 Bacteria 1284
137 Ga0207660_10449132 3300025917 Bacteria 1042
138 Ga0207652_11481125 3300025921 Bacteria 583
139 Ga0207681_10034540 3300025923 Bacteria 3326
140 Ga0207681_10986049 3300025923 Bacteria 707
141 Ga0207694_10515419 3300025924 Bacteria 1002
142 Ga0207694_10841681 3300025924 Bacteria 775
143 Ga0207650_10786573 3300025925 Bacteria 806
144 Ga0207659_10100736 3300025926 Bacteria 2177
145 Ga0207659_10773128 3300025926 Bacteria 824
146 Ga0207700_10048251 3300025928 Bacteria 3161
147 Ga0207700_10108496 3300025928 Bacteria 2229
148 Ga0207700_10285843 3300025928 Bacteria 1420
149 Ga0207700_11278015 3300025928 Bacteria 654
150 Ga0207664_10095073 3300025929 Bacteria 2451
151 Ga0207670_11086241 3300025936 Bacteria 675
152 Ga0207669_10220396 3300025937 Bacteria 1392
153 Ga0207704_10019860 3300025938 Bacteria 3540
154 Ga0207665_10062781 3300025939 Bacteria 2521
155 Ga0207691_10191703 3300025940 Bacteria 1782
156 Ga0207691_10223609 3300025940 Bacteria 1632
157 Ga0207679_11844940 3300025945 Bacteria 552
158 Ga0207667_10007385 3300025949 Bacteria 13224
159 Ga0207667_10059673 3300025949 Bacteria 3995
160 Ga0207667_10100614 3300025949 Bacteria 2982
161 Ga0207667_10652426 3300025949 Bacteria 1058
162 Ga0207651_10171587 3300025960 Bacteria 1711
163 Ga0207712_10177988 3300025961 Bacteria 1668
164 Ga0207668_10193085 3300025972 Bacteria 1615
165 Ga0207668_10281479 3300025972 Bacteria 1364
166 Ga0207640_11518529 3300025981 Bacteria 602
167 Ga0207658_10572323 3300025986 Bacteria 1013
168 Ga0207703_10178169 3300026035 Bacteria 1874
169 Ga0207703_10979423 3300026035 Bacteria 811
170 Ga0207639_11987074 3300026041 Bacteria 543
171 Ga0207641_11564166 3300026088 Bacteria 661
172 Ga0207648_12039525 3300026089 Bacteria 535
173 Ga0207676_10044571 3300026095 Bacteria 3423
174 Ga0207674_10252167 3300026116 Bacteria 1712
175 Ga0207675_101238769 3300026118 Bacteria 766
176 Ga0207683_10729861 3300026121 Bacteria 919
177 Ga0207698_10436424 3300026142 Bacteria 1261
178 Ga0209588_1027650 3300027671 Bacteria 1805
179 Ga0265356_1000887 3300028017 Bacteria 4902
180 Ga0268266_10130177 3300028379 Bacteria 2250
181 Ga0268265_10162701 3300028380 Bacteria 1898
182 Ga0268265_10528830 3300028380 Bacteria 1116
183 Ga0268265_10702539 3300028380 Bacteria 977
184 Ga0268264_11166595 3300028381 Bacteria 779
185 Ga0265334_10010738 3300028573 Bacteria 3866
186 Ga0265338_10042295 3300028800 Bacteria 4245
187 Ga0265328_10010986 3300031239 Bacteria 3630
188 Ga0265340_10072207 3300031247 Bacteria 1634
189 Ga0265331_10003079 3300031250 Bacteria 10942
190 Ga0265316_11298035 3300031344 Bacteria 503
191 Ga0307415_101711389 3300032126 Bacteria 607
192 Ga0373955_0175373 3300035172 Bacteria 1270
193 Ga0373924_0182851 3300035410 Bacteria 923
194 Ga0373931_0879961 3300035691 Bacteria 601
195 Ga0373927_0337411 3300035695 Bacteria 993
196 Ga0373933_0302613 3300035724 Bacteria 1035
197 Ga0373947_1194417 3300035725 Bacteria 518
198 Ga0373937_0012119 3300036401 Bacteria 7568
199 Ga0436360_1131244 3300039438 Bacteria 21100
200 Ga0436361_0257140 3300039447 Bacteria 797
201 Ga0436361_0636321 3300039447 Bacteria 580
202 Ga0436361_0636991 3300039447 Bacteria 741
203 Ga0436361_1164277 3300039447 Bacteria 688
204 Ga0451577_0170444 3300042876 Bacteria 1961
205 Ga0451577_0245750 3300042876 Bacteria 1619
206 Ga0466972_0265558 3300044658 Bacteria 802
207 Ga0453684_0142210 3300044712 Bacteria 2863
208 Ga0453684_1140554 3300044712 Bacteria 821
209 Ga0453684_2303469 3300044712 Bacteria 535
210 Ga0466971_0370354 3300044719 Bacteria 695
211 Ga0466970_0151829 3300044765 Bacteria 1279
212 Ga0466959_0007699 3300045049 Bacteria 7571
213 Ga0466959_0085527 3300045049 Bacteria 2269
214 Ga0466959_0998391 3300045049 Bacteria 557
215 Ga0451576_0385373 3300045051 Bacteria 1469
216 Ga0451576_0672354 3300045051 Bacteria 1088
217 Ga0451576_1437476 3300045051 Bacteria 717
218 Ga0495638_0067293 3300046460 Bacteria 2200
219 Ga0495580_0048367 3300046472 Bacteria 3012
220 Ga0495580_0279979 3300046472 Bacteria 1138
221 Ga0495630_0510431 3300046517 Bacteria 922
222 Ga0495645_0314803 3300046543 Bacteria 1018
223 Ga0495657_0084384 3300046675 Bacteria 2049
224 Ga0495604_0078155 3300047317 Bacteria 2484
225 Ga0495672_0008372 3300047320 Bacteria 7646
226 Ga0495675_0223817 3300047444 Bacteria 1137
227 Ga0495686_0347594 3300047472 Bacteria 807
228 Ga0495602_0161442 3300048088 Bacteria 1749
229 Ga0496100_0171885 3300048903 Bacteria 1561
230 Ga0496101_0071032 3300048904 Bacteria 2551
231 Ga0496102_1415205 3300048905 Bacteria 614
232 Ga0496104_0097374 3300048907 Bacteria 2816
233 Ga0496105_0070643 3300048908 Bacteria 2887
234 Ga0496106_0129778 3300048909 Bacteria 1976
235 Ga0496109_0638856 3300048912 Bacteria 1001
236 Ga0496110_1006115 3300048913 Bacteria 741
237 Ga0496112_0320371 3300048915 Bacteria 1495
238 Ga0496115_0287525 3300048918 Bacteria 1349
239 Ga0496119_0158287 3300048922 Bacteria 1207
240 Ga0496121_0365059 3300048924 Bacteria 957
241 Ga0496126_0003943 3300048929 Bacteria 18161
242 Ga0496126_1039666 3300048929 Unclassified 612
243 Ga0501072_0397310 3300049588 Bacteria 1094
244 nmdc:mga06r32_683521_c1 3300050510 Bacteria 993
245 nmdc:mga08y16_606131_c1 3300050511 Bacteria 1103
246 nmdc:mga0n895_430026_c1 3300050512 Bacteria 1334
247 nmdc:mga0rr50_63408_c1 3300050513 Bacteria 2791
248 nmdc:mga08x19_216866_c1 3300050514 Bacteria 1314
249 Ga0500572_006349 3300053111 Bacteria 2705
250 Ga0500622_0308858 3300053156 Bacteria 670
251 Ga0500636_0252606 3300053177 Bacteria 898
252 Ga0070709_10397932
253 Ga0070676_10435646
254 Ga0070690_100369480
255 Ga0070680_100090527
256 Ga0070680_101087626
257 Ga0070689_100609195
258 Ga0070689_102149608
259 Ga0070687_101275375
260 Ga0070668_100028245
261 Ga0070669_100240612
262 Ga0070669_101009786
263 Ga0070675_100147163
264 Ga0070671_100620319
265 Ga0070674_100124323
266 Ga0070667_100288088
267 Ga0070709_10002859
268 Ga0070709_11414649
269 Ga0070714_100006647
270 Ga0070714_100572593
271 Ga0070713_100063751
272 Ga0070713_100080423
273 Ga0070713_100653177
274 Ga0070713_100732341
275 Ga0070710_10037931
276 Ga0070701_11027246
277 Ga0070711_100085854
278 Ga0070705_101627038
279 Ga0070694_100235600
280 Ga0070678_100482411
281 Ga0070662_100774104
282 Ga0070685_10349073
283 Ga0070679_100569564
284 Ga0068853_101960240
285 Ga0070672_100348704
286 Ga0070672_100890190
287 Ga0070686_101412160
288 Ga0070695_100506044
289 Ga0070696_100000300
290 Ga0070665_100000295
291 Ga0070665_100154438
292 Ga0070704_101518381
293 Ga0068855_100003665
294 Ga0068855_100339267
295 Ga0068855_100485369
296 Ga0068855_100815449
297 Ga0070664_102145373
298 Ga0068857_100420431
299 Ga0068857_101382547
300 Ga0068859_100137854
301 Ga0068859_101215504
302 Ga0068864_101426329
303 Ga0068861_100839337
304 Ga0068863_101407997
305 Ga0068858_100679874
306 Ga0068858_100737243
307 Ga0068860_102649026
308 Ga0068862_100054429
309 Ga0070717_10001293
310 Ga0070717_11477349
311 Ga0070715_10609438
312 Ga0070716_100076471
313 Ga0070712_100130824
314 Ga0075428_100698548
315 Ga0075428_101039288
316 Ga0075430_100157284
317 Ga0075431_101217245
318 Ga0075433_10598476
319 Ga0075434_100426607
320 Ga0075434_102355835
321 Ga0075436_100158114
322 Ga0075436_100431408
323 Ga0097620_100137857
324 Ga0097620_101215374
325 Ga0075435_100082421
326 Ga0099794_10023375
327 Ga0099795_10000210
328 Ga0099795_10422205
329 Ga0105240_10000743
330 Ga0105240_10007617
331 Ga0105240_10017163
332 Ga0105240_10083273
333 Ga0105240_10228940
334 Ga0105240_11570951
335 Ga0111539_10337785
336 Ga0111539_11976258
337 Ga0111539_12555224
338 Ga0105247_10133883
339 Ga0105247_11761512
340 Ga0105243_10042811
341 Ga0105243_11803526
342 Ga0105237_10013864
343 Ga0105237_10047127
344 Ga0105237_10165517
345 Ga0105238_10361694
346 Ga0105249_10144175
347 Ga0105249_10480362
348 Ga0099796_10033157
349 Ga0099796_10330656
350 Ga0105239_10685335
351 Ga0157370_10247146
352 Ga0157370_10333264
353 Ga0157370_10390291
354 Ga0157369_10013463
355 Ga0157369_10325618
356 Ga0157369_10878705
357 Ga0157374_10370829
358 Ga0163162_11843513
359 Ga0163162_13145648
360 Ga0157372_10025776
361 Ga0157372_10429151
362 Ga0163163_11858642
363 Ga0157380_10010294
364 Ga0157380_11163845
365 Ga0157380_13088235
366 Ga0157377_10404262
367 Ga0157379_10127571
368 Ga0157379_10166232
369 Ga0206356_10464472
370 Ga0207692_10047907
371 Ga0207710_10247913
372 Ga0207685_10109632
373 Ga0207699_10011485
374 Ga0207699_10877004
375 Ga0207645_10345021
376 Ga0207645_10921408
377 Ga0207707_10054840
378 Ga0207707_10197086
379 Ga0207695_10019327
380 Ga0207695_10041769
381 Ga0207695_10042013
382 Ga0207695_10044209
383 Ga0207695_10048285
384 Ga0207695_10464408
385 Ga0207695_11062383
386 Ga0207693_10185990
387 Ga0207663_10258673
388 Ga0207660_10449132
389 Ga0207652_11481125
390 Ga0207681_10034540
391 Ga0207681_10986049
392 Ga0207694_10515419
393 Ga0207694_10841681
394 Ga0207650_10786573
395 Ga0207659_10100736
396 Ga0207659_10773128
397 Ga0207700_10048251
398 Ga0207700_10108496
399 Ga0207700_10285843
400 Ga0207700_11278015
401 Ga0207664_10095073
402 Ga0207670_11086241
403 Ga0207669_10220396
404 Ga0207704_10019860
405 Ga0207665_10062781
406 Ga0207691_10191703
407 Ga0207691_10223609
408 Ga0207679_11844940
409 Ga0207667_10007385
410 Ga0207667_10059673
411 Ga0207667_10100614
412 Ga0207667_10652426
413 Ga0207651_10171587
414 Ga0207712_10177988
415 Ga0207668_10193085
416 Ga0207668_10281479
417 Ga0207640_11518529
418 Ga0207658_10572323
419 Ga0207703_10178169
420 Ga0207703_10979423
421 Ga0207639_11987074
422 Ga0207641_11564166
423 Ga0207648_12039525
424 Ga0207676_10044571
425 Ga0207674_10252167
426 Ga0207675_101238769
427 Ga0207683_10729861
428 Ga0207698_10436424
429 Ga0209588_1027650
430 Ga0265356_1000887
431 Ga0268266_10130177
432 Ga0268265_10162701
433 Ga0268265_10528830
434 Ga0268265_10702539
435 Ga0268264_11166595
436 Ga0265334_10010738
437 Ga0265338_10042295
438 Ga0265328_10010986
439 Ga0265340_10072207
440 Ga0265331_10003079
441 Ga0265316_11298035
442 Ga0307415_101711389
443 Ga0373955_0175373
444 Ga0373924_0182851
445 Ga0373931_0879961
446 Ga0373927_0337411
447 Ga0373933_0302613
448 Ga0373947_1194417
449 Ga0373937_0012119
450 Ga0436360_1131244
451 Ga0436361_0257140
452 Ga0436361_0636321
453 Ga0436361_0636991
454 Ga0436361_1164277
455 Ga0451577_0170444
456 Ga0451577_0245750
457 Ga0466972_0265558
458 Ga0453684_0142210
459 Ga0453684_1140554
460 Ga0453684_2303469
461 Ga0466971_0370354
462 Ga0466970_0151829
463 Ga0466959_0007699
464 Ga0466959_0085527
465 Ga0466959_0998391
466 Ga0451576_0385373
467 Ga0451576_0672354
468 Ga0451576_1437476
469 Ga0495638_0067293
470 Ga0495580_0048367
471 Ga0495580_0279979
472 Ga0495630_0510431
473 Ga0495645_0314803
474 Ga0495657_0084384
475 Ga0495604_0078155
476 Ga0495672_0008372
477 Ga0495675_0223817
478 Ga0495686_0347594
479 Ga0495602_0161442
480 Ga0496100_0171885
481 Ga0496101_0071032
482 Ga0496102_1415205
483 Ga0496104_0097374
484 Ga0496105_0070643
485 Ga0496106_0129778
486 Ga0496109_0638856
487 Ga0496110_1006115
488 Ga0496112_0320371
489 Ga0496115_0287525
490 Ga0496119_0158287
491 Ga0496121_0365059
492 Ga0496126_0003943
493 Ga0496126_1039666
494 Ga0501072_0397310
495 nmdc:mga06r32_683521_c1
496 nmdc:mga08y16_606131_c1
497 nmdc:mga0n895_430026_c1
498 nmdc:mga0rr50_63408_c1
499 nmdc:mga08x19_216866_c1
500 Ga0500572_006349
501 Ga0500622_0308858
502 Ga0500636_0252606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04267

SoxD

Sarcosine oxidase, delta subunit family

3

84

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f8e-assembly2.cif.gz_B crystal structure of the wdr domain of human dcaf1 in complex with oicr-8268 compound 0.8293 52 83
7sse-assembly1.cif.gz_A crystal structure of the wdr domain of human dcaf1 in complex with cyca-117-70 0.8045 50 83
5aja-assembly1.cif.gz_A crystal structure of mandrill samhd1 (amino acid residues 1-114) bound to vpx isolated from mandrill and human dcaf1 (amino acid residues 1058-1396) 0.8038 52 83
5vlj-assembly1.cif.gz_B cryo-em structure of yeast cytoplasmic dynein with walker b mutation at aaa3 in presence of atp-vo4 0.8007 52 83
7s23-assembly2.cif.gz_B crystal structure of alpha-cop-wd40 domain, y139a mutant 0.7886 50 83
ID Description Score Start End Superfamily
af_Q4E087_7_130_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8385 52 83 2.130.10.10
af_I1LVQ3_371_670_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8354 51 81 2.130.10.10
af_Q6ZPG2_936_1067_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8272 51 83 2.130.10.10
af_Q9W235_31_265_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.817 52 81 2.130.10.10
af_O53405_9_231_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8141 52 84 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A534AR77-F1-model_v4 Sarcosine oxidase subunit delta 0.8635 50 92 GO:0008115
GO:0046653
AF-A0A534AR77-F1-model_v4 Sarcosine oxidase subunit delta 0.8473 50 92 GO:0008115
GO:0046653
AF-A0A435X650-F1-model_v4 deleted 0.8053 49 93
AF-A0A7V9H6T0-F1-model_v4 Sarcosine oxidase subunit delta 0.7862 50 95 GO:0008115
GO:0046653
AF-A0A538RY29-F1-model_v4 Sarcosine oxidase subunit delta 0.7555 2 88 GO:0008115
GO:0046653

Map