F362191

General Info

Members Datasets Scaffolds Average Seq Length
251 170 250 144

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10243804|Ga0070692_102438041
Length 156
Sequence MTSRRSAAPDMNMEERIHDYIAGQPERKRDDMRALHRLILQVSPDCALWFLDGKDDEGKTISNNPNIGYGRQPIRYAGGKSREFYRIGLSANTTGLSIYIIGIEDKKYLAEAYGQRLGKASVTGYCIKFRTLSDIDRGVLEEAIRFGFEARNETQA

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
155 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
156 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
157 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
166 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.36
Nodule 0
Rhizoplane 1.2
Rhizosphere 82.47
Stem 0
Stem Tuber 0
Unclassified 5.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10007462 3300001989 Bacteria 4102
2 JGI25162J39368_1002277 3300002737 Bacteria 7743
3 JGI25162J39368_1011705 3300002737 Bacteria 1041
4 JGI25164J39214_1000784 3300002772 Bacteria 11493
5 JGI25165J46597_1001820 3300003214 Bacteria 8933
6 JGI25165J46597_1002311 3300003214 Bacteria 6492
7 JGI25165J46597_1012208 3300003214 Bacteria 1207
8 rootH2_10024170 3300003320 Bacteria 19128
9 rootH2_10027345 3300003320 Bacteria 2699
10 rootH2_10116827 3300003320 Bacteria 2479
11 rootH1_10174316 3300003323 Bacteria 4135
12 rootH1_10306491 3300003323 Bacteria 1130
13 Ga0065715_10452727 3300005293 Bacteria 815
14 Ga0065715_10573389 3300005293 Bacteria 722
15 Ga0065707_10230928 3300005295 Unclassified 1189
16 Ga0070658_10001115 3300005327 Bacteria 22930
17 Ga0070658_11498447 3300005327 Bacteria 585
18 Ga0070676_10170732 3300005328 Bacteria 1406
19 Ga0070690_100069455 3300005330 Bacteria 2286
20 Ga0068869_100943827 3300005334 Bacteria 748
21 Ga0070666_10020331 3300005335 Bacteria 4291
22 Ga0070666_10152366 3300005335 Bacteria 1613
23 Ga0070666_11514422 3300005335 Bacteria 502
24 Ga0070682_100856973 3300005337 Bacteria 743
25 Ga0068868_100011667 3300005338 Bacteria 6400
26 Ga0068868_100076905 3300005338 Bacteria 2669
27 Ga0070660_100089663 3300005339 Bacteria 2423
28 Ga0070687_100076261 3300005343 Bacteria 1815
29 Ga0070692_10243804 3300005345 Bacteria 1072
30 Ga0070668_100232823 3300005347 Bacteria 1523
31 Ga0070668_100788693 3300005347 Bacteria 843
32 Ga0070669_100002975 3300005353 Bacteria 12214
33 Ga0070675_100747141 3300005354 Bacteria 892
34 Ga0070674_100048788 3300005356 Bacteria 2907
35 Ga0070674_101380682 3300005356 Unclassified 630
36 Ga0070673_100002890 3300005364 Bacteria 10572
37 Ga0070659_101409062 3300005366 Bacteria 620
38 Ga0070713_100075031 3300005436 Bacteria 2867
39 Ga0070678_100259620 3300005456 Bacteria 1460
40 Ga0070662_100917433 3300005457 Bacteria 748
41 Ga0070662_101160155 3300005457 Bacteria 663
42 Ga0068867_101688847 3300005459 Bacteria 593
43 Ga0070707_100826500 3300005468 Bacteria 890
44 Ga0070684_100898049 3300005535 Bacteria 830
45 Ga0068853_100416315 3300005539 Bacteria 1260
46 Ga0068853_100818889 3300005539 Bacteria 892
47 Ga0068853_100841043 3300005539 Bacteria 880
48 Ga0070672_100034125 3300005543 Bacteria 3860
49 Ga0070672_100947610 3300005543 Bacteria 761
50 Ga0070686_100418669 3300005544 Bacteria 1023
51 Ga0070665_100000017 3300005548 Bacteria 448013
52 Ga0070665_100982579 3300005548 Bacteria 856
53 Ga0070704_101027078 3300005549 Bacteria 746
54 Ga0068855_100044241 3300005563 Bacteria 5270
55 Ga0068855_100159745 3300005563 Bacteria 2559
56 Ga0068855_100448626 3300005563 Bacteria 1408
57 Ga0068854_100876874 3300005578 Bacteria 787
58 Ga0068854_101017128 3300005578 Bacteria 734
59 Ga0068854_101133891 3300005578 Bacteria 698
60 Ga0068856_100051606 3300005614 Bacteria 4055
61 Ga0068852_100028241 3300005616 Bacteria 4588
62 Ga0068852_101535586 3300005616 Bacteria 688
63 Ga0068859_100006660 3300005617 Bacteria 11729
64 Ga0068859_102037660 3300005617 Bacteria 634
65 Ga0068866_10551452 3300005718 Bacteria 771
66 Ga0068870_10029349 3300005840 Bacteria 2769
67 Ga0068858_100377839 3300005842 Bacteria 1359
68 Ga0068858_100728302 3300005842 Bacteria 966
69 Ga0068860_101354335 3300005843 Bacteria 733
70 Ga0075365_11004447 3300006038 Unclassified 588
71 Ga0075370_10427237 3300006353 Bacteria 796
72 Ga0068871_101278476 3300006358 Bacteria 690
73 Ga0068865_100000107 3300006881 Bacteria 43014
74 Ga0068865_100017689 3300006881 Bacteria 4588
75 Ga0097620_100006660 3300006931 Bacteria 11729
76 Ga0097620_102037622 3300006931 Bacteria 634
77 Ga0105240_10001376 3300009093 Bacteria 41811
78 Ga0105245_10001064 3300009098 Bacteria 24872
79 Ga0105245_10060300 3300009098 Bacteria 3417
80 Ga0105245_10069967 3300009098 Bacteria 3183
81 Ga0105245_10475750 3300009098 Bacteria 1262
82 Ga0105247_11066599 3300009101 Unclassified 635
83 Ga0105243_10326206 3300009148 Bacteria 1401
84 Ga0105243_11072688 3300009148 Bacteria 812
85 Ga0105243_11363769 3300009148 Bacteria 728
86 Ga0105241_10022398 3300009174 Bacteria 4680
87 Ga0105241_10124079 3300009174 Bacteria 2083
88 Ga0105241_10862183 3300009174 Bacteria 838
89 Ga0105242_10009079 3300009176 Bacteria 7636
90 Ga0105248_10000003 3300009177 Bacteria 1019601
91 Ga0105237_10063659 3300009545 Bacteria 3686
92 Ga0105237_10199168 3300009545 Bacteria 2002
93 Ga0105237_11077178 3300009545 Bacteria 810
94 Ga0105238_12472613 3300009551 Bacteria 555
95 Ga0105239_10036854 3300010375 Bacteria 5365
96 Ga0105239_10273828 3300010375 Bacteria 1899
97 Ga0105239_12086342 3300010375 Unclassified 659
98 Ga0105246_11078711 3300011119 Bacteria 732
99 Ga0157371_10063821 3300013102 Bacteria 2611
100 Ga0157374_10337641 3300013296 Bacteria 1495
101 Ga0157374_10584920 3300013296 Bacteria 1126
102 Ga0157378_10049668 3300013297 Bacteria 3732
103 Ga0157378_10088169 3300013297 Bacteria 2816
104 Ga0163162_10000051 3300013306 Bacteria 117695
105 Ga0163162_10426806 3300013306 Bacteria 1458
106 Ga0163162_11016749 3300013306 Bacteria 937
107 Ga0163162_12075181 3300013306 Unclassified 652
108 Ga0157372_10135437 3300013307 Bacteria 2836
109 Ga0157372_10201603 3300013307 Bacteria 2305
110 Ga0157372_10227783 3300013307 Bacteria 2161
111 Ga0157375_10038419 3300013308 Bacteria 4597
112 Ga0163163_10648503 3300014325 Unclassified 1119
113 Ga0163163_10672000 3300014325 Bacteria 1099
114 Ga0157380_10848784 3300014326 Bacteria 935
115 Ga0157377_10102480 3300014745 Bacteria 1708
116 Ga0157379_10546093 3300014968 Bacteria 1078
117 Ga0157379_10853256 3300014968 Bacteria 862
118 Ga0157376_11304441 3300014969 Bacteria 756
119 Ga0163161_10696972 3300017792 Bacteria 845
120 Ga0213876_10023427 3300021384 Unclassified 3262
121 Ga0207427_100305 3300025231 Bacteria 34164
122 Ga0207427_106624 3300025231 Bacteria 1446
123 Ga0209437_100020 3300025233 Bacteria 656374
124 Ga0209437_106725 3300025233 Bacteria 1902
125 Ga0209129_1014434 3300025258 Bacteria 1683
126 Ga0209233_1000020 3300025261 Bacteria 798224
127 Ga0209233_1017626 3300025261 Bacteria 1941
128 Ga0209564_1008284 3300025295 Bacteria 5157
129 Ga0207697_10067995 3300025315 Bacteria 1490
130 Ga0207642_10076879 3300025899 Bacteria 1608
131 Ga0207642_10746548 3300025899 Bacteria 619
132 Ga0207688_10031111 3300025901 Bacteria 2945
133 Ga0207680_10285590 3300025903 Bacteria 1147
134 Ga0207680_10905720 3300025903 Bacteria 632
135 Ga0207647_10403591 3300025904 Bacteria 770
136 Ga0207647_10408347 3300025904 Bacteria 764
137 Ga0207645_10000088 3300025907 Bacteria 65894
138 Ga0207645_10255928 3300025907 Bacteria 1159
139 Ga0207643_10013068 3300025908 Bacteria 4489
140 Ga0207705_10001091 3300025909 Bacteria 22077
141 Ga0207705_10347003 3300025909 Bacteria 1143
142 Ga0207705_10901012 3300025909 Bacteria 685
143 Ga0207654_10074563 3300025911 Bacteria 2025
144 Ga0207654_10081055 3300025911 Bacteria 1953
145 Ga0207695_10014944 3300025913 Bacteria 9161
146 Ga0207695_10048081 3300025913 Bacteria 4508
147 Ga0207671_10005868 3300025914 Bacteria 11154
148 Ga0207662_10095353 3300025918 Bacteria 1836
149 Ga0207657_10005269 3300025919 Bacteria 13547
150 Ga0207657_10662294 3300025919 Unclassified 812
151 Ga0207646_10807298 3300025922 Bacteria 835
152 Ga0207687_10012337 3300025927 Bacteria 5587
153 Ga0207687_10280352 3300025927 Unclassified 1335
154 Ga0207706_10267354 3300025933 Bacteria 1493
155 Ga0207706_10286628 3300025933 Bacteria 1436
156 Ga0207706_11353009 3300025933 Bacteria 586
157 Ga0207686_10058490 3300025934 Bacteria 2430
158 Ga0207686_10361910 3300025934 Bacteria 1095
159 Ga0207709_10126179 3300025935 Bacteria 1736
160 Ga0207669_10656570 3300025937 Bacteria 858
161 Ga0207704_10004331 3300025938 Bacteria 6489
162 Ga0207704_11306735 3300025938 Bacteria 620
163 Ga0207691_10009737 3300025940 Bacteria 9223
164 Ga0207691_10873701 3300025940 Unclassified 753
165 Ga0207691_11193220 3300025940 Bacteria 631
166 Ga0207711_10000012 3300025941 Bacteria 515147
167 Ga0207689_10064033 3300025942 Bacteria 3025
168 Ga0207667_10226120 3300025949 Bacteria 1917
169 Ga0207667_10472589 3300025949 Bacteria 1273
170 Ga0207640_10255247 3300025981 Bacteria 1363
171 Ga0207640_10704231 3300025981 Bacteria 866
172 Ga0207640_11203315 3300025981 Bacteria 674
173 Ga0207639_10008741 3300026041 Bacteria 6956
174 Ga0207639_10684359 3300026041 Bacteria 951
175 Ga0207708_10290078 3300026075 Bacteria 1328
176 Ga0207702_10055979 3300026078 Bacteria 3347
177 Ga0207641_10107060 3300026088 Bacteria 2472
178 Ga0207648_10007201 3300026089 Bacteria 10969
179 Ga0207648_10088911 3300026089 Bacteria 2697
180 Ga0207674_10666181 3300026116 Bacteria 1005
181 Ga0207675_100013829 3300026118 Bacteria 7526
182 Ga0207675_100739654 3300026118 Bacteria 994
183 Ga0207683_10032582 3300026121 Bacteria 4527
184 Ga0207698_10470073 3300026142 Bacteria 1218
185 Ga0268266_10000037 3300028379 Bacteria 342368
186 Ga0268264_11060152 3300028381 Bacteria 818
187 Ga0307515_10000019 3300028794 Bacteria 422262
188 Ga0307515_10072720 3300028794 Bacteria 4633
189 Ga0307513_10999184 3300031456 Unclassified 546
190 Ga0307408_100772105 3300031548 Bacteria 870
191 Ga0307405_10078742 3300031731 Bacteria 2146
192 Ga0307406_10098775 3300031901 Bacteria 1983
193 Ga0307409_100143737 3300031995 Unclassified 2060
194 Ga0307411_10484051 3300032005 Bacteria 1043
195 Ga0307510_10023424 3300033180 Bacteria 7158
196 Ga0373935_0939914 3300035692 Bacteria 641
197 Ga0436364_1057197 3300037853 Bacteria 616
198 Ga0436365_1054924 3300039437 Bacteria 11608
199 Ga0436360_0591757 3300039438 Bacteria 1164
200 Ga0436361_0515442 3300039447 Bacteria 980
201 Ga0451853_0013079 3300041512 Bacteria 660
202 Ga0451853_2967229 3300041512 Bacteria 556
203 Ga0466972_0122383 3300044658 Bacteria 1227
204 Ga0466961_0356182 3300044693 Bacteria 890
205 Ga0466964_0196743 3300044706 Bacteria 965
206 Ga0466960_0154025 3300044901 Bacteria 1230
207 Ga0466959_0115539 3300045049 Bacteria 1912
208 Ga0495617_007403 3300046452 Bacteria 3809
209 Ga0495583_0000005 3300046506 Bacteria 636894
210 Ga0495583_0001019 3300046506 Bacteria 31909
211 Ga0495631_0388260 3300046518 Unclassified 594
212 Ga0495640_0382360 3300046533 Bacteria 866
213 Ga0495586_0607556 3300046535 Bacteria 632
214 Ga0495633_0000074 3300046558 Bacteria 130197
215 Ga0495633_0045105 3300046558 Bacteria 2088
216 Ga0495625_0052911 3300046660 Unclassified 2906
217 Ga0495625_0246708 3300046660 Bacteria 1160
218 Ga0495683_0000453 3300047323 Bacteria 32191
219 Ga0496105_0048807 3300048908 Bacteria 3494
220 Ga0496112_0787059 3300048915 Bacteria 876
221 Ga0496114_0592481 3300048917 Bacteria 978
222 Ga0496120_0088951 3300048923 Bacteria 1654
223 Ga0501036_0035915 3300049572 Bacteria 4193
224 Ga0501037_0942648 3300049573 Bacteria 564
225 Ga0501047_0086393 3300049581 Bacteria 3014
226 Ga0501048_0896410 3300049582 Bacteria 638
227 Ga0501070_0111177 3300049586 Bacteria 2264
228 Ga0501073_0008989 3300049589 Bacteria 7379
229 Ga0501073_0121091 3300049589 Bacteria 1813
230 Ga0501074_0029872 3300049590 Bacteria 3949
231 Ga0501074_0125907 3300049590 Bacteria 1832
232 Ga0501222_051012 3300049662 Bacteria 607
233 Ga0501233_100992 3300049668 Bacteria 763
234 Ga0501257_100757 3300049686 Bacteria 758
235 Ga0501234_018299 3300049707 Bacteria 1109
236 Ga0501079_0024261 3300049741 Bacteria 4654
237 Ga0501080_0146281 3300049742 Bacteria 2184
238 Ga0501035_0011210 3300049822 Bacteria 8303
239 nmdc:mga07m45_612106_c1 3300050496 Bacteria 629
240 nmdc:mga0n895_241419_c1 3300050512 Bacteria 1833
241 Ga0500643_019897 3300053087 Bacteria 2204
242 Ga0500644_0043424 3300053088 Bacteria 1504
243 Ga0500646_0088233 3300053090 Unclassified 956
244 Ga0500595_023628 3300053119 Bacteria 2156
245 Ga0500568_0000992 3300053139 Bacteria 19446
246 Ga0500604_0000015 3300053151 Bacteria 92018
247 Ga0500604_0061810 3300053151 Bacteria 1178
248 Ga0500616_0000080 3300053153 Bacteria 200381
249 Ga0500616_0126339 3300053153 Bacteria 1214
250 Ga0501084_1353791 3300054114 Bacteria 596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0048807 Ga0496105_0048807_2004_2417 113
2 3300032005 Ga0307411_10484051 Ga0307411_104840511 137
3 iso_pu_bacteria 2585427687 2586207975 137
4 3300006881 Ga0068865_100000107 Ga0068865_1000001076 139
5 3300014325 Ga0163163_10648503 Ga0163163_106485031 139
6 3300025938 Ga0207704_10004331 Ga0207704_100043315 139
7 3300025940 Ga0207691_10873701 Ga0207691_108737011 139
8 3300026118 Ga0207675_100739654 Ga0207675_1007396542 139
9 3300028794 Ga0307515_10000019 Ga0307515_10000019153 139
10 3300037853 Ga0436364_1057197 Ga0436364_1057197_14_433 139
11 3300044706 Ga0466964_0196743 Ga0466964_0196743_116_559 139
12 3300049572 Ga0501036_0035915 Ga0501036_0035915_2524_2943 139
13 3300049573 Ga0501037_0942648 Ga0501037_0942648_44_463 139
14 3300049581 Ga0501047_0086393 Ga0501047_0086393_2298_2717 139
15 3300049822 Ga0501035_0011210 Ga0501035_0011210_1840_2259 139
16 3300053090 Ga0500646_0088233 Ga0500646_0088233_156_575 139
17 3300053151 Ga0500604_0000015 Ga0500604_0000015_12278_12697 139
18 3300003323 rootH1_10306491 rootH1_103064912 140
19 3300005327 Ga0070658_11498447 Ga0070658_114984471 140
20 3300005539 Ga0068853_100818889 Ga0068853_1008188891 140
21 3300006353 Ga0075370_10427237 Ga0075370_104272372 140
22 3300025909 Ga0207705_10901012 Ga0207705_109010121 140
23 3300026088 Ga0207641_10107060 Ga0207641_101070602 140
24 3300031995 Ga0307409_100143737 Ga0307409_1001437373 140
25 3300041512 Ga0451853_0013079 Ga0451853_0013079_167_589 140
26 3300050496 nmdc:mga07m45_612106_c1 nmdc:mga07m45_612106_c1_195_617 140
27 3300053087 Ga0500643_019897 Ga0500643_019897_1652_2116 140
28 3300053151 Ga0500604_0061810 Ga0500604_0061810_27_449 140
29 3300001989 JGI24739J22299_10007462 JGI24739J22299_100074622 141
30 3300002737 JGI25162J39368_1002277 JGI25162J39368_10022775 141
31 3300002737 JGI25162J39368_1011705 JGI25162J39368_10117052 141
32 3300002772 JGI25164J39214_1000784 JGI25164J39214_10007849 141
33 3300003214 JGI25165J46597_1001820 JGI25165J46597_10018204 141
34 3300003214 JGI25165J46597_1002311 JGI25165J46597_10023115 141
35 3300003214 JGI25165J46597_1012208 JGI25165J46597_10122082 141
36 3300003320 rootH2_10024170 rootH2_1002417014 141
37 3300003320 rootH2_10027345 rootH2_100273454 141
38 3300003320 rootH2_10116827 rootH2_101168272 141
39 3300003323 rootH1_10174316 rootH1_101743165 141
40 3300005293 Ga0065715_10452727 Ga0065715_104527272 141
41 3300005293 Ga0065715_10573389 Ga0065715_105733891 141
42 3300005295 Ga0065707_10230928 Ga0065707_102309282 141
43 3300005327 Ga0070658_10001115 Ga0070658_100011157 141
44 3300005328 Ga0070676_10170732 Ga0070676_101707322 141
45 3300005330 Ga0070690_100069455 Ga0070690_1000694551 141
46 3300005334 Ga0068869_100943827 Ga0068869_1009438271 141
47 3300005335 Ga0070666_10020331 Ga0070666_100203313 141
48 3300005335 Ga0070666_10152366 Ga0070666_101523662 141
49 3300005335 Ga0070666_11514422 Ga0070666_115144221 141
50 3300005337 Ga0070682_100856973 Ga0070682_1008569731 141
51 3300005338 Ga0068868_100011667 Ga0068868_1000116673 141
52 3300005338 Ga0068868_100076905 Ga0068868_1000769054 141
53 3300005339 Ga0070660_100089663 Ga0070660_1000896632 141
54 3300005343 Ga0070687_100076261 Ga0070687_1000762613 141
55 3300005345 Ga0070692_10243804 Ga0070692_102438041 141
56 3300005347 Ga0070668_100232823 Ga0070668_1002328232 141
57 3300005347 Ga0070668_100788693 Ga0070668_1007886932 141
58 3300005353 Ga0070669_100002975 Ga0070669_1000029754 141
59 3300005354 Ga0070675_100747141 Ga0070675_1007471412 141
60 3300005356 Ga0070674_100048788 Ga0070674_1000487884 141
61 3300005356 Ga0070674_101380682 Ga0070674_1013806821 141
62 3300005364 Ga0070673_100002890 Ga0070673_1000028905 141
63 3300005366 Ga0070659_101409062 Ga0070659_1014090622 141
64 3300005436 Ga0070713_100075031 Ga0070713_1000750311 141
65 3300005456 Ga0070678_100259620 Ga0070678_1002596202 141
66 3300005457 Ga0070662_100917433 Ga0070662_1009174331 141
67 3300005457 Ga0070662_101160155 Ga0070662_1011601551 141
68 3300005459 Ga0068867_101688847 Ga0068867_1016888471 141
69 3300005468 Ga0070707_100826500 Ga0070707_1008265002 141
70 3300005535 Ga0070684_100898049 Ga0070684_1008980492 141
71 3300005539 Ga0068853_100416315 Ga0068853_1004163152 141
72 3300005539 Ga0068853_100841043 Ga0068853_1008410431 141
73 3300005543 Ga0070672_100034125 Ga0070672_1000341254 141
74 3300005543 Ga0070672_100947610 Ga0070672_1009476102 141
75 3300005544 Ga0070686_100418669 Ga0070686_1004186692 141
76 3300005548 Ga0070665_100000017 Ga0070665_100000017279 141
77 3300005548 Ga0070665_100982579 Ga0070665_1009825792 141
78 3300005549 Ga0070704_101027078 Ga0070704_1010270782 141
79 3300005563 Ga0068855_100044241 Ga0068855_1000442417 141
80 3300005563 Ga0068855_100159745 Ga0068855_1001597454 141
81 3300005563 Ga0068855_100448626 Ga0068855_1004486263 141
82 3300005578 Ga0068854_100876874 Ga0068854_1008768742 141
83 3300005578 Ga0068854_101017128 Ga0068854_1010171282 141
84 3300005578 Ga0068854_101133891 Ga0068854_1011338911 141
85 3300005614 Ga0068856_100051606 Ga0068856_1000516065 141
86 3300005616 Ga0068852_100028241 Ga0068852_1000282417 141
87 3300005616 Ga0068852_101535586 Ga0068852_1015355862 141
88 3300005617 Ga0068859_100006660 Ga0068859_1000066604 141
89 3300005617 Ga0068859_102037660 Ga0068859_1020376601 141
90 3300005718 Ga0068866_10551452 Ga0068866_105514521 141
91 3300005840 Ga0068870_10029349 Ga0068870_100293492 141
92 3300005842 Ga0068858_100377839 Ga0068858_1003778392 141
93 3300005842 Ga0068858_100728302 Ga0068858_1007283021 141
94 3300005843 Ga0068860_101354335 Ga0068860_1013543351 141
95 3300006038 Ga0075365_11004447 Ga0075365_110044471 141
96 3300006358 Ga0068871_101278476 Ga0068871_1012784761 141
97 3300006881 Ga0068865_100017689 Ga0068865_1000176892 141
98 3300006931 Ga0097620_100006660 Ga0097620_1000066604 141
99 3300006931 Ga0097620_102037622 Ga0097620_1020376221 141
100 3300009093 Ga0105240_10001376 Ga0105240_1000137633 141
101 3300009098 Ga0105245_10001064 Ga0105245_1000106417 141
102 3300009098 Ga0105245_10060300 Ga0105245_100603002 141
103 3300009098 Ga0105245_10069967 Ga0105245_100699672 141
104 3300009098 Ga0105245_10475750 Ga0105245_104757502 141
105 3300009101 Ga0105247_11066599 Ga0105247_110665991 141
106 3300009148 Ga0105243_10326206 Ga0105243_103262062 141
107 3300009148 Ga0105243_11072688 Ga0105243_110726881 141
108 3300009148 Ga0105243_11363769 Ga0105243_113637692 141
109 3300009174 Ga0105241_10022398 Ga0105241_100223982 141
110 3300009174 Ga0105241_10124079 Ga0105241_101240792 141
111 3300009174 Ga0105241_10862183 Ga0105241_108621832 141
112 3300009176 Ga0105242_10009079 Ga0105242_100090792 141
113 3300009177 Ga0105248_10000003 Ga0105248_10000003122 141
114 3300009545 Ga0105237_10063659 Ga0105237_100636595 141
115 3300009545 Ga0105237_10199168 Ga0105237_101991681 141
116 3300009545 Ga0105237_11077178 Ga0105237_110771782 141
117 3300009551 Ga0105238_12472613 Ga0105238_124726131 141
118 3300010375 Ga0105239_10036854 Ga0105239_100368545 141
119 3300010375 Ga0105239_10273828 Ga0105239_102738283 141
120 3300010375 Ga0105239_12086342 Ga0105239_120863421 141
121 3300011119 Ga0105246_11078711 Ga0105246_110787111 141
122 3300013102 Ga0157371_10063821 Ga0157371_100638212 141
123 3300013296 Ga0157374_10337641 Ga0157374_103376411 141
124 3300013296 Ga0157374_10584920 Ga0157374_105849202 141
125 3300013297 Ga0157378_10049668 Ga0157378_100496683 141
126 3300013297 Ga0157378_10088169 Ga0157378_100881693 141
127 3300013306 Ga0163162_10000051 Ga0163162_1000005113 141
128 3300013306 Ga0163162_10426806 Ga0163162_104268063 141
129 3300013306 Ga0163162_11016749 Ga0163162_110167491 141
130 3300013306 Ga0163162_12075181 Ga0163162_120751811 141
131 3300013307 Ga0157372_10135437 Ga0157372_101354373 141
132 3300013307 Ga0157372_10201603 Ga0157372_102016032 141
133 3300013307 Ga0157372_10227783 Ga0157372_102277832 141
134 3300013308 Ga0157375_10038419 Ga0157375_100384191 141
135 3300014325 Ga0163163_10672000 Ga0163163_106720002 141
136 3300014326 Ga0157380_10848784 Ga0157380_108487842 141
137 3300014745 Ga0157377_10102480 Ga0157377_101024802 141
138 3300014968 Ga0157379_10546093 Ga0157379_105460931 141
139 3300014968 Ga0157379_10853256 Ga0157379_108532561 141
140 3300014969 Ga0157376_11304441 Ga0157376_113044411 141
141 3300017792 Ga0163161_10696972 Ga0163161_106969721 141
142 3300021384 Ga0213876_10023427 Ga0213876_100234272 141
143 3300025231 Ga0207427_100305 Ga0207427_10030522 141
144 3300025231 Ga0207427_106624 Ga0207427_1066242 141
145 3300025233 Ga0209437_100020 Ga0209437_10002083 141
146 3300025233 Ga0209437_106725 Ga0209437_1067254 141
147 3300025258 Ga0209129_1014434 Ga0209129_10144342 141
148 3300025261 Ga0209233_1000020 Ga0209233_1000020542 141
149 3300025261 Ga0209233_1017626 Ga0209233_10176264 141
150 3300025295 Ga0209564_1008284 Ga0209564_10082843 141
151 3300025315 Ga0207697_10067995 Ga0207697_100679952 141
152 3300025899 Ga0207642_10076879 Ga0207642_100768791 141
153 3300025899 Ga0207642_10746548 Ga0207642_107465482 141
154 3300025901 Ga0207688_10031111 Ga0207688_100311112 141
155 3300025903 Ga0207680_10285590 Ga0207680_102855902 141
156 3300025903 Ga0207680_10905720 Ga0207680_109057201 141
157 3300025904 Ga0207647_10403591 Ga0207647_104035911 141
158 3300025904 Ga0207647_10408347 Ga0207647_104083471 141
159 3300025907 Ga0207645_10000088 Ga0207645_1000008849 141
160 3300025907 Ga0207645_10255928 Ga0207645_102559282 141
161 3300025908 Ga0207643_10013068 Ga0207643_100130683 141
162 3300025909 Ga0207705_10001091 Ga0207705_1000109117 141
163 3300025909 Ga0207705_10347003 Ga0207705_103470032 141
164 3300025911 Ga0207654_10074563 Ga0207654_100745631 141
165 3300025911 Ga0207654_10081055 Ga0207654_100810551 141
166 3300025913 Ga0207695_10014944 Ga0207695_100149444 141
167 3300025913 Ga0207695_10048081 Ga0207695_100480816 141
168 3300025914 Ga0207671_10005868 Ga0207671_100058686 141
169 3300025918 Ga0207662_10095353 Ga0207662_100953531 141
170 3300025919 Ga0207657_10005269 Ga0207657_100052698 141
171 3300025919 Ga0207657_10662294 Ga0207657_106622942 141
172 3300025922 Ga0207646_10807298 Ga0207646_108072981 141
173 3300025927 Ga0207687_10012337 Ga0207687_100123374 141
174 3300025927 Ga0207687_10280352 Ga0207687_102803522 141
175 3300025933 Ga0207706_10267354 Ga0207706_102673541 141
176 3300025933 Ga0207706_10286628 Ga0207706_102866282 141
177 3300025933 Ga0207706_11353009 Ga0207706_113530091 141
178 3300025934 Ga0207686_10058490 Ga0207686_100584903 141
179 3300025934 Ga0207686_10361910 Ga0207686_103619102 141
180 3300025935 Ga0207709_10126179 Ga0207709_101261791 141
181 3300025937 Ga0207669_10656570 Ga0207669_106565701 141
182 3300025938 Ga0207704_11306735 Ga0207704_113067351 141
183 3300025940 Ga0207691_10009737 Ga0207691_100097378 141
184 3300025940 Ga0207691_11193220 Ga0207691_111932202 141
185 3300025941 Ga0207711_10000012 Ga0207711_10000012300 141
186 3300025942 Ga0207689_10064033 Ga0207689_100640332 141
187 3300025949 Ga0207667_10226120 Ga0207667_102261203 141
188 3300025949 Ga0207667_10472589 Ga0207667_104725892 141
189 3300025981 Ga0207640_10255247 Ga0207640_102552472 141
190 3300025981 Ga0207640_10704231 Ga0207640_107042311 141
191 3300025981 Ga0207640_11203315 Ga0207640_112033151 141
192 3300026041 Ga0207639_10008741 Ga0207639_100087412 141
193 3300026041 Ga0207639_10684359 Ga0207639_106843593 141
194 3300026075 Ga0207708_10290078 Ga0207708_102900782 141
195 3300026078 Ga0207702_10055979 Ga0207702_100559795 141
196 3300026089 Ga0207648_10007201 Ga0207648_100072019 141
197 3300026089 Ga0207648_10088911 Ga0207648_100889114 141
198 3300026116 Ga0207674_10666181 Ga0207674_106661811 141
199 3300026118 Ga0207675_100013829 Ga0207675_1000138292 141
200 3300026121 Ga0207683_10032582 Ga0207683_100325824 141
201 3300026142 Ga0207698_10470073 Ga0207698_104700732 141
202 3300028379 Ga0268266_10000037 Ga0268266_1000003738 141
203 3300028381 Ga0268264_11060152 Ga0268264_110601521 141
204 3300028794 Ga0307515_10072720 Ga0307515_100727203 141
205 3300031456 Ga0307513_10999184 Ga0307513_109991841 141
206 3300031548 Ga0307408_100772105 Ga0307408_1007721052 141
207 3300031731 Ga0307405_10078742 Ga0307405_100787423 141
208 3300031901 Ga0307406_10098775 Ga0307406_100987752 141
209 3300033180 Ga0307510_10023424 Ga0307510_1002342410 141
210 3300035692 Ga0373935_0939914 Ga0373935_0939914_13_459 141
211 3300039437 Ga0436365_1054924 Ga0436365_1054924_10101_10538 141
212 3300039438 Ga0436360_0591757 Ga0436360_0591757_321_761 141
213 3300039447 Ga0436361_0515442 Ga0436361_0515442_163_660 141
214 3300041512 Ga0451853_2967229 Ga0451853_2967229_41_487 141
215 3300044658 Ga0466972_0122383 Ga0466972_0122383_701_1132 141
216 3300044693 Ga0466961_0356182 Ga0466961_0356182_22_453 141
217 3300044901 Ga0466960_0154025 Ga0466960_0154025_115_546 141
218 3300045049 Ga0466959_0115539 Ga0466959_0115539_1445_1876 141
219 3300046452 Ga0495617_007403 Ga0495617_007403_688_1113 141
220 3300046506 Ga0495583_0000005 Ga0495583_0000005_255877_256317 141
221 3300046506 Ga0495583_0001019 Ga0495583_0001019_29054_29479 141
222 3300046518 Ga0495631_0388260 Ga0495631_0388260_31_456 141
223 3300046533 Ga0495640_0382360 Ga0495640_0382360_33_479 141
224 3300046535 Ga0495586_0607556 Ga0495586_0607556_146_592 141
225 3300046558 Ga0495633_0000074 Ga0495633_0000074_116380_116811 141
226 3300046558 Ga0495633_0045105 Ga0495633_0045105_1365_1790 141
227 3300046660 Ga0495625_0052911 Ga0495625_0052911_608_1033 141
228 3300046660 Ga0495625_0246708 Ga0495625_0246708_294_740 141
229 3300047323 Ga0495683_0000453 Ga0495683_0000453_27150_27575 141
230 3300048915 Ga0496112_0787059 Ga0496112_0787059_276_719 141
231 3300048917 Ga0496114_0592481 Ga0496114_0592481_35_532 141
232 3300048923 Ga0496120_0088951 Ga0496120_0088951_885_1319 141
233 3300049582 Ga0501048_0896410 Ga0501048_0896410_53_478 141
234 3300049586 Ga0501070_0111177 Ga0501070_0111177_1648_2073 141
235 3300049589 Ga0501073_0008989 Ga0501073_0008989_3289_3714 141
236 3300049589 Ga0501073_0121091 Ga0501073_0121091_1076_1501 141
237 3300049590 Ga0501074_0029872 Ga0501074_0029872_315_740 141
238 3300049590 Ga0501074_0125907 Ga0501074_0125907_1094_1519 141
239 3300049662 Ga0501222_051012 Ga0501222_051012_23_457 141
240 3300049668 Ga0501233_100992 Ga0501233_100992_59_493 141
241 3300049686 Ga0501257_100757 Ga0501257_100757_200_634 141
242 3300049707 Ga0501234_018299 Ga0501234_018299_261_695 141
243 3300049741 Ga0501079_0024261 Ga0501079_0024261_654_1079 141
244 3300049742 Ga0501080_0146281 Ga0501080_0146281_1511_1936 141
245 3300050512 nmdc:mga0n895_241419_c1 nmdc:mga0n895_241419_c1_694_1206 141
246 3300053088 Ga0500644_0043424 Ga0500644_0043424_287_721 141
247 3300053119 Ga0500595_023628 Ga0500595_023628_1380_1814 141
248 3300053139 Ga0500568_0000992 Ga0500568_0000992_14870_15313 141
249 3300053153 Ga0500616_0000080 Ga0500616_0000080_114990_115433 141
250 3300053153 Ga0500616_0126339 Ga0500616_0126339_759_1184 141
251 3300054114 Ga0501084_1353791 Ga0501084_1353791_26_451 141

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7564 9 137
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6546 9 137
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.645 22 138
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.5524 22 138
3a8u-assembly1.cif.gz_X crystal structure of omega-amino acid:pyruvate aminotransferase 0.5468 75 141
ID Description Score Start End Superfamily
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7451 9 137 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6887 9 137 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6177 5 138 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.5858 5 138 3.90.1150.200
af_Q54J48_8_246_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.5703 53 81 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7W5Q1R6-F1-model_v4 YdhG-like domain-containing protein 0.9909 1 139
AF-A0A4Q3UIT9-F1-model_v4 DUF1801 domain-containing protein 0.9855 1 139
AF-A0A6B8RMY4-F1-model_v4 DUF1801 domain-containing protein 0.9837 1 138
AF-A0A1H6JFL5-F1-model_v4 Uncharacterized protein 0.9801 1 138
AF-A0A4Q3UIT9-F1-model_v4 DUF1801 domain-containing protein 0.9785 1 139

Feature Viewer

pLDDT pTM Quality
95.43 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map