F361543
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 188 | 241 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10171835|Ga0105238_101718352 |
| Length | 348 |
| Sequence | MVAWASIILRNKSTDMKYRQLGKTGEKLSAIGLGCMGMSHAYGAVDDGESIATLNRALELGINFWDTADMYGNGVNEKLISQVLGARRKDVFIATKFGFRFKGDSAGFSTSPGVYLDASPEWIKEAVELSLKRLRIDVIDLYYAHRVDPNVPIEETVGAMARLVDEGKVRYIGLSEASAATIRKAHAVHPVSALQTEYSVMTRDVEGEILSTTRELGISLVAYSPLGRGLVTNTLDVQSLGEGDFRKTLPRFSGENLEKNEAVTRAFAAMAEGKGCTASQLALAWVLGKGEDIIPIPGTKRRKYLEENAKAVELSLSAADMSAIDGLFDRDSISGQRYLETSMKMLNH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 2 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 3 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 4 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 5 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 6 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 7 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 8 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 9 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 93 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 101 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 102 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 103 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 104 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 111 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 112 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 115 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 116 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 117 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 118 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 119 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 183 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 184 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 185 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 186 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 187 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.4 |
| Metatranscriptomes | 2 |
| Isolates | 3.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.2 |
| Nodule | 0.8 |
| Rhizoplane | 0.8 |
| Rhizosphere | 89.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000118 | 3300002737 | Bacteria | 87343 |
| 2 | Ga0006556J51387_1003372 | 3300003479 | Eukaryota | 1526 |
| 3 | Ga0007409J51694_1032653 | 3300003575 | Eukaryota | 1410 |
| 4 | Ga0065715_10242372 | 3300005293 | Bacteria | 1194 |
| 5 | Ga0070658_10000017 | 3300005327 | Bacteria | 223560 |
| 6 | Ga0070658_10004001 | 3300005327 | Bacteria | 12081 |
| 7 | Ga0070658_10124349 | 3300005327 | Bacteria | 2146 |
| 8 | Ga0070683_100000006 | 3300005329 | Bacteria | 361071 |
| 9 | Ga0070670_100087258 | 3300005331 | Bacteria | 2681 |
| 10 | Ga0070666_10012493 | 3300005335 | Bacteria | 5359 |
| 11 | Ga0070666_10250260 | 3300005335 | Bacteria | 1255 |
| 12 | Ga0070680_100007849 | 3300005336 | Bacteria | 8137 |
| 13 | Ga0070682_100055752 | 3300005337 | Bacteria | 2483 |
| 14 | Ga0070661_100128517 | 3300005344 | Bacteria | 1902 |
| 15 | Ga0070669_100032725 | 3300005353 | Bacteria | 3756 |
| 16 | Ga0070675_100183425 | 3300005354 | Bacteria | 1810 |
| 17 | Ga0070671_100003603 | 3300005355 | Bacteria | 12114 |
| 18 | Ga0070674_100014799 | 3300005356 | Bacteria | 4854 |
| 19 | Ga0070673_100512853 | 3300005364 | Bacteria | 1086 |
| 20 | Ga0070688_100080456 | 3300005365 | Bacteria | 2107 |
| 21 | Ga0070667_100140994 | 3300005367 | Bacteria | 2111 |
| 22 | Ga0070713_100490427 | 3300005436 | Bacteria | 1158 |
| 23 | Ga0070698_100009259 | 3300005471 | Bacteria | 10565 |
| 24 | Ga0070679_100013484 | 3300005530 | Bacteria | 7827 |
| 25 | Ga0070679_100071702 | 3300005530 | Bacteria | 3455 |
| 26 | Ga0070684_100000064 | 3300005535 | Bacteria | 68614 |
| 27 | Ga0070697_100130270 | 3300005536 | Bacteria | 2109 |
| 28 | Ga0070665_100021347 | 3300005548 | Bacteria | 6513 |
| 29 | Ga0070665_100033876 | 3300005548 | Bacteria | 5138 |
| 30 | Ga0068855_100062757 | 3300005563 | Bacteria | 4337 |
| 31 | Ga0068855_100126512 | 3300005563 | Bacteria | 2921 |
| 32 | Ga0068855_100297137 | 3300005563 | Bacteria | 1789 |
| 33 | Ga0068857_100105106 | 3300005577 | Bacteria | 2535 |
| 34 | Ga0068859_100170598 | 3300005617 | Bacteria | 2256 |
| 35 | Ga0068864_100016174 | 3300005618 | Bacteria | 6209 |
| 36 | Ga0068861_100055060 | 3300005719 | Bacteria | 3032 |
| 37 | Ga0068863_100137128 | 3300005841 | Bacteria | 2338 |
| 38 | Ga0068862_100010950 | 3300005844 | Bacteria | 7489 |
| 39 | Ga0081538_10019339 | 3300005981 | Bacteria | 5066 |
| 40 | Ga0081540_1001026 | 3300005983 | Bacteria | 25025 |
| 41 | Ga0070717_10010371 | 3300006028 | Bacteria | 7032 |
| 42 | Ga0097620_100170607 | 3300006931 | Bacteria | 2256 |
| 43 | Ga0097620_100184217 | 3300006931 | Bacteria | 2171 |
| 44 | Ga0105240_10000008 | 3300009093 | Bacteria | 618862 |
| 45 | Ga0105240_10000326 | 3300009093 | Bacteria | 89982 |
| 46 | Ga0105240_10000413 | 3300009093 | Bacteria | 79609 |
| 47 | Ga0105247_10004592 | 3300009101 | Bacteria | 8803 |
| 48 | Ga0114129_10013974 | 3300009147 | Bacteria | 11439 |
| 49 | Ga0105248_10335063 | 3300009177 | Bacteria | 1704 |
| 50 | Ga0105248_10358113 | 3300009177 | Bacteria | 1643 |
| 51 | Ga0105237_10000046 | 3300009545 | Bacteria | 168707 |
| 52 | Ga0105237_10050432 | 3300009545 | Bacteria | 4182 |
| 53 | Ga0105237_10069814 | 3300009545 | Bacteria | 3509 |
| 54 | Ga0105238_10006035 | 3300009551 | Bacteria | 12012 |
| 55 | Ga0105238_10171835 | 3300009551 | Bacteria | 2143 |
| 56 | Ga0105238_10376459 | 3300009551 | Bacteria | 1411 |
| 57 | Ga0105249_10016935 | 3300009553 | Bacteria | 6467 |
| 58 | Ga0105239_10000645 | 3300010375 | Bacteria | 49516 |
| 59 | Ga0105239_10003788 | 3300010375 | Bacteria | 18408 |
| 60 | Ga0105239_10005275 | 3300010375 | Bacteria | 15191 |
| 61 | Ga0105239_10014823 | 3300010375 | Bacteria | 8645 |
| 62 | Ga0105239_10016624 | 3300010375 | Bacteria | 8134 |
| 63 | Ga0105239_10044510 | 3300010375 | Bacteria | 4865 |
| 64 | Ga0105239_10073016 | 3300010375 | Bacteria | 3773 |
| 65 | Ga0105246_10000119 | 3300011119 | Bacteria | 35825 |
| 66 | Ga0157370_10301711 | 3300013104 | Bacteria | 1478 |
| 67 | Ga0157369_10080984 | 3300013105 | Bacteria | 3475 |
| 68 | Ga0157369_10297771 | 3300013105 | Bacteria | 1678 |
| 69 | Ga0157374_10070813 | 3300013296 | Bacteria | 3286 |
| 70 | Ga0157378_10269316 | 3300013297 | Bacteria | 1637 |
| 71 | Ga0157375_10013726 | 3300013308 | Bacteria | 7221 |
| 72 | Ga0157380_10153673 | 3300014326 | Bacteria | 1992 |
| 73 | Ga0157377_10011614 | 3300014745 | Bacteria | 4402 |
| 74 | Ga0157379_10352936 | 3300014968 | Bacteria | 1347 |
| 75 | Ga0157376_10015169 | 3300014969 | Bacteria | 5812 |
| 76 | Ga0182005_1000093 | 3300015265 | Bacteria | 67293 |
| 77 | Ga0163161_10021415 | 3300017792 | Bacteria | 4544 |
| 78 | Ga0209437_100102 | 3300025233 | Bacteria | 224216 |
| 79 | Ga0209759_1012693 | 3300025256 | Bacteria | 2319 |
| 80 | Ga0209051_1027994 | 3300025303 | Bacteria | 2235 |
| 81 | Ga0207680_10046481 | 3300025903 | Bacteria | 2566 |
| 82 | Ga0207647_10086186 | 3300025904 | Bacteria | 1877 |
| 83 | Ga0207705_10000020 | 3300025909 | Bacteria | 311745 |
| 84 | Ga0207707_10173754 | 3300025912 | Bacteria | 1882 |
| 85 | Ga0207695_10000021 | 3300025913 | Bacteria | 679399 |
| 86 | Ga0207695_10000039 | 3300025913 | Bacteria | 454801 |
| 87 | Ga0207695_10002791 | 3300025913 | Bacteria | 25413 |
| 88 | Ga0207695_10008936 | 3300025913 | Bacteria | 12471 |
| 89 | Ga0207671_10000268 | 3300025914 | Bacteria | 77496 |
| 90 | Ga0207660_10144758 | 3300025917 | Bacteria | 1820 |
| 91 | Ga0207649_10095445 | 3300025920 | Bacteria | 1957 |
| 92 | Ga0207694_10011792 | 3300025924 | Bacteria | 6594 |
| 93 | Ga0207711_10047180 | 3300025941 | Bacteria | 3682 |
| 94 | Ga0207711_10122225 | 3300025941 | Bacteria | 2326 |
| 95 | Ga0207661_10000011 | 3300025944 | Bacteria | 361200 |
| 96 | Ga0207667_10104733 | 3300025949 | Bacteria | 2918 |
| 97 | Ga0207651_10276744 | 3300025960 | Bacteria | 1385 |
| 98 | Ga0207712_10103539 | 3300025961 | Bacteria | 2121 |
| 99 | Ga0207668_10033030 | 3300025972 | Bacteria | 3426 |
| 100 | Ga0207658_10109495 | 3300025986 | Bacteria | 2181 |
| 101 | Ga0207639_10012286 | 3300026041 | Bacteria | 5963 |
| 102 | Ga0207676_10054800 | 3300026095 | Bacteria | 3126 |
| 103 | Ga0207674_10393661 | 3300026116 | Bacteria | 1339 |
| 104 | Ga0207675_100003894 | 3300026118 | Bacteria | 14510 |
| 105 | Ga0207698_10531157 | 3300026142 | Bacteria | 1150 |
| 106 | Ga0268266_10001615 | 3300028379 | Bacteria | 26291 |
| 107 | Ga0268266_10001974 | 3300028379 | Bacteria | 22989 |
| 108 | Ga0268266_10045853 | 3300028379 | Bacteria | 3742 |
| 109 | Ga0268265_10135050 | 3300028380 | Bacteria | 2057 |
| 110 | Ga0265319_1000053 | 3300028563 | Bacteria | 94221 |
| 111 | Ga0265318_10000053 | 3300028577 | Bacteria | 115241 |
| 112 | Ga0265318_10000963 | 3300028577 | Bacteria | 18482 |
| 113 | Ga0307515_10007231 | 3300028794 | Bacteria | 21986 |
| 114 | Ga0307515_10079880 | 3300028794 | Bacteria | 4276 |
| 115 | Ga0265338_10009829 | 3300028800 | Bacteria | 11339 |
| 116 | Ga0265762_1006639 | 3300030760 | Bacteria | 2069 |
| 117 | Ga0265330_10000048 | 3300031235 | Bacteria | 104793 |
| 118 | Ga0265332_10000770 | 3300031238 | Bacteria | 19733 |
| 119 | Ga0265332_10040711 | 3300031238 | Bacteria | 2011 |
| 120 | Ga0265328_10003899 | 3300031239 | Bacteria | 6563 |
| 121 | Ga0265320_10000223 | 3300031240 | Bacteria | 46106 |
| 122 | Ga0265320_10004374 | 3300031240 | Bacteria | 9271 |
| 123 | Ga0265320_10010108 | 3300031240 | Bacteria | 5640 |
| 124 | Ga0265325_10064486 | 3300031241 | Bacteria | 1852 |
| 125 | Ga0265331_10000615 | 3300031250 | Bacteria | 30977 |
| 126 | Ga0265316_10002943 | 3300031344 | Bacteria | 17434 |
| 127 | Ga0307513_10195896 | 3300031456 | Bacteria | 1867 |
| 128 | Ga0265313_10000412 | 3300031595 | Bacteria | 45964 |
| 129 | Ga0265313_10022538 | 3300031595 | Bacteria | 3413 |
| 130 | Ga0265314_10000088 | 3300031711 | Bacteria | 138315 |
| 131 | Ga0265314_10000342 | 3300031711 | Bacteria | 65026 |
| 132 | Ga0265314_10015168 | 3300031711 | Bacteria | 6124 |
| 133 | Ga0307510_10185648 | 3300033180 | Bacteria | 1635 |
| 134 | Ga0373937_0207281 | 3300036401 | Bacteria | 1844 |
| 135 | Ga0395898_0162673 | 3300037466 | Bacteria | 2135 |
| 136 | Ga0395901_0001632 | 3300038443 | Bacteria | 23197 |
| 137 | Ga0395901_0194477 | 3300038443 | Bacteria | 2127 |
| 138 | Ga0451853_1107206 | 3300041512 | Bacteria | 1011 |
| 139 | Ga0466972_0061136 | 3300044658 | Bacteria | 1807 |
| 140 | Ga0466965_0005737 | 3300044683 | Bacteria | 5603 |
| 141 | Ga0466966_0109858 | 3300044684 | Bacteria | 1700 |
| 142 | Ga0466963_0037471 | 3300044694 | Bacteria | 3167 |
| 143 | Ga0466964_0133894 | 3300044706 | Bacteria | 1132 |
| 144 | Ga0453684_0116941 | 3300044712 | Bacteria | 3227 |
| 145 | Ga0466970_0021641 | 3300044765 | Bacteria | 3351 |
| 146 | Ga0466957_0070691 | 3300044842 | Bacteria | 2157 |
| 147 | Ga0466960_0011769 | 3300044901 | Bacteria | 3673 |
| 148 | Ga0466959_0145592 | 3300045049 | Bacteria | 1672 |
| 149 | Ga0451576_0301704 | 3300045051 | Bacteria | 1675 |
| 150 | Ga0495603_0001547 | 3300046455 | Bacteria | 13469 |
| 151 | Ga0495603_0020778 | 3300046455 | Bacteria | 3975 |
| 152 | Ga0495629_0156366 | 3300046459 | Bacteria | 1584 |
| 153 | Ga0495651_0146084 | 3300046462 | Bacteria | 1710 |
| 154 | Ga0495650_0000029 | 3300046471 | Bacteria | 453466 |
| 155 | Ga0495650_0008610 | 3300046471 | Bacteria | 5921 |
| 156 | Ga0495605_0078447 | 3300046474 | Bacteria | 1548 |
| 157 | Ga0495662_0002704 | 3300046476 | Bacteria | 8963 |
| 158 | Ga0495664_0032726 | 3300046477 | Bacteria | 3052 |
| 159 | Ga0495594_0027631 | 3300046499 | Bacteria | 3058 |
| 160 | Ga0495594_0035442 | 3300046499 | Bacteria | 2718 |
| 161 | Ga0495583_0031791 | 3300046506 | Bacteria | 2554 |
| 162 | Ga0495606_0148329 | 3300046507 | Bacteria | 1379 |
| 163 | Ga0495644_0000316 | 3300046523 | Bacteria | 22262 |
| 164 | Ga0495648_0032928 | 3300046524 | Unclassified | 3393 |
| 165 | Ga0495666_0030696 | 3300046526 | Bacteria | 2635 |
| 166 | Ga0495642_0016923 | 3300046528 | Bacteria | 2846 |
| 167 | Ga0495652_0049688 | 3300046529 | Bacteria | 3589 |
| 168 | Ga0495609_0042381 | 3300046538 | Bacteria | 2044 |
| 169 | Ga0495634_0008386 | 3300046642 | Bacteria | 7700 |
| 170 | Ga0495611_0034232 | 3300046648 | Bacteria | 2245 |
| 171 | Ga0495611_0056215 | 3300046648 | Bacteria | 1781 |
| 172 | Ga0495625_0001024 | 3300046660 | Bacteria | 36797 |
| 173 | Ga0495625_0005679 | 3300046660 | Bacteria | 11300 |
| 174 | Ga0495625_0036237 | 3300046660 | Bacteria | 3628 |
| 175 | Ga0495625_0046120 | 3300046660 | Bacteria | 3146 |
| 176 | Ga0495625_0108834 | 3300046660 | Bacteria | 1896 |
| 177 | Ga0495625_0110253 | 3300046660 | Bacteria | 1881 |
| 178 | Ga0495635_0095052 | 3300046663 | Bacteria | 2037 |
| 179 | Ga0495635_0278290 | 3300046663 | Bacteria | 1124 |
| 180 | Ga0495659_0084767 | 3300046664 | Bacteria | 1208 |
| 181 | Ga0495657_0182037 | 3300046675 | Bacteria | 1289 |
| 182 | Ga0495623_0127362 | 3300046679 | Bacteria | 1528 |
| 183 | Ga0495669_0047045 | 3300046684 | Bacteria | 1926 |
| 184 | Ga0495670_0010787 | 3300046691 | Bacteria | 4489 |
| 185 | Ga0495671_0067377 | 3300046692 | Bacteria | 1761 |
| 186 | Ga0495649_0100276 | 3300046694 | Bacteria | 1540 |
| 187 | Ga0495589_0104670 | 3300046794 | Bacteria | 1368 |
| 188 | Ga0495600_0001535 | 3300046809 | Bacteria | 12828 |
| 189 | Ga0495581_0003151 | 3300047315 | Bacteria | 9438 |
| 190 | Ga0495604_0044413 | 3300047317 | Bacteria | 3472 |
| 191 | Ga0495604_0082352 | 3300047317 | Bacteria | 2407 |
| 192 | Ga0495674_0161447 | 3300047319 | Bacteria | 1875 |
| 193 | Ga0495674_0305156 | 3300047319 | Bacteria | 1299 |
| 194 | Ga0495672_0009742 | 3300047320 | Bacteria | 6925 |
| 195 | Ga0495676_0001042 | 3300047321 | Bacteria | 23408 |
| 196 | Ga0495680_0044789 | 3300047322 | Bacteria | 3497 |
| 197 | Ga0495686_0002023 | 3300047472 | Bacteria | 20001 |
| 198 | Ga0495686_0008736 | 3300047472 | Bacteria | 7391 |
| 199 | Ga0495686_0051104 | 3300047472 | Bacteria | 2595 |
| 200 | Ga0496108_0046795 | 3300048911 | Bacteria | 3615 |
| 201 | Ga0496115_0000084 | 3300048918 | Bacteria | 86953 |
| 202 | Ga0496121_0174634 | 3300048924 | Bacteria | 1557 |
| 203 | Ga0496126_0000226 | 3300048929 | Bacteria | 122150 |
| 204 | Ga0496126_0001093 | 3300048929 | Bacteria | 45526 |
| 205 | Ga0496126_0074525 | 3300048929 | Bacteria | 3014 |
| 206 | Ga0501306_006438 | 3300049127 | Eukaryota | 1378 |
| 207 | Ga0495678_004800 | 3300049459 | Bacteria | 7693 |
| 208 | Ga0495682_0041950 | 3300049460 | Bacteria | 1677 |
| 209 | Ga0501319_001751 | 3300049535 | Eukaryota | 1302 |
| 210 | Ga0501032_0002834 | 3300049569 | Bacteria | 13488 |
| 211 | Ga0501032_0008382 | 3300049569 | Bacteria | 7537 |
| 212 | Ga0501033_0027069 | 3300049570 | Bacteria | 4313 |
| 213 | Ga0501034_0004264 | 3300049571 | Bacteria | 15952 |
| 214 | Ga0501034_0033984 | 3300049571 | Bacteria | 5170 |
| 215 | Ga0501036_0011574 | 3300049572 | Bacteria | 7310 |
| 216 | Ga0501037_0001771 | 3300049573 | Bacteria | 15679 |
| 217 | Ga0501037_0002620 | 3300049573 | Bacteria | 12977 |
| 218 | Ga0501038_0000845 | 3300049574 | Bacteria | 27143 |
| 219 | Ga0501038_0001567 | 3300049574 | Bacteria | 21171 |
| 220 | Ga0501039_0000525 | 3300049575 | Bacteria | 27702 |
| 221 | Ga0501043_0000801 | 3300049579 | Bacteria | 27935 |
| 222 | Ga0501043_0002287 | 3300049579 | Bacteria | 16248 |
| 223 | Ga0501046_0004323 | 3300049580 | Bacteria | 12931 |
| 224 | Ga0501047_0001407 | 3300049581 | Bacteria | 23589 |
| 225 | Ga0501047_0315651 | 3300049581 | Bacteria | 1403 |
| 226 | Ga0501068_0160471 | 3300049584 | Bacteria | 1417 |
| 227 | Ga0501070_0001347 | 3300049586 | Bacteria | 21982 |
| 228 | Ga0501070_0003640 | 3300049586 | Bacteria | 13322 |
| 229 | Ga0501070_0342626 | 3300049586 | Bacteria | 1214 |
| 230 | Ga0501083_0150268 | 3300049744 | Bacteria | 1525 |
| 231 | Ga0501035_0005515 | 3300049822 | Bacteria | 11956 |
| 232 | Ga0501044_0002709 | 3300049823 | Bacteria | 20135 |
| 233 | Ga0501044_0139178 | 3300049823 | Bacteria | 2416 |
| 234 | nmdc:mga05p37_107671_c1 | 3300050507 | Bacteria | 3429 |
| 235 | Ga0500643_018883 | 3300053087 | Bacteria | 2280 |
| 236 | Ga0500595_000187 | 3300053119 | Bacteria | 42083 |
| 237 | Ga0500559_0000447 | 3300053136 | Bacteria | 29356 |
| 238 | Ga0500564_025180 | 3300053138 | Bacteria | 2733 |
| 239 | Ga0500624_000617 | 3300053157 | Bacteria | 9699 |
| 240 | Ga0501084_0237292 | 3300054114 | Bacteria | 1539 |
| 241 | Ga0501082_0002159 | 3300060353 | Bacteria | 17232 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028380 | Ga0268265_10135050 | Ga0268265_101350504 | 256 |
| 2 | 3300049586 | Ga0501070_0001347 | Ga0501070_0001347_14552_15442 | 274 |
| 3 | 3300041512 | Ga0451853_1107206 | Ga0451853_1107206_106_963 | 284 |
| 4 | iso_pu_bacteria | 2922178524 | 2922178530 | 290 |
| 5 | 3300049535 | Ga0501319_001751 | Ga0501319_001751_369_1277 | 292 |
| 6 | 3300044684 | Ga0466966_0109858 | Ga0466966_0109858_721_1605 | 293 |
| 7 | 3300046663 | Ga0495635_0278290 | Ga0495635_0278290_11_901 | 295 |
| 8 | 3300015265 | Ga0182005_1000093 | Ga0182005_100009339 | 298 |
| 9 | 3300028379 | Ga0268266_10045853 | Ga0268266_100458534 | 304 |
| 10 | 3300037466 | Ga0395898_0162673 | Ga0395898_0162673_1065_2003 | 305 |
| 11 | 3300038443 | Ga0395901_0194477 | Ga0395901_0194477_111_1049 | 305 |
| 12 | 3300050507 | nmdc:mga05p37_107671_c1 | nmdc:mga05p37_107671_c1_2437_3405 | 305 |
| 13 | 3300048924 | Ga0496121_0174634 | Ga0496121_0174634_200_1129 | 306 |
| 14 | 3300006028 | Ga0070717_10010371 | Ga0070717_100103714 | 308 |
| 15 | 3300009177 | Ga0105248_10335063 | Ga0105248_103350632 | 308 |
| 16 | 3300046648 | Ga0495611_0056215 | Ga0495611_0056215_46_981 | 308 |
| 17 | 3300046660 | Ga0495625_0046120 | Ga0495625_0046120_36_971 | 308 |
| 18 | 3300046679 | Ga0495623_0127362 | Ga0495623_0127362_559_1491 | 308 |
| 19 | 3300047317 | Ga0495604_0082352 | Ga0495604_0082352_870_1802 | 308 |
| 20 | 3300013105 | Ga0157369_10080984 | Ga0157369_100809842 | 309 |
| 21 | 3300005327 | Ga0070658_10000017 | Ga0070658_10000017180 | 310 |
| 22 | 3300005563 | Ga0068855_100062757 | Ga0068855_1000627574 | 310 |
| 23 | 3300013104 | Ga0157370_10301711 | Ga0157370_103017112 | 310 |
| 24 | 3300025909 | Ga0207705_10000020 | Ga0207705_10000020199 | 310 |
| 25 | 3300006931 | Ga0097620_100184217 | Ga0097620_1001842172 | 313 |
| 26 | 3300025913 | Ga0207695_10000021 | Ga0207695_10000021280 | 313 |
| 27 | 3300005617 | Ga0068859_100170598 | Ga0068859_1001705982 | 314 |
| 28 | 3300006931 | Ga0097620_100170607 | Ga0097620_1001706072 | 314 |
| 29 | 3300025960 | Ga0207651_10276744 | Ga0207651_102767441 | 314 |
| 30 | 3300025961 | Ga0207712_10103539 | Ga0207712_101035391 | 314 |
| 31 | 3300026116 | Ga0207674_10393661 | Ga0207674_103936612 | 314 |
| 32 | iso_pu_bacteria | 2818991444 | 2819587713 | 316 |
| 33 | iso_pu_bacteria | 2821136567 | 2821139565 | 316 |
| 34 | iso_pu_bacteria | 2904467357 | 2904471801 | 316 |
| 35 | 3300005983 | Ga0081540_1001026 | Ga0081540_100102630 | 321 |
| 36 | iso_pu_bacteria | 2643221548 | 2643761612 | 321 |
| 37 | iso_pu_bacteria | 2884215851 | 2884216955 | 321 |
| 38 | 3300025913 | Ga0207695_10000039 | Ga0207695_10000039124 | 322 |
| 39 | 3300031456 | Ga0307513_10195896 | Ga0307513_101958962 | 323 |
| 40 | 3300003479 | Ga0006556J51387_1003372 | Ga0006556J51387_10033721 | 325 |
| 41 | 3300003575 | Ga0007409J51694_1032653 | Ga0007409J51694_10326531 | 325 |
| 42 | 3300009101 | Ga0105247_10004592 | Ga0105247_100045928 | 325 |
| 43 | 3300011119 | Ga0105246_10000119 | Ga0105246_1000011912 | 325 |
| 44 | 3300025256 | Ga0209759_1012693 | Ga0209759_10126933 | 325 |
| 45 | 3300025303 | Ga0209051_1027994 | Ga0209051_10279942 | 325 |
| 46 | 3300028794 | Ga0307515_10079880 | Ga0307515_100798803 | 325 |
| 47 | 3300038443 | Ga0395901_0001632 | Ga0395901_0001632_19408_20394 | 325 |
| 48 | 3300044658 | Ga0466972_0061136 | Ga0466972_0061136_576_1562 | 325 |
| 49 | 3300044683 | Ga0466965_0005737 | Ga0466965_0005737_2895_3881 | 325 |
| 50 | 3300044712 | Ga0453684_0116941 | Ga0453684_0116941_108_1094 | 325 |
| 51 | 3300044765 | Ga0466970_0021641 | Ga0466970_0021641_562_1548 | 325 |
| 52 | 3300044901 | Ga0466960_0011769 | Ga0466960_0011769_1724_2710 | 325 |
| 53 | 3300045051 | Ga0451576_0301704 | Ga0451576_0301704_447_1433 | 325 |
| 54 | 3300046455 | Ga0495603_0001547 | Ga0495603_0001547_8844_9830 | 325 |
| 55 | 3300047321 | Ga0495676_0001042 | Ga0495676_0001042_11662_12648 | 325 |
| 56 | 3300049127 | Ga0501306_006438 | Ga0501306_006438_293_1333 | 325 |
| 57 | 3300049569 | Ga0501032_0008382 | Ga0501032_0008382_4473_5459 | 325 |
| 58 | 3300049571 | Ga0501034_0033984 | Ga0501034_0033984_3905_4891 | 325 |
| 59 | 3300049573 | Ga0501037_0002620 | Ga0501037_0002620_4504_5490 | 325 |
| 60 | 3300049574 | Ga0501038_0001567 | Ga0501038_0001567_17249_18235 | 325 |
| 61 | 3300049575 | Ga0501039_0000525 | Ga0501039_0000525_4067_5053 | 325 |
| 62 | 3300049579 | Ga0501043_0000801 | Ga0501043_0000801_18443_19429 | 325 |
| 63 | 3300049581 | Ga0501047_0315651 | Ga0501047_0315651_55_1047 | 325 |
| 64 | 3300049584 | Ga0501068_0160471 | Ga0501068_0160471_24_1010 | 325 |
| 65 | 3300049586 | Ga0501070_0003640 | Ga0501070_0003640_8739_9725 | 325 |
| 66 | 3300005331 | Ga0070670_100087258 | Ga0070670_1000872582 | 326 |
| 67 | 3300005981 | Ga0081538_10019339 | Ga0081538_100193393 | 326 |
| 68 | 3300009147 | Ga0114129_10013974 | Ga0114129_100139748 | 326 |
| 69 | 3300044842 | Ga0466957_0070691 | Ga0466957_0070691_1031_2029 | 326 |
| 70 | 3300045049 | Ga0466959_0145592 | Ga0466959_0145592_642_1631 | 326 |
| 71 | iso_pu_bacteria | 2509276018 | 2509368486 | 326 |
| 72 | iso_pu_bacteria | 2920760137 | 2920763823 | 326 |
| 73 | 3300005471 | Ga0070698_100009259 | Ga0070698_1000092595 | 327 |
| 74 | 3300014326 | Ga0157380_10153673 | Ga0157380_101536732 | 327 |
| 75 | 3300005327 | Ga0070658_10004001 | Ga0070658_100040016 | 328 |
| 76 | 3300005327 | Ga0070658_10124349 | Ga0070658_101243493 | 328 |
| 77 | 3300005329 | Ga0070683_100000006 | Ga0070683_100000006291 | 328 |
| 78 | 3300005335 | Ga0070666_10012493 | Ga0070666_100124934 | 328 |
| 79 | 3300005335 | Ga0070666_10250260 | Ga0070666_102502601 | 328 |
| 80 | 3300005336 | Ga0070680_100007849 | Ga0070680_1000078492 | 328 |
| 81 | 3300005337 | Ga0070682_100055752 | Ga0070682_1000557521 | 328 |
| 82 | 3300005344 | Ga0070661_100128517 | Ga0070661_1001285172 | 328 |
| 83 | 3300005355 | Ga0070671_100003603 | Ga0070671_10000360313 | 328 |
| 84 | 3300005367 | Ga0070667_100140994 | Ga0070667_1001409942 | 328 |
| 85 | 3300005436 | Ga0070713_100490427 | Ga0070713_1004904271 | 328 |
| 86 | 3300005530 | Ga0070679_100013484 | Ga0070679_1000134847 | 328 |
| 87 | 3300005530 | Ga0070679_100071702 | Ga0070679_1000717023 | 328 |
| 88 | 3300005535 | Ga0070684_100000064 | Ga0070684_10000006425 | 328 |
| 89 | 3300005536 | Ga0070697_100130270 | Ga0070697_1001302702 | 328 |
| 90 | 3300005548 | Ga0070665_100021347 | Ga0070665_1000213472 | 328 |
| 91 | 3300005548 | Ga0070665_100033876 | Ga0070665_1000338765 | 328 |
| 92 | 3300005563 | Ga0068855_100126512 | Ga0068855_1001265122 | 328 |
| 93 | 3300005563 | Ga0068855_100297137 | Ga0068855_1002971372 | 328 |
| 94 | 3300005577 | Ga0068857_100105106 | Ga0068857_1001051062 | 328 |
| 95 | 3300005618 | Ga0068864_100016174 | Ga0068864_1000161743 | 328 |
| 96 | 3300005841 | Ga0068863_100137128 | Ga0068863_1001371283 | 328 |
| 97 | 3300009093 | Ga0105240_10000413 | Ga0105240_100004131 | 328 |
| 98 | 3300009177 | Ga0105248_10358113 | Ga0105248_103581132 | 328 |
| 99 | 3300009545 | Ga0105237_10000046 | Ga0105237_1000004694 | 328 |
| 100 | 3300009551 | Ga0105238_10006035 | Ga0105238_1000603511 | 328 |
| 101 | 3300009551 | Ga0105238_10376459 | Ga0105238_103764591 | 328 |
| 102 | 3300010375 | Ga0105239_10014823 | Ga0105239_100148232 | 328 |
| 103 | 3300010375 | Ga0105239_10016624 | Ga0105239_100166247 | 328 |
| 104 | 3300010375 | Ga0105239_10044510 | Ga0105239_100445102 | 328 |
| 105 | 3300010375 | Ga0105239_10073016 | Ga0105239_100730162 | 328 |
| 106 | 3300013105 | Ga0157369_10297771 | Ga0157369_102977712 | 328 |
| 107 | 3300013296 | Ga0157374_10070813 | Ga0157374_100708132 | 328 |
| 108 | 3300013297 | Ga0157378_10269316 | Ga0157378_102693162 | 328 |
| 109 | 3300014968 | Ga0157379_10352936 | Ga0157379_103529362 | 328 |
| 110 | 3300014969 | Ga0157376_10015169 | Ga0157376_100151694 | 328 |
| 111 | 3300017792 | Ga0163161_10021415 | Ga0163161_100214152 | 328 |
| 112 | 3300025903 | Ga0207680_10046481 | Ga0207680_100464814 | 328 |
| 113 | 3300025912 | Ga0207707_10173754 | Ga0207707_101737542 | 328 |
| 114 | 3300025913 | Ga0207695_10002791 | Ga0207695_1000279110 | 328 |
| 115 | 3300025914 | Ga0207671_10000268 | Ga0207671_1000026831 | 328 |
| 116 | 3300025917 | Ga0207660_10144758 | Ga0207660_101447582 | 328 |
| 117 | 3300025920 | Ga0207649_10095445 | Ga0207649_100954452 | 328 |
| 118 | 3300025924 | Ga0207694_10011792 | Ga0207694_100117925 | 328 |
| 119 | 3300025941 | Ga0207711_10047180 | Ga0207711_100471803 | 328 |
| 120 | 3300025941 | Ga0207711_10122225 | Ga0207711_101222253 | 328 |
| 121 | 3300025944 | Ga0207661_10000011 | Ga0207661_10000011293 | 328 |
| 122 | 3300025949 | Ga0207667_10104733 | Ga0207667_101047332 | 328 |
| 123 | 3300025972 | Ga0207668_10033030 | Ga0207668_100330305 | 328 |
| 124 | 3300025986 | Ga0207658_10109495 | Ga0207658_101094952 | 328 |
| 125 | 3300026095 | Ga0207676_10054800 | Ga0207676_100548003 | 328 |
| 126 | 3300026142 | Ga0207698_10531157 | Ga0207698_105311571 | 328 |
| 127 | 3300028379 | Ga0268266_10001615 | Ga0268266_100016154 | 328 |
| 128 | 3300028379 | Ga0268266_10001974 | Ga0268266_100019749 | 328 |
| 129 | 3300028563 | Ga0265319_1000053 | Ga0265319_100005351 | 328 |
| 130 | 3300028577 | Ga0265318_10000053 | Ga0265318_1000005382 | 328 |
| 131 | 3300028577 | Ga0265318_10000963 | Ga0265318_1000096313 | 328 |
| 132 | 3300028800 | Ga0265338_10009829 | Ga0265338_100098298 | 328 |
| 133 | 3300030760 | Ga0265762_1006639 | Ga0265762_10066392 | 328 |
| 134 | 3300031235 | Ga0265330_10000048 | Ga0265330_1000004882 | 328 |
| 135 | 3300031238 | Ga0265332_10000770 | Ga0265332_100007704 | 328 |
| 136 | 3300031238 | Ga0265332_10040711 | Ga0265332_100407112 | 328 |
| 137 | 3300031239 | Ga0265328_10003899 | Ga0265328_100038994 | 328 |
| 138 | 3300031240 | Ga0265320_10000223 | Ga0265320_1000022322 | 328 |
| 139 | 3300031240 | Ga0265320_10004374 | Ga0265320_100043748 | 328 |
| 140 | 3300031240 | Ga0265320_10010108 | Ga0265320_100101085 | 328 |
| 141 | 3300031241 | Ga0265325_10064486 | Ga0265325_100644862 | 328 |
| 142 | 3300031250 | Ga0265331_10000615 | Ga0265331_1000061522 | 328 |
| 143 | 3300031344 | Ga0265316_10002943 | Ga0265316_1000294312 | 328 |
| 144 | 3300031595 | Ga0265313_10000412 | Ga0265313_1000041223 | 328 |
| 145 | 3300031595 | Ga0265313_10022538 | Ga0265313_100225382 | 328 |
| 146 | 3300031711 | Ga0265314_10000088 | Ga0265314_1000008840 | 328 |
| 147 | 3300031711 | Ga0265314_10000342 | Ga0265314_1000034223 | 328 |
| 148 | 3300031711 | Ga0265314_10015168 | Ga0265314_100151681 | 328 |
| 149 | 3300033180 | Ga0307510_10185648 | Ga0307510_101856482 | 328 |
| 150 | 3300036401 | Ga0373937_0207281 | Ga0373937_0207281_242_1237 | 328 |
| 151 | 3300044694 | Ga0466963_0037471 | Ga0466963_0037471_666_1664 | 328 |
| 152 | 3300046455 | Ga0495603_0020778 | Ga0495603_0020778_1951_2952 | 328 |
| 153 | 3300046459 | Ga0495629_0156366 | Ga0495629_0156366_556_1557 | 328 |
| 154 | 3300046462 | Ga0495651_0146084 | Ga0495651_0146084_607_1605 | 328 |
| 155 | 3300046471 | Ga0495650_0000029 | Ga0495650_0000029_128090_129091 | 328 |
| 156 | 3300046471 | Ga0495650_0008610 | Ga0495650_0008610_4718_5719 | 328 |
| 157 | 3300046474 | Ga0495605_0078447 | Ga0495605_0078447_128_1129 | 328 |
| 158 | 3300046476 | Ga0495662_0002704 | Ga0495662_0002704_5642_6643 | 328 |
| 159 | 3300046477 | Ga0495664_0032726 | Ga0495664_0032726_858_1859 | 328 |
| 160 | 3300046499 | Ga0495594_0027631 | Ga0495594_0027631_861_1862 | 328 |
| 161 | 3300046499 | Ga0495594_0035442 | Ga0495594_0035442_271_1272 | 328 |
| 162 | 3300046506 | Ga0495583_0031791 | Ga0495583_0031791_1203_2207 | 328 |
| 163 | 3300046507 | Ga0495606_0148329 | Ga0495606_0148329_11_1015 | 328 |
| 164 | 3300046523 | Ga0495644_0000316 | Ga0495644_0000316_15314_16315 | 328 |
| 165 | 3300046526 | Ga0495666_0030696 | Ga0495666_0030696_1193_2194 | 328 |
| 166 | 3300046528 | Ga0495642_0016923 | Ga0495642_0016923_1389_2390 | 328 |
| 167 | 3300046529 | Ga0495652_0049688 | Ga0495652_0049688_2065_3066 | 328 |
| 168 | 3300046538 | Ga0495609_0042381 | Ga0495609_0042381_711_1712 | 328 |
| 169 | 3300046642 | Ga0495634_0008386 | Ga0495634_0008386_1715_2716 | 328 |
| 170 | 3300046660 | Ga0495625_0001024 | Ga0495625_0001024_3585_4586 | 328 |
| 171 | 3300046660 | Ga0495625_0036237 | Ga0495625_0036237_2569_3573 | 328 |
| 172 | 3300046660 | Ga0495625_0108834 | Ga0495625_0108834_881_1885 | 328 |
| 173 | 3300046663 | Ga0495635_0095052 | Ga0495635_0095052_1014_2015 | 328 |
| 174 | 3300046664 | Ga0495659_0084767 | Ga0495659_0084767_64_1065 | 328 |
| 175 | 3300046675 | Ga0495657_0182037 | Ga0495657_0182037_155_1153 | 328 |
| 176 | 3300046684 | Ga0495669_0047045 | Ga0495669_0047045_420_1421 | 328 |
| 177 | 3300046691 | Ga0495670_0010787 | Ga0495670_0010787_526_1527 | 328 |
| 178 | 3300046694 | Ga0495649_0100276 | Ga0495649_0100276_477_1481 | 328 |
| 179 | 3300046794 | Ga0495589_0104670 | Ga0495589_0104670_159_1160 | 328 |
| 180 | 3300046809 | Ga0495600_0001535 | Ga0495600_0001535_5563_6564 | 328 |
| 181 | 3300047315 | Ga0495581_0003151 | Ga0495581_0003151_405_1406 | 328 |
| 182 | 3300047317 | Ga0495604_0044413 | Ga0495604_0044413_1301_2377 | 328 |
| 183 | 3300047319 | Ga0495674_0161447 | Ga0495674_0161447_245_1321 | 328 |
| 184 | 3300047319 | Ga0495674_0305156 | Ga0495674_0305156_12_1013 | 328 |
| 185 | 3300047320 | Ga0495672_0009742 | Ga0495672_0009742_264_1268 | 328 |
| 186 | 3300047322 | Ga0495680_0044789 | Ga0495680_0044789_897_1898 | 328 |
| 187 | 3300047472 | Ga0495686_0008736 | Ga0495686_0008736_4158_5156 | 328 |
| 188 | 3300047472 | Ga0495686_0051104 | Ga0495686_0051104_518_1519 | 328 |
| 189 | 3300048911 | Ga0496108_0046795 | Ga0496108_0046795_870_1865 | 328 |
| 190 | 3300048918 | Ga0496115_0000084 | Ga0496115_0000084_62619_63611 | 328 |
| 191 | 3300048929 | Ga0496126_0000226 | Ga0496126_0000226_12283_13275 | 328 |
| 192 | 3300048929 | Ga0496126_0001093 | Ga0496126_0001093_35413_36414 | 328 |
| 193 | 3300048929 | Ga0496126_0074525 | Ga0496126_0074525_951_1949 | 328 |
| 194 | 3300049460 | Ga0495682_0041950 | Ga0495682_0041950_50_1054 | 328 |
| 195 | 3300049569 | Ga0501032_0002834 | Ga0501032_0002834_3585_4589 | 328 |
| 196 | 3300049570 | Ga0501033_0027069 | Ga0501033_0027069_2382_3386 | 328 |
| 197 | 3300049571 | Ga0501034_0004264 | Ga0501034_0004264_6422_7426 | 328 |
| 198 | 3300049572 | Ga0501036_0011574 | Ga0501036_0011574_912_1916 | 328 |
| 199 | 3300049573 | Ga0501037_0001771 | Ga0501037_0001771_2812_3816 | 328 |
| 200 | 3300049574 | Ga0501038_0000845 | Ga0501038_0000845_8635_9639 | 328 |
| 201 | 3300049579 | Ga0501043_0002287 | Ga0501043_0002287_5424_6428 | 328 |
| 202 | 3300049580 | Ga0501046_0004323 | Ga0501046_0004323_7814_8818 | 328 |
| 203 | 3300049581 | Ga0501047_0001407 | Ga0501047_0001407_8960_9964 | 328 |
| 204 | 3300049586 | Ga0501070_0342626 | Ga0501070_0342626_181_1185 | 328 |
| 205 | 3300049744 | Ga0501083_0150268 | Ga0501083_0150268_355_1353 | 328 |
| 206 | 3300049822 | Ga0501035_0005515 | Ga0501035_0005515_1608_2612 | 328 |
| 207 | 3300049823 | Ga0501044_0002709 | Ga0501044_0002709_2382_3386 | 328 |
| 208 | 3300049823 | Ga0501044_0139178 | Ga0501044_0139178_1375_2379 | 328 |
| 209 | 3300053087 | Ga0500643_018883 | Ga0500643_018883_874_1875 | 328 |
| 210 | 3300053119 | Ga0500595_000187 | Ga0500595_000187_24139_25140 | 328 |
| 211 | 3300053136 | Ga0500559_0000447 | Ga0500559_0000447_15841_16833 | 328 |
| 212 | 3300054114 | Ga0501084_0237292 | Ga0501084_0237292_19_1011 | 328 |
| 213 | 3300060353 | Ga0501082_0002159 | Ga0501082_0002159_12311_13366 | 328 |
| 214 | 3300005356 | Ga0070674_100014799 | Ga0070674_1000147993 | 330 |
| 215 | 3300028794 | Ga0307515_10007231 | Ga0307515_1000723116 | 330 |
| 216 | 3300047472 | Ga0495686_0002023 | Ga0495686_0002023_17675_18670 | 330 |
| 217 | iso_pu_bacteria | 2919437846 | 2919440226 | 331 |
| 218 | 3300009093 | Ga0105240_10000008 | Ga0105240_10000008121 | 333 |
| 219 | 3300009093 | Ga0105240_10000326 | Ga0105240_1000032625 | 333 |
| 220 | 3300009551 | Ga0105238_10171835 | Ga0105238_101718352 | 333 |
| 221 | 3300010375 | Ga0105239_10005275 | Ga0105239_100052752 | 333 |
| 222 | 3300025904 | Ga0207647_10086186 | Ga0207647_100861862 | 333 |
| 223 | 3300025913 | Ga0207695_10008936 | Ga0207695_100089367 | 333 |
| 224 | 3300026041 | Ga0207639_10012286 | Ga0207639_100122866 | 333 |
| 225 | 3300044706 | Ga0466964_0133894 | Ga0466964_0133894_111_1112 | 333 |
| 226 | 3300005293 | Ga0065715_10242372 | Ga0065715_102423721 | 334 |
| 227 | 3300005353 | Ga0070669_100032725 | Ga0070669_1000327251 | 334 |
| 228 | 3300005354 | Ga0070675_100183425 | Ga0070675_1001834252 | 334 |
| 229 | 3300005364 | Ga0070673_100512853 | Ga0070673_1005128531 | 334 |
| 230 | 3300005365 | Ga0070688_100080456 | Ga0070688_1000804562 | 334 |
| 231 | 3300005719 | Ga0068861_100055060 | Ga0068861_1000550602 | 334 |
| 232 | 3300005844 | Ga0068862_100010950 | Ga0068862_1000109504 | 334 |
| 233 | 3300009553 | Ga0105249_10016935 | Ga0105249_100169351 | 334 |
| 234 | 3300013308 | Ga0157375_10013726 | Ga0157375_100137263 | 334 |
| 235 | 3300014745 | Ga0157377_10011614 | Ga0157377_100116143 | 334 |
| 236 | 3300026118 | Ga0207675_100003894 | Ga0207675_1000038943 | 334 |
| 237 | 3300002737 | JGI25162J39368_1000118 | JGI25162J39368_100011856 | 335 |
| 238 | 3300009545 | Ga0105237_10050432 | Ga0105237_100504323 | 335 |
| 239 | 3300009545 | Ga0105237_10069814 | Ga0105237_100698143 | 335 |
| 240 | 3300010375 | Ga0105239_10000645 | Ga0105239_1000064526 | 335 |
| 241 | 3300010375 | Ga0105239_10003788 | Ga0105239_1000378812 | 335 |
| 242 | 3300025233 | Ga0209437_100102 | Ga0209437_10010297 | 335 |
| 243 | 3300046524 | Ga0495648_0032928 | Ga0495648_0032928_722_1729 | 335 |
| 244 | 3300046648 | Ga0495611_0034232 | Ga0495611_0034232_558_1565 | 335 |
| 245 | 3300046660 | Ga0495625_0005679 | Ga0495625_0005679_5399_6406 | 335 |
| 246 | 3300046660 | Ga0495625_0110253 | Ga0495625_0110253_665_1696 | 335 |
| 247 | 3300046692 | Ga0495671_0067377 | Ga0495671_0067377_167_1198 | 335 |
| 248 | 3300049459 | Ga0495678_004800 | Ga0495678_004800_5078_6109 | 335 |
| 249 | 3300053138 | Ga0500564_025180 | Ga0500564_025180_748_1755 | 335 |
| 250 | 3300053157 | Ga0500624_000617 | Ga0500624_000617_3851_4858 | 335 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.944 | 1 | 314 |
| 1pz1-assembly2.cif.gz_B | structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) | 0.9262 | 1 | 323 |
| 3v0t-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.923 | 1 | 321 |
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.9191 | 3 | 311 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9117 | 1 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4HPY8_8_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9527 | 1 | 327 | 3.20.20.100 |
| af_A0A0R0ETH2_7_234_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9488 | 1 | 229 | 3.20.20.100 |
| af_P49249_9_269_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9445 | 2 | 262 | 3.20.20.100 |
| 3v0uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.944 | 1 | 314 | 3.20.20.100 |
| af_Q09923_6_337_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9382 | 4 | 335 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W9VHQ2-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9932 | 104 | 205 |
GO:0004033
GO:0005737 |
| AF-A0A328TDJ7-F1-model_v4 | Aldo/keto reductase family protein | 0.9878 | 130 | 213 |
GO:0004033
GO:0005737 |
| AF-A0A2I1FKN2-F1-model_v4 | deleted | 0.9876 | 1 | 185 |
|
| AF-A0A317LPZ2-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.9872 | 1 | 334 |
GO:0004033
GO:0005737 |
| AF-A0A3C0S391-F1-model_v4 | Aldo/keto reductase | 0.9845 | 1 | 186 |
GO:0004033
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar