F361543

General Info

Members Datasets Scaffolds Average Seq Length
250 188 241 330

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10171835|Ga0105238_101718352
Length 348
Sequence MVAWASIILRNKSTDMKYRQLGKTGEKLSAIGLGCMGMSHAYGAVDDGESIATLNRALELGINFWDTADMYGNGVNEKLISQVLGARRKDVFIATKFGFRFKGDSAGFSTSPGVYLDASPEWIKEAVELSLKRLRIDVIDLYYAHRVDPNVPIEETVGAMARLVDEGKVRYIGLSEASAATIRKAHAVHPVSALQTEYSVMTRDVEGEILSTTRELGISLVAYSPLGRGLVTNTLDVQSLGEGDFRKTLPRFSGENLEKNEAVTRAFAAMAEGKGCTASQLALAWVLGKGEDIIPIPGTKRRKYLEENAKAVELSLSAADMSAIDGLFDRDSISGQRYLETSMKMLNH

Samples

Sample ID Description Type Environment
1 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
2 2643221548 Streptomyces sp. Root55 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
6 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
9 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
186 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.4
Metatranscriptomes 2
Isolates 3.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0.8
Rhizoplane 0.8
Rhizosphere 89.2
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000118 3300002737 Bacteria 87343
2 Ga0006556J51387_1003372 3300003479 Eukaryota 1526
3 Ga0007409J51694_1032653 3300003575 Eukaryota 1410
4 Ga0065715_10242372 3300005293 Bacteria 1194
5 Ga0070658_10000017 3300005327 Bacteria 223560
6 Ga0070658_10004001 3300005327 Bacteria 12081
7 Ga0070658_10124349 3300005327 Bacteria 2146
8 Ga0070683_100000006 3300005329 Bacteria 361071
9 Ga0070670_100087258 3300005331 Bacteria 2681
10 Ga0070666_10012493 3300005335 Bacteria 5359
11 Ga0070666_10250260 3300005335 Bacteria 1255
12 Ga0070680_100007849 3300005336 Bacteria 8137
13 Ga0070682_100055752 3300005337 Bacteria 2483
14 Ga0070661_100128517 3300005344 Bacteria 1902
15 Ga0070669_100032725 3300005353 Bacteria 3756
16 Ga0070675_100183425 3300005354 Bacteria 1810
17 Ga0070671_100003603 3300005355 Bacteria 12114
18 Ga0070674_100014799 3300005356 Bacteria 4854
19 Ga0070673_100512853 3300005364 Bacteria 1086
20 Ga0070688_100080456 3300005365 Bacteria 2107
21 Ga0070667_100140994 3300005367 Bacteria 2111
22 Ga0070713_100490427 3300005436 Bacteria 1158
23 Ga0070698_100009259 3300005471 Bacteria 10565
24 Ga0070679_100013484 3300005530 Bacteria 7827
25 Ga0070679_100071702 3300005530 Bacteria 3455
26 Ga0070684_100000064 3300005535 Bacteria 68614
27 Ga0070697_100130270 3300005536 Bacteria 2109
28 Ga0070665_100021347 3300005548 Bacteria 6513
29 Ga0070665_100033876 3300005548 Bacteria 5138
30 Ga0068855_100062757 3300005563 Bacteria 4337
31 Ga0068855_100126512 3300005563 Bacteria 2921
32 Ga0068855_100297137 3300005563 Bacteria 1789
33 Ga0068857_100105106 3300005577 Bacteria 2535
34 Ga0068859_100170598 3300005617 Bacteria 2256
35 Ga0068864_100016174 3300005618 Bacteria 6209
36 Ga0068861_100055060 3300005719 Bacteria 3032
37 Ga0068863_100137128 3300005841 Bacteria 2338
38 Ga0068862_100010950 3300005844 Bacteria 7489
39 Ga0081538_10019339 3300005981 Bacteria 5066
40 Ga0081540_1001026 3300005983 Bacteria 25025
41 Ga0070717_10010371 3300006028 Bacteria 7032
42 Ga0097620_100170607 3300006931 Bacteria 2256
43 Ga0097620_100184217 3300006931 Bacteria 2171
44 Ga0105240_10000008 3300009093 Bacteria 618862
45 Ga0105240_10000326 3300009093 Bacteria 89982
46 Ga0105240_10000413 3300009093 Bacteria 79609
47 Ga0105247_10004592 3300009101 Bacteria 8803
48 Ga0114129_10013974 3300009147 Bacteria 11439
49 Ga0105248_10335063 3300009177 Bacteria 1704
50 Ga0105248_10358113 3300009177 Bacteria 1643
51 Ga0105237_10000046 3300009545 Bacteria 168707
52 Ga0105237_10050432 3300009545 Bacteria 4182
53 Ga0105237_10069814 3300009545 Bacteria 3509
54 Ga0105238_10006035 3300009551 Bacteria 12012
55 Ga0105238_10171835 3300009551 Bacteria 2143
56 Ga0105238_10376459 3300009551 Bacteria 1411
57 Ga0105249_10016935 3300009553 Bacteria 6467
58 Ga0105239_10000645 3300010375 Bacteria 49516
59 Ga0105239_10003788 3300010375 Bacteria 18408
60 Ga0105239_10005275 3300010375 Bacteria 15191
61 Ga0105239_10014823 3300010375 Bacteria 8645
62 Ga0105239_10016624 3300010375 Bacteria 8134
63 Ga0105239_10044510 3300010375 Bacteria 4865
64 Ga0105239_10073016 3300010375 Bacteria 3773
65 Ga0105246_10000119 3300011119 Bacteria 35825
66 Ga0157370_10301711 3300013104 Bacteria 1478
67 Ga0157369_10080984 3300013105 Bacteria 3475
68 Ga0157369_10297771 3300013105 Bacteria 1678
69 Ga0157374_10070813 3300013296 Bacteria 3286
70 Ga0157378_10269316 3300013297 Bacteria 1637
71 Ga0157375_10013726 3300013308 Bacteria 7221
72 Ga0157380_10153673 3300014326 Bacteria 1992
73 Ga0157377_10011614 3300014745 Bacteria 4402
74 Ga0157379_10352936 3300014968 Bacteria 1347
75 Ga0157376_10015169 3300014969 Bacteria 5812
76 Ga0182005_1000093 3300015265 Bacteria 67293
77 Ga0163161_10021415 3300017792 Bacteria 4544
78 Ga0209437_100102 3300025233 Bacteria 224216
79 Ga0209759_1012693 3300025256 Bacteria 2319
80 Ga0209051_1027994 3300025303 Bacteria 2235
81 Ga0207680_10046481 3300025903 Bacteria 2566
82 Ga0207647_10086186 3300025904 Bacteria 1877
83 Ga0207705_10000020 3300025909 Bacteria 311745
84 Ga0207707_10173754 3300025912 Bacteria 1882
85 Ga0207695_10000021 3300025913 Bacteria 679399
86 Ga0207695_10000039 3300025913 Bacteria 454801
87 Ga0207695_10002791 3300025913 Bacteria 25413
88 Ga0207695_10008936 3300025913 Bacteria 12471
89 Ga0207671_10000268 3300025914 Bacteria 77496
90 Ga0207660_10144758 3300025917 Bacteria 1820
91 Ga0207649_10095445 3300025920 Bacteria 1957
92 Ga0207694_10011792 3300025924 Bacteria 6594
93 Ga0207711_10047180 3300025941 Bacteria 3682
94 Ga0207711_10122225 3300025941 Bacteria 2326
95 Ga0207661_10000011 3300025944 Bacteria 361200
96 Ga0207667_10104733 3300025949 Bacteria 2918
97 Ga0207651_10276744 3300025960 Bacteria 1385
98 Ga0207712_10103539 3300025961 Bacteria 2121
99 Ga0207668_10033030 3300025972 Bacteria 3426
100 Ga0207658_10109495 3300025986 Bacteria 2181
101 Ga0207639_10012286 3300026041 Bacteria 5963
102 Ga0207676_10054800 3300026095 Bacteria 3126
103 Ga0207674_10393661 3300026116 Bacteria 1339
104 Ga0207675_100003894 3300026118 Bacteria 14510
105 Ga0207698_10531157 3300026142 Bacteria 1150
106 Ga0268266_10001615 3300028379 Bacteria 26291
107 Ga0268266_10001974 3300028379 Bacteria 22989
108 Ga0268266_10045853 3300028379 Bacteria 3742
109 Ga0268265_10135050 3300028380 Bacteria 2057
110 Ga0265319_1000053 3300028563 Bacteria 94221
111 Ga0265318_10000053 3300028577 Bacteria 115241
112 Ga0265318_10000963 3300028577 Bacteria 18482
113 Ga0307515_10007231 3300028794 Bacteria 21986
114 Ga0307515_10079880 3300028794 Bacteria 4276
115 Ga0265338_10009829 3300028800 Bacteria 11339
116 Ga0265762_1006639 3300030760 Bacteria 2069
117 Ga0265330_10000048 3300031235 Bacteria 104793
118 Ga0265332_10000770 3300031238 Bacteria 19733
119 Ga0265332_10040711 3300031238 Bacteria 2011
120 Ga0265328_10003899 3300031239 Bacteria 6563
121 Ga0265320_10000223 3300031240 Bacteria 46106
122 Ga0265320_10004374 3300031240 Bacteria 9271
123 Ga0265320_10010108 3300031240 Bacteria 5640
124 Ga0265325_10064486 3300031241 Bacteria 1852
125 Ga0265331_10000615 3300031250 Bacteria 30977
126 Ga0265316_10002943 3300031344 Bacteria 17434
127 Ga0307513_10195896 3300031456 Bacteria 1867
128 Ga0265313_10000412 3300031595 Bacteria 45964
129 Ga0265313_10022538 3300031595 Bacteria 3413
130 Ga0265314_10000088 3300031711 Bacteria 138315
131 Ga0265314_10000342 3300031711 Bacteria 65026
132 Ga0265314_10015168 3300031711 Bacteria 6124
133 Ga0307510_10185648 3300033180 Bacteria 1635
134 Ga0373937_0207281 3300036401 Bacteria 1844
135 Ga0395898_0162673 3300037466 Bacteria 2135
136 Ga0395901_0001632 3300038443 Bacteria 23197
137 Ga0395901_0194477 3300038443 Bacteria 2127
138 Ga0451853_1107206 3300041512 Bacteria 1011
139 Ga0466972_0061136 3300044658 Bacteria 1807
140 Ga0466965_0005737 3300044683 Bacteria 5603
141 Ga0466966_0109858 3300044684 Bacteria 1700
142 Ga0466963_0037471 3300044694 Bacteria 3167
143 Ga0466964_0133894 3300044706 Bacteria 1132
144 Ga0453684_0116941 3300044712 Bacteria 3227
145 Ga0466970_0021641 3300044765 Bacteria 3351
146 Ga0466957_0070691 3300044842 Bacteria 2157
147 Ga0466960_0011769 3300044901 Bacteria 3673
148 Ga0466959_0145592 3300045049 Bacteria 1672
149 Ga0451576_0301704 3300045051 Bacteria 1675
150 Ga0495603_0001547 3300046455 Bacteria 13469
151 Ga0495603_0020778 3300046455 Bacteria 3975
152 Ga0495629_0156366 3300046459 Bacteria 1584
153 Ga0495651_0146084 3300046462 Bacteria 1710
154 Ga0495650_0000029 3300046471 Bacteria 453466
155 Ga0495650_0008610 3300046471 Bacteria 5921
156 Ga0495605_0078447 3300046474 Bacteria 1548
157 Ga0495662_0002704 3300046476 Bacteria 8963
158 Ga0495664_0032726 3300046477 Bacteria 3052
159 Ga0495594_0027631 3300046499 Bacteria 3058
160 Ga0495594_0035442 3300046499 Bacteria 2718
161 Ga0495583_0031791 3300046506 Bacteria 2554
162 Ga0495606_0148329 3300046507 Bacteria 1379
163 Ga0495644_0000316 3300046523 Bacteria 22262
164 Ga0495648_0032928 3300046524 Unclassified 3393
165 Ga0495666_0030696 3300046526 Bacteria 2635
166 Ga0495642_0016923 3300046528 Bacteria 2846
167 Ga0495652_0049688 3300046529 Bacteria 3589
168 Ga0495609_0042381 3300046538 Bacteria 2044
169 Ga0495634_0008386 3300046642 Bacteria 7700
170 Ga0495611_0034232 3300046648 Bacteria 2245
171 Ga0495611_0056215 3300046648 Bacteria 1781
172 Ga0495625_0001024 3300046660 Bacteria 36797
173 Ga0495625_0005679 3300046660 Bacteria 11300
174 Ga0495625_0036237 3300046660 Bacteria 3628
175 Ga0495625_0046120 3300046660 Bacteria 3146
176 Ga0495625_0108834 3300046660 Bacteria 1896
177 Ga0495625_0110253 3300046660 Bacteria 1881
178 Ga0495635_0095052 3300046663 Bacteria 2037
179 Ga0495635_0278290 3300046663 Bacteria 1124
180 Ga0495659_0084767 3300046664 Bacteria 1208
181 Ga0495657_0182037 3300046675 Bacteria 1289
182 Ga0495623_0127362 3300046679 Bacteria 1528
183 Ga0495669_0047045 3300046684 Bacteria 1926
184 Ga0495670_0010787 3300046691 Bacteria 4489
185 Ga0495671_0067377 3300046692 Bacteria 1761
186 Ga0495649_0100276 3300046694 Bacteria 1540
187 Ga0495589_0104670 3300046794 Bacteria 1368
188 Ga0495600_0001535 3300046809 Bacteria 12828
189 Ga0495581_0003151 3300047315 Bacteria 9438
190 Ga0495604_0044413 3300047317 Bacteria 3472
191 Ga0495604_0082352 3300047317 Bacteria 2407
192 Ga0495674_0161447 3300047319 Bacteria 1875
193 Ga0495674_0305156 3300047319 Bacteria 1299
194 Ga0495672_0009742 3300047320 Bacteria 6925
195 Ga0495676_0001042 3300047321 Bacteria 23408
196 Ga0495680_0044789 3300047322 Bacteria 3497
197 Ga0495686_0002023 3300047472 Bacteria 20001
198 Ga0495686_0008736 3300047472 Bacteria 7391
199 Ga0495686_0051104 3300047472 Bacteria 2595
200 Ga0496108_0046795 3300048911 Bacteria 3615
201 Ga0496115_0000084 3300048918 Bacteria 86953
202 Ga0496121_0174634 3300048924 Bacteria 1557
203 Ga0496126_0000226 3300048929 Bacteria 122150
204 Ga0496126_0001093 3300048929 Bacteria 45526
205 Ga0496126_0074525 3300048929 Bacteria 3014
206 Ga0501306_006438 3300049127 Eukaryota 1378
207 Ga0495678_004800 3300049459 Bacteria 7693
208 Ga0495682_0041950 3300049460 Bacteria 1677
209 Ga0501319_001751 3300049535 Eukaryota 1302
210 Ga0501032_0002834 3300049569 Bacteria 13488
211 Ga0501032_0008382 3300049569 Bacteria 7537
212 Ga0501033_0027069 3300049570 Bacteria 4313
213 Ga0501034_0004264 3300049571 Bacteria 15952
214 Ga0501034_0033984 3300049571 Bacteria 5170
215 Ga0501036_0011574 3300049572 Bacteria 7310
216 Ga0501037_0001771 3300049573 Bacteria 15679
217 Ga0501037_0002620 3300049573 Bacteria 12977
218 Ga0501038_0000845 3300049574 Bacteria 27143
219 Ga0501038_0001567 3300049574 Bacteria 21171
220 Ga0501039_0000525 3300049575 Bacteria 27702
221 Ga0501043_0000801 3300049579 Bacteria 27935
222 Ga0501043_0002287 3300049579 Bacteria 16248
223 Ga0501046_0004323 3300049580 Bacteria 12931
224 Ga0501047_0001407 3300049581 Bacteria 23589
225 Ga0501047_0315651 3300049581 Bacteria 1403
226 Ga0501068_0160471 3300049584 Bacteria 1417
227 Ga0501070_0001347 3300049586 Bacteria 21982
228 Ga0501070_0003640 3300049586 Bacteria 13322
229 Ga0501070_0342626 3300049586 Bacteria 1214
230 Ga0501083_0150268 3300049744 Bacteria 1525
231 Ga0501035_0005515 3300049822 Bacteria 11956
232 Ga0501044_0002709 3300049823 Bacteria 20135
233 Ga0501044_0139178 3300049823 Bacteria 2416
234 nmdc:mga05p37_107671_c1 3300050507 Bacteria 3429
235 Ga0500643_018883 3300053087 Bacteria 2280
236 Ga0500595_000187 3300053119 Bacteria 42083
237 Ga0500559_0000447 3300053136 Bacteria 29356
238 Ga0500564_025180 3300053138 Bacteria 2733
239 Ga0500624_000617 3300053157 Bacteria 9699
240 Ga0501084_0237292 3300054114 Bacteria 1539
241 Ga0501082_0002159 3300060353 Bacteria 17232

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028380 Ga0268265_10135050 Ga0268265_101350504 256
2 3300049586 Ga0501070_0001347 Ga0501070_0001347_14552_15442 274
3 3300041512 Ga0451853_1107206 Ga0451853_1107206_106_963 284
4 iso_pu_bacteria 2922178524 2922178530 290
5 3300049535 Ga0501319_001751 Ga0501319_001751_369_1277 292
6 3300044684 Ga0466966_0109858 Ga0466966_0109858_721_1605 293
7 3300046663 Ga0495635_0278290 Ga0495635_0278290_11_901 295
8 3300015265 Ga0182005_1000093 Ga0182005_100009339 298
9 3300028379 Ga0268266_10045853 Ga0268266_100458534 304
10 3300037466 Ga0395898_0162673 Ga0395898_0162673_1065_2003 305
11 3300038443 Ga0395901_0194477 Ga0395901_0194477_111_1049 305
12 3300050507 nmdc:mga05p37_107671_c1 nmdc:mga05p37_107671_c1_2437_3405 305
13 3300048924 Ga0496121_0174634 Ga0496121_0174634_200_1129 306
14 3300006028 Ga0070717_10010371 Ga0070717_100103714 308
15 3300009177 Ga0105248_10335063 Ga0105248_103350632 308
16 3300046648 Ga0495611_0056215 Ga0495611_0056215_46_981 308
17 3300046660 Ga0495625_0046120 Ga0495625_0046120_36_971 308
18 3300046679 Ga0495623_0127362 Ga0495623_0127362_559_1491 308
19 3300047317 Ga0495604_0082352 Ga0495604_0082352_870_1802 308
20 3300013105 Ga0157369_10080984 Ga0157369_100809842 309
21 3300005327 Ga0070658_10000017 Ga0070658_10000017180 310
22 3300005563 Ga0068855_100062757 Ga0068855_1000627574 310
23 3300013104 Ga0157370_10301711 Ga0157370_103017112 310
24 3300025909 Ga0207705_10000020 Ga0207705_10000020199 310
25 3300006931 Ga0097620_100184217 Ga0097620_1001842172 313
26 3300025913 Ga0207695_10000021 Ga0207695_10000021280 313
27 3300005617 Ga0068859_100170598 Ga0068859_1001705982 314
28 3300006931 Ga0097620_100170607 Ga0097620_1001706072 314
29 3300025960 Ga0207651_10276744 Ga0207651_102767441 314
30 3300025961 Ga0207712_10103539 Ga0207712_101035391 314
31 3300026116 Ga0207674_10393661 Ga0207674_103936612 314
32 iso_pu_bacteria 2818991444 2819587713 316
33 iso_pu_bacteria 2821136567 2821139565 316
34 iso_pu_bacteria 2904467357 2904471801 316
35 3300005983 Ga0081540_1001026 Ga0081540_100102630 321
36 iso_pu_bacteria 2643221548 2643761612 321
37 iso_pu_bacteria 2884215851 2884216955 321
38 3300025913 Ga0207695_10000039 Ga0207695_10000039124 322
39 3300031456 Ga0307513_10195896 Ga0307513_101958962 323
40 3300003479 Ga0006556J51387_1003372 Ga0006556J51387_10033721 325
41 3300003575 Ga0007409J51694_1032653 Ga0007409J51694_10326531 325
42 3300009101 Ga0105247_10004592 Ga0105247_100045928 325
43 3300011119 Ga0105246_10000119 Ga0105246_1000011912 325
44 3300025256 Ga0209759_1012693 Ga0209759_10126933 325
45 3300025303 Ga0209051_1027994 Ga0209051_10279942 325
46 3300028794 Ga0307515_10079880 Ga0307515_100798803 325
47 3300038443 Ga0395901_0001632 Ga0395901_0001632_19408_20394 325
48 3300044658 Ga0466972_0061136 Ga0466972_0061136_576_1562 325
49 3300044683 Ga0466965_0005737 Ga0466965_0005737_2895_3881 325
50 3300044712 Ga0453684_0116941 Ga0453684_0116941_108_1094 325
51 3300044765 Ga0466970_0021641 Ga0466970_0021641_562_1548 325
52 3300044901 Ga0466960_0011769 Ga0466960_0011769_1724_2710 325
53 3300045051 Ga0451576_0301704 Ga0451576_0301704_447_1433 325
54 3300046455 Ga0495603_0001547 Ga0495603_0001547_8844_9830 325
55 3300047321 Ga0495676_0001042 Ga0495676_0001042_11662_12648 325
56 3300049127 Ga0501306_006438 Ga0501306_006438_293_1333 325
57 3300049569 Ga0501032_0008382 Ga0501032_0008382_4473_5459 325
58 3300049571 Ga0501034_0033984 Ga0501034_0033984_3905_4891 325
59 3300049573 Ga0501037_0002620 Ga0501037_0002620_4504_5490 325
60 3300049574 Ga0501038_0001567 Ga0501038_0001567_17249_18235 325
61 3300049575 Ga0501039_0000525 Ga0501039_0000525_4067_5053 325
62 3300049579 Ga0501043_0000801 Ga0501043_0000801_18443_19429 325
63 3300049581 Ga0501047_0315651 Ga0501047_0315651_55_1047 325
64 3300049584 Ga0501068_0160471 Ga0501068_0160471_24_1010 325
65 3300049586 Ga0501070_0003640 Ga0501070_0003640_8739_9725 325
66 3300005331 Ga0070670_100087258 Ga0070670_1000872582 326
67 3300005981 Ga0081538_10019339 Ga0081538_100193393 326
68 3300009147 Ga0114129_10013974 Ga0114129_100139748 326
69 3300044842 Ga0466957_0070691 Ga0466957_0070691_1031_2029 326
70 3300045049 Ga0466959_0145592 Ga0466959_0145592_642_1631 326
71 iso_pu_bacteria 2509276018 2509368486 326
72 iso_pu_bacteria 2920760137 2920763823 326
73 3300005471 Ga0070698_100009259 Ga0070698_1000092595 327
74 3300014326 Ga0157380_10153673 Ga0157380_101536732 327
75 3300005327 Ga0070658_10004001 Ga0070658_100040016 328
76 3300005327 Ga0070658_10124349 Ga0070658_101243493 328
77 3300005329 Ga0070683_100000006 Ga0070683_100000006291 328
78 3300005335 Ga0070666_10012493 Ga0070666_100124934 328
79 3300005335 Ga0070666_10250260 Ga0070666_102502601 328
80 3300005336 Ga0070680_100007849 Ga0070680_1000078492 328
81 3300005337 Ga0070682_100055752 Ga0070682_1000557521 328
82 3300005344 Ga0070661_100128517 Ga0070661_1001285172 328
83 3300005355 Ga0070671_100003603 Ga0070671_10000360313 328
84 3300005367 Ga0070667_100140994 Ga0070667_1001409942 328
85 3300005436 Ga0070713_100490427 Ga0070713_1004904271 328
86 3300005530 Ga0070679_100013484 Ga0070679_1000134847 328
87 3300005530 Ga0070679_100071702 Ga0070679_1000717023 328
88 3300005535 Ga0070684_100000064 Ga0070684_10000006425 328
89 3300005536 Ga0070697_100130270 Ga0070697_1001302702 328
90 3300005548 Ga0070665_100021347 Ga0070665_1000213472 328
91 3300005548 Ga0070665_100033876 Ga0070665_1000338765 328
92 3300005563 Ga0068855_100126512 Ga0068855_1001265122 328
93 3300005563 Ga0068855_100297137 Ga0068855_1002971372 328
94 3300005577 Ga0068857_100105106 Ga0068857_1001051062 328
95 3300005618 Ga0068864_100016174 Ga0068864_1000161743 328
96 3300005841 Ga0068863_100137128 Ga0068863_1001371283 328
97 3300009093 Ga0105240_10000413 Ga0105240_100004131 328
98 3300009177 Ga0105248_10358113 Ga0105248_103581132 328
99 3300009545 Ga0105237_10000046 Ga0105237_1000004694 328
100 3300009551 Ga0105238_10006035 Ga0105238_1000603511 328
101 3300009551 Ga0105238_10376459 Ga0105238_103764591 328
102 3300010375 Ga0105239_10014823 Ga0105239_100148232 328
103 3300010375 Ga0105239_10016624 Ga0105239_100166247 328
104 3300010375 Ga0105239_10044510 Ga0105239_100445102 328
105 3300010375 Ga0105239_10073016 Ga0105239_100730162 328
106 3300013105 Ga0157369_10297771 Ga0157369_102977712 328
107 3300013296 Ga0157374_10070813 Ga0157374_100708132 328
108 3300013297 Ga0157378_10269316 Ga0157378_102693162 328
109 3300014968 Ga0157379_10352936 Ga0157379_103529362 328
110 3300014969 Ga0157376_10015169 Ga0157376_100151694 328
111 3300017792 Ga0163161_10021415 Ga0163161_100214152 328
112 3300025903 Ga0207680_10046481 Ga0207680_100464814 328
113 3300025912 Ga0207707_10173754 Ga0207707_101737542 328
114 3300025913 Ga0207695_10002791 Ga0207695_1000279110 328
115 3300025914 Ga0207671_10000268 Ga0207671_1000026831 328
116 3300025917 Ga0207660_10144758 Ga0207660_101447582 328
117 3300025920 Ga0207649_10095445 Ga0207649_100954452 328
118 3300025924 Ga0207694_10011792 Ga0207694_100117925 328
119 3300025941 Ga0207711_10047180 Ga0207711_100471803 328
120 3300025941 Ga0207711_10122225 Ga0207711_101222253 328
121 3300025944 Ga0207661_10000011 Ga0207661_10000011293 328
122 3300025949 Ga0207667_10104733 Ga0207667_101047332 328
123 3300025972 Ga0207668_10033030 Ga0207668_100330305 328
124 3300025986 Ga0207658_10109495 Ga0207658_101094952 328
125 3300026095 Ga0207676_10054800 Ga0207676_100548003 328
126 3300026142 Ga0207698_10531157 Ga0207698_105311571 328
127 3300028379 Ga0268266_10001615 Ga0268266_100016154 328
128 3300028379 Ga0268266_10001974 Ga0268266_100019749 328
129 3300028563 Ga0265319_1000053 Ga0265319_100005351 328
130 3300028577 Ga0265318_10000053 Ga0265318_1000005382 328
131 3300028577 Ga0265318_10000963 Ga0265318_1000096313 328
132 3300028800 Ga0265338_10009829 Ga0265338_100098298 328
133 3300030760 Ga0265762_1006639 Ga0265762_10066392 328
134 3300031235 Ga0265330_10000048 Ga0265330_1000004882 328
135 3300031238 Ga0265332_10000770 Ga0265332_100007704 328
136 3300031238 Ga0265332_10040711 Ga0265332_100407112 328
137 3300031239 Ga0265328_10003899 Ga0265328_100038994 328
138 3300031240 Ga0265320_10000223 Ga0265320_1000022322 328
139 3300031240 Ga0265320_10004374 Ga0265320_100043748 328
140 3300031240 Ga0265320_10010108 Ga0265320_100101085 328
141 3300031241 Ga0265325_10064486 Ga0265325_100644862 328
142 3300031250 Ga0265331_10000615 Ga0265331_1000061522 328
143 3300031344 Ga0265316_10002943 Ga0265316_1000294312 328
144 3300031595 Ga0265313_10000412 Ga0265313_1000041223 328
145 3300031595 Ga0265313_10022538 Ga0265313_100225382 328
146 3300031711 Ga0265314_10000088 Ga0265314_1000008840 328
147 3300031711 Ga0265314_10000342 Ga0265314_1000034223 328
148 3300031711 Ga0265314_10015168 Ga0265314_100151681 328
149 3300033180 Ga0307510_10185648 Ga0307510_101856482 328
150 3300036401 Ga0373937_0207281 Ga0373937_0207281_242_1237 328
151 3300044694 Ga0466963_0037471 Ga0466963_0037471_666_1664 328
152 3300046455 Ga0495603_0020778 Ga0495603_0020778_1951_2952 328
153 3300046459 Ga0495629_0156366 Ga0495629_0156366_556_1557 328
154 3300046462 Ga0495651_0146084 Ga0495651_0146084_607_1605 328
155 3300046471 Ga0495650_0000029 Ga0495650_0000029_128090_129091 328
156 3300046471 Ga0495650_0008610 Ga0495650_0008610_4718_5719 328
157 3300046474 Ga0495605_0078447 Ga0495605_0078447_128_1129 328
158 3300046476 Ga0495662_0002704 Ga0495662_0002704_5642_6643 328
159 3300046477 Ga0495664_0032726 Ga0495664_0032726_858_1859 328
160 3300046499 Ga0495594_0027631 Ga0495594_0027631_861_1862 328
161 3300046499 Ga0495594_0035442 Ga0495594_0035442_271_1272 328
162 3300046506 Ga0495583_0031791 Ga0495583_0031791_1203_2207 328
163 3300046507 Ga0495606_0148329 Ga0495606_0148329_11_1015 328
164 3300046523 Ga0495644_0000316 Ga0495644_0000316_15314_16315 328
165 3300046526 Ga0495666_0030696 Ga0495666_0030696_1193_2194 328
166 3300046528 Ga0495642_0016923 Ga0495642_0016923_1389_2390 328
167 3300046529 Ga0495652_0049688 Ga0495652_0049688_2065_3066 328
168 3300046538 Ga0495609_0042381 Ga0495609_0042381_711_1712 328
169 3300046642 Ga0495634_0008386 Ga0495634_0008386_1715_2716 328
170 3300046660 Ga0495625_0001024 Ga0495625_0001024_3585_4586 328
171 3300046660 Ga0495625_0036237 Ga0495625_0036237_2569_3573 328
172 3300046660 Ga0495625_0108834 Ga0495625_0108834_881_1885 328
173 3300046663 Ga0495635_0095052 Ga0495635_0095052_1014_2015 328
174 3300046664 Ga0495659_0084767 Ga0495659_0084767_64_1065 328
175 3300046675 Ga0495657_0182037 Ga0495657_0182037_155_1153 328
176 3300046684 Ga0495669_0047045 Ga0495669_0047045_420_1421 328
177 3300046691 Ga0495670_0010787 Ga0495670_0010787_526_1527 328
178 3300046694 Ga0495649_0100276 Ga0495649_0100276_477_1481 328
179 3300046794 Ga0495589_0104670 Ga0495589_0104670_159_1160 328
180 3300046809 Ga0495600_0001535 Ga0495600_0001535_5563_6564 328
181 3300047315 Ga0495581_0003151 Ga0495581_0003151_405_1406 328
182 3300047317 Ga0495604_0044413 Ga0495604_0044413_1301_2377 328
183 3300047319 Ga0495674_0161447 Ga0495674_0161447_245_1321 328
184 3300047319 Ga0495674_0305156 Ga0495674_0305156_12_1013 328
185 3300047320 Ga0495672_0009742 Ga0495672_0009742_264_1268 328
186 3300047322 Ga0495680_0044789 Ga0495680_0044789_897_1898 328
187 3300047472 Ga0495686_0008736 Ga0495686_0008736_4158_5156 328
188 3300047472 Ga0495686_0051104 Ga0495686_0051104_518_1519 328
189 3300048911 Ga0496108_0046795 Ga0496108_0046795_870_1865 328
190 3300048918 Ga0496115_0000084 Ga0496115_0000084_62619_63611 328
191 3300048929 Ga0496126_0000226 Ga0496126_0000226_12283_13275 328
192 3300048929 Ga0496126_0001093 Ga0496126_0001093_35413_36414 328
193 3300048929 Ga0496126_0074525 Ga0496126_0074525_951_1949 328
194 3300049460 Ga0495682_0041950 Ga0495682_0041950_50_1054 328
195 3300049569 Ga0501032_0002834 Ga0501032_0002834_3585_4589 328
196 3300049570 Ga0501033_0027069 Ga0501033_0027069_2382_3386 328
197 3300049571 Ga0501034_0004264 Ga0501034_0004264_6422_7426 328
198 3300049572 Ga0501036_0011574 Ga0501036_0011574_912_1916 328
199 3300049573 Ga0501037_0001771 Ga0501037_0001771_2812_3816 328
200 3300049574 Ga0501038_0000845 Ga0501038_0000845_8635_9639 328
201 3300049579 Ga0501043_0002287 Ga0501043_0002287_5424_6428 328
202 3300049580 Ga0501046_0004323 Ga0501046_0004323_7814_8818 328
203 3300049581 Ga0501047_0001407 Ga0501047_0001407_8960_9964 328
204 3300049586 Ga0501070_0342626 Ga0501070_0342626_181_1185 328
205 3300049744 Ga0501083_0150268 Ga0501083_0150268_355_1353 328
206 3300049822 Ga0501035_0005515 Ga0501035_0005515_1608_2612 328
207 3300049823 Ga0501044_0002709 Ga0501044_0002709_2382_3386 328
208 3300049823 Ga0501044_0139178 Ga0501044_0139178_1375_2379 328
209 3300053087 Ga0500643_018883 Ga0500643_018883_874_1875 328
210 3300053119 Ga0500595_000187 Ga0500595_000187_24139_25140 328
211 3300053136 Ga0500559_0000447 Ga0500559_0000447_15841_16833 328
212 3300054114 Ga0501084_0237292 Ga0501084_0237292_19_1011 328
213 3300060353 Ga0501082_0002159 Ga0501082_0002159_12311_13366 328
214 3300005356 Ga0070674_100014799 Ga0070674_1000147993 330
215 3300028794 Ga0307515_10007231 Ga0307515_1000723116 330
216 3300047472 Ga0495686_0002023 Ga0495686_0002023_17675_18670 330
217 iso_pu_bacteria 2919437846 2919440226 331
218 3300009093 Ga0105240_10000008 Ga0105240_10000008121 333
219 3300009093 Ga0105240_10000326 Ga0105240_1000032625 333
220 3300009551 Ga0105238_10171835 Ga0105238_101718352 333
221 3300010375 Ga0105239_10005275 Ga0105239_100052752 333
222 3300025904 Ga0207647_10086186 Ga0207647_100861862 333
223 3300025913 Ga0207695_10008936 Ga0207695_100089367 333
224 3300026041 Ga0207639_10012286 Ga0207639_100122866 333
225 3300044706 Ga0466964_0133894 Ga0466964_0133894_111_1112 333
226 3300005293 Ga0065715_10242372 Ga0065715_102423721 334
227 3300005353 Ga0070669_100032725 Ga0070669_1000327251 334
228 3300005354 Ga0070675_100183425 Ga0070675_1001834252 334
229 3300005364 Ga0070673_100512853 Ga0070673_1005128531 334
230 3300005365 Ga0070688_100080456 Ga0070688_1000804562 334
231 3300005719 Ga0068861_100055060 Ga0068861_1000550602 334
232 3300005844 Ga0068862_100010950 Ga0068862_1000109504 334
233 3300009553 Ga0105249_10016935 Ga0105249_100169351 334
234 3300013308 Ga0157375_10013726 Ga0157375_100137263 334
235 3300014745 Ga0157377_10011614 Ga0157377_100116143 334
236 3300026118 Ga0207675_100003894 Ga0207675_1000038943 334
237 3300002737 JGI25162J39368_1000118 JGI25162J39368_100011856 335
238 3300009545 Ga0105237_10050432 Ga0105237_100504323 335
239 3300009545 Ga0105237_10069814 Ga0105237_100698143 335
240 3300010375 Ga0105239_10000645 Ga0105239_1000064526 335
241 3300010375 Ga0105239_10003788 Ga0105239_1000378812 335
242 3300025233 Ga0209437_100102 Ga0209437_10010297 335
243 3300046524 Ga0495648_0032928 Ga0495648_0032928_722_1729 335
244 3300046648 Ga0495611_0034232 Ga0495611_0034232_558_1565 335
245 3300046660 Ga0495625_0005679 Ga0495625_0005679_5399_6406 335
246 3300046660 Ga0495625_0110253 Ga0495625_0110253_665_1696 335
247 3300046692 Ga0495671_0067377 Ga0495671_0067377_167_1198 335
248 3300049459 Ga0495678_004800 Ga0495678_004800_5078_6109 335
249 3300053138 Ga0500564_025180 Ga0500564_025180_748_1755 335
250 3300053157 Ga0500624_000617 Ga0500624_000617_3851_4858 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

30

329

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.944 1 314
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.9262 1 323
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.923 1 321
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9191 3 311
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9117 1 314
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9527 1 327 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9488 1 229 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9445 2 262 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.944 1 314 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9382 4 335 3.20.20.100
ID Description Score Start End GO Terms
AF-W9VHQ2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9932 104 205 GO:0004033
GO:0005737
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 0.9878 130 213 GO:0004033
GO:0005737
AF-A0A2I1FKN2-F1-model_v4 deleted 0.9876 1 185
AF-A0A317LPZ2-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9872 1 334 GO:0004033
GO:0005737
AF-A0A3C0S391-F1-model_v4 Aldo/keto reductase 0.9845 1 186 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.92 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map