F361413

General Info

Members Datasets Scaffolds Average Seq Length
250 181 233 359

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100411734|Ga0068853_1004117341
Length 377
Sequence MCWRRGRGPSLMLRWLRRILAVVAILIALSVLVPLAYIEGTCRPSSGAATASAPAVTLPAIDEPGYRRKLNNTFFTFPEWYIVYSFEDFGRFLDRSSESHFGYLGHIFGFWRSFCTINRAVPATGESLTEVKTMIYIIGISYSVEYAVKGFYENTVGRVFEWIRGKKRTPQDEFGRAVLQDYAAFLYTIPWYKYPFREKLDGLMAISAPTPSKLRSWERDFALGAEYFVKIGYAALIQKALDAGGDEEPRDIMFAVATLPPQALAKEPRIKPIRPLNAQWQLVQAPRYKALTEILQGLLDQGIGLAEIAGNHDILVTVIAPDAAKLDIKGTTELFSLELDARPGFRRAGLKARVEQLVDINRELKAKGASIEHFYDY

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
6 2791355199
7 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
8 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
9 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
10 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
11 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
12 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
170 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
173 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
174 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
175 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
176 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
177 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
178 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
179 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
180 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
181 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.57
Metatranscriptomes 0
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 4.4
Rhizoplane 9.2
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 7.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002395 3300003203 Bacteria 8863
2 JGI25404J52841_10003472 3300003659 Bacteria 3120
3 JGI25404J52841_10013464 3300003659 Bacteria 1774
4 JGI25404J52841_10018999 3300003659 Bacteria 1489
5 Ga0070658_10286854 3300005327 Bacteria 1402
6 Ga0070676_10099500 3300005328 Bacteria 1794
7 Ga0070683_100086998 3300005329 Bacteria 2930
8 Ga0070682_100040751 3300005337 Bacteria 2859
9 Ga0068868_100008495 3300005338 Bacteria 7352
10 Ga0068868_100355140 3300005338 Bacteria 1256
11 Ga0070661_100096914 3300005344 Bacteria 2189
12 Ga0070668_100178027 3300005347 Bacteria 1735
13 Ga0070669_100226026 3300005353 Bacteria 1481
14 Ga0070671_100041174 3300005355 Bacteria 3839
15 Ga0070671_100263491 3300005355 Bacteria 1465
16 Ga0070674_100175433 3300005356 Bacteria 1637
17 Ga0070711_100183737 3300005439 Bacteria 1602
18 Ga0070708_100366934 3300005445 Bacteria 1357
19 Ga0070663_100002806 3300005455 Bacteria 9886
20 Ga0070678_100045278 3300005456 Bacteria 3147
21 Ga0070678_100296976 3300005456 Bacteria 1371
22 Ga0068867_100307926 3300005459 Bacteria 1308
23 Ga0070684_100034698 3300005535 Bacteria 4315
24 Ga0068853_100411734 3300005539 Bacteria 1267
25 Ga0070665_100052114 3300005548 Bacteria 4105
26 Ga0070665_100072899 3300005548 Bacteria 3441
27 Ga0070665_100072924 3300005548 Bacteria 3441
28 Ga0070665_100103283 3300005548 Bacteria 2853
29 Ga0068857_100232302 3300005577 Bacteria 1687
30 Ga0068859_100014858 3300005617 Bacteria 7818
31 Ga0068864_100073961 3300005618 Bacteria 2972
32 Ga0068864_100148595 3300005618 Bacteria 2121
33 Ga0068861_100038217 3300005719 Bacteria 3572
34 Ga0068858_100282406 3300005842 Bacteria 1581
35 Ga0068862_100014814 3300005844 Bacteria 6476
36 Ga0068862_100096819 3300005844 Bacteria 2576
37 Ga0068862_100130028 3300005844 Bacteria 2226
38 Ga0081455_10007484 3300005937 Bacteria 11492
39 Ga0081540_1000575 3300005983 Bacteria 35551
40 Ga0081540_1002052 3300005983 Bacteria 16799
41 Ga0081540_1003503 3300005983 Bacteria 12388
42 Ga0081540_1003756 3300005983 Bacteria 11902
43 Ga0081540_1011065 3300005983 Bacteria 6057
44 Ga0081540_1011979 3300005983 Bacteria 5748
45 Ga0081540_1015672 3300005983 Bacteria 4786
46 Ga0081539_10000341 3300005985 Bacteria 103044
47 Ga0075365_10058994 3300006038 Bacteria 2556
48 Ga0075367_10044908 3300006178 Unclassified 2592
49 Ga0075367_10073889 3300006178 Bacteria 2055
50 Ga0068871_100096258 3300006358 Bacteria 2473
51 Ga0097620_100014858 3300006931 Bacteria 7818
52 Ga0075435_100206649 3300007076 Bacteria 1665
53 Ga0105250_10049522 3300009092 Bacteria 1685
54 Ga0111539_10140486 3300009094 Bacteria 2828
55 Ga0111539_10679107 3300009094 Bacteria 1199
56 Ga0105245_10009648 3300009098 Bacteria 8417
57 Ga0105247_10099267 3300009101 Bacteria 1859
58 Ga0114129_10199113 3300009147 Bacteria 2714
59 Ga0105242_10059965 3300009176 Bacteria 3124
60 Ga0105248_10018820 3300009177 Bacteria 7638
61 Ga0105248_10328685 3300009177 Bacteria 1722
62 Ga0105237_10094434 3300009545 Bacteria 2980
63 Ga0105238_10074851 3300009551 Bacteria 3379
64 Ga0105249_10192063 3300009553 Bacteria 1993
65 Ga0105249_10274462 3300009553 Bacteria 1681
66 Ga0099796_10045394 3300010159 Bacteria 1505
67 Ga0105239_10012289 3300010375 Bacteria 9536
68 Ga0105239_10035774 3300010375 Bacteria 5453
69 Ga0105246_10002429 3300011119 Bacteria 11234
70 Ga0157378_10008982 3300013297 Bacteria 8699
71 Ga0163162_10016120 3300013306 Bacteria 7305
72 Ga0163162_10401250 3300013306 Bacteria 1504
73 Ga0163162_10408839 3300013306 Bacteria 1490
74 Ga0157375_10117168 3300013308 Bacteria 2769
75 Ga0157375_10176118 3300013308 Bacteria 2288
76 Ga0157375_10261499 3300013308 Bacteria 1892
77 Ga0163163_10053494 3300014325 Bacteria 3985
78 Ga0163163_10127735 3300014325 Bacteria 2581
79 Ga0163163_10272994 3300014325 Bacteria 1742
80 Ga0157380_10036759 3300014326 Bacteria 3791
81 Ga0157380_10154733 3300014326 Bacteria 1986
82 Ga0157376_10029316 3300014969 Bacteria 4383
83 Ga0157376_10043981 3300014969 Bacteria 3668
84 Ga0163161_10061966 3300017792 Bacteria 2724
85 Ga0163161_10118096 3300017792 Bacteria 1990
86 Ga0163161_10196922 3300017792 Bacteria 1551
87 Ga0207688_10057286 3300025901 Bacteria 2190
88 Ga0207688_10137165 3300025901 Bacteria 1438
89 Ga0207649_10186090 3300025920 Bacteria 1457
90 Ga0207681_10265578 3300025923 Bacteria 1345
91 Ga0207694_10116946 3300025924 Bacteria 2125
92 Ga0207644_10145583 3300025931 Bacteria 1829
93 Ga0207669_10172669 3300025937 Bacteria 1540
94 Ga0207691_10110305 3300025940 Bacteria 2447
95 Ga0207711_10045314 3300025941 Bacteria 3759
96 Ga0207711_10348215 3300025941 Bacteria 1372
97 Ga0207689_10078822 3300025942 Bacteria 2707
98 Ga0207661_10061479 3300025944 Bacteria 3035
99 Ga0207712_10050947 3300025961 Bacteria 2893
100 Ga0207668_10092943 3300025972 Bacteria 2221
101 Ga0207677_10030660 3300026023 Bacteria 3436
102 Ga0207678_10017844 3300026067 Bacteria 6232
103 Ga0207708_10297232 3300026075 Bacteria 1312
104 Ga0207648_10114973 3300026089 Bacteria 2364
105 Ga0207676_10011817 3300026095 Bacteria 6247
106 Ga0207676_10249392 3300026095 Bacteria 1597
107 Ga0207674_10402367 3300026116 Bacteria 1323
108 Ga0207675_100092080 3300026118 Bacteria 2851
109 Ga0207675_100282637 3300026118 Bacteria 1613
110 Ga0207683_10044454 3300026121 Bacteria 3883
111 Ga0207683_10115719 3300026121 Bacteria 2404
112 Ga0207698_10164818 3300026142 Bacteria 1943
113 Ga0268266_10004561 3300028379 Bacteria 13235
114 Ga0268266_10019523 3300028379 Bacteria 5776
115 Ga0268266_10094649 3300028379 Bacteria 2622
116 Ga0268266_10111482 3300028379 Bacteria 2424
117 Ga0268265_10023012 3300028380 Bacteria 4387
118 Ga0268265_10066320 3300028380 Bacteria 2790
119 Ga0268264_10314671 3300028381 Bacteria 1478
120 Ga0307517_10001174 3300028786 Bacteria 44101
121 Ga0307515_10044437 3300028794 Bacteria 6863
122 Ga0307509_10072001 3300031507 Bacteria 3603
123 Ga0307408_100077510 3300031548 Bacteria 2475
124 Ga0307508_10079265 3300031616 Bacteria 2865
125 Ga0307516_10022701 3300031730 Bacteria 6441
126 Ga0307414_10078197 3300032004 Bacteria 2411
127 Ga0307415_100120377 3300032126 Bacteria 1967
128 Ga0307510_10047417 3300033180 Bacteria 4603
129 Ga0307510_10090157 3300033180 Bacteria 2914
130 Ga0373954_0137718 3300035118 Bacteria 1190
131 Ga0373943_0005797 3300035170 Bacteria 5548
132 Ga0373946_0024843 3300035171 Bacteria 2352
133 Ga0373955_0078536 3300035172 Bacteria 1860
134 Ga0373931_0079883 3300035691 Bacteria 1802
135 Ga0373927_0000121 3300035695 Bacteria 59449
136 Ga0373927_0081199 3300035695 Bacteria 2101
137 Ga0373947_0000118 3300035725 Bacteria 39817
138 Ga0373925_0090318 3300037068 Bacteria 2341
139 Ga0373925_0170393 3300037068 Bacteria 1719
140 Ga0466972_0001204 3300044658 Bacteria 12446
141 Ga0466960_0019225 3300044901 Bacteria 3006
142 Ga0495592_0002158 3300046454 Bacteria 13860
143 Ga0495603_0000053 3300046455 Bacteria 49373
144 Ga0495603_0107948 3300046455 Bacteria 1624
145 Ga0495629_0000879 3300046459 Bacteria 24220
146 Ga0495638_0029451 3300046460 Bacteria 3540
147 Ga0495641_0001147 3300046461 Bacteria 22816
148 Ga0495580_0177107 3300046472 Bacteria 1473
149 Ga0495582_0000186 3300046473 Bacteria 34006
150 Ga0495605_0095138 3300046474 Bacteria 1375
151 Ga0495639_0000078 3300046475 Bacteria 46048
152 Ga0495639_0055385 3300046475 Bacteria 1809
153 Ga0495662_0000360 3300046476 Bacteria 19992
154 Ga0495664_0014571 3300046477 Bacteria 4460
155 Ga0495585_0149359 3300046492 Bacteria 1219
156 Ga0495594_0000103 3300046499 Bacteria 39690
157 Ga0495608_0129020 3300046511 Bacteria 1619
158 Ga0495616_0083903 3300046513 Bacteria 1519
159 Ga0495628_0147749 3300046516 Bacteria 1791
160 Ga0495630_0003914 3300046517 Bacteria 10413
161 Ga0495631_0079444 3300046518 Bacteria 1416
162 Ga0495665_0000190 3300046531 Bacteria 31563
163 Ga0495665_0104954 3300046531 Bacteria 1483
164 Ga0495640_0001297 3300046533 Bacteria 19633
165 Ga0495622_0001547 3300046557 Bacteria 11434
166 Ga0495633_0112891 3300046558 Bacteria 1260
167 Ga0495667_0016490 3300046559 Bacteria 4991
168 Ga0495656_0068626 3300046615 Bacteria 1568
169 Ga0495588_0009772 3300046674 Bacteria 4448
170 Ga0495646_0098874 3300046680 Bacteria 1675
171 Ga0495647_0000720 3300046681 Bacteria 9794
172 Ga0495613_0004274 3300046689 Bacteria 10700
173 Ga0495624_0000504 3300046690 Bacteria 30575
174 Ga0495674_0000228 3300047319 Bacteria 46998
175 Ga0495674_0257348 3300047319 Bacteria 1435
176 Ga0495674_0266451 3300047319 Bacteria 1407
177 Ga0495672_0026461 3300047320 Bacteria 3701
178 Ga0495676_0085156 3300047321 Bacteria 2382
179 Ga0495593_0000033 3300047673 Bacteria 58363
180 Ga0496101_0005528 3300048904 Bacteria 8063
181 Ga0496101_0228648 3300048904 Bacteria 1445
182 Ga0496102_0014871 3300048905 Bacteria 6770
183 Ga0496102_0074461 3300048905 Bacteria 3121
184 Ga0496102_0338401 3300048905 Bacteria 1417
185 Ga0496104_0240784 3300048907 Bacteria 1721
186 Ga0496105_0075997 3300048908 Bacteria 2773
187 Ga0496105_0145193 3300048908 Bacteria 1951
188 Ga0496106_0099619 3300048909 Bacteria 2253
189 Ga0496107_0003484 3300048910 Bacteria 10524
190 Ga0496107_0069933 3300048910 Bacteria 2548
191 Ga0496108_0024677 3300048911 Bacteria 4952
192 Ga0496109_0157762 3300048912 Bacteria 2125
193 Ga0496109_0207964 3300048912 Bacteria 1840
194 Ga0496110_0108854 3300048913 Bacteria 2488
195 Ga0496111_0054852 3300048914 Bacteria 2882
196 Ga0496111_0173080 3300048914 Bacteria 1604
197 Ga0496113_0163496 3300048916 Bacteria 1760
198 Ga0496114_0013267 3300048917 Bacteria 6605
199 Ga0496114_0087710 3300048917 Bacteria 2638
200 Ga0496114_0118087 3300048917 Bacteria 2279
201 Ga0496115_0001082 3300048918 Bacteria 19741
202 Ga0496115_0028332 3300048918 Bacteria 4389
203 Ga0496119_0127657 3300048922 Bacteria 1390
204 Ga0496121_0000886 3300048924 Bacteria 54049
205 Ga0496121_0002398 3300048924 Bacteria 28727
206 Ga0496121_0061244 3300048924 Bacteria 3089
207 Ga0496125_0103196 3300048928 Bacteria 2093
208 Ga0496126_0014744 3300048929 Bacteria 7885
209 Ga0501069_0107638 3300049585 Bacteria 1586
210 Ga0501073_0015437 3300049589 Bacteria 5540
211 Ga0501073_0118337 3300049589 Bacteria 1836
212 nmdc:mga0yw44_224195_c1 3300050492 Bacteria 1247
213 nmdc:mga06z11_90098_c1 3300050494 Unclassified 1663
214 nmdc:mga08y16_133959_c1 3300050511 Bacteria 2575
215 nmdc:mga0n895_298631_c1 3300050512 Bacteria 1633
216 Ga0500635_0006069 3300053080 Bacteria 3210
217 Ga0495619_0004738 3300053085 Bacteria 8654
218 Ga0500641_0018102 3300053096 Bacteria 2645
219 Ga0500641_0034102 3300053096 Bacteria 2024
220 Ga0500554_010933 3300053102 Bacteria 2231
221 Ga0500554_036044 3300053102 Bacteria 1492
222 Ga0500595_001238 3300053119 Bacteria 14072
223 Ga0500595_002440 3300053119 Bacteria 9224
224 Ga0500595_002480 3300053119 Bacteria 9129
225 Ga0500595_030694 3300053119 Bacteria 1808
226 Ga0500568_0021172 3300053139 Bacteria 2801
227 Ga0500603_001811 3300053150 Bacteria 4796
228 Ga0500603_014603 3300053150 Bacteria 1837
229 Ga0500638_032514 3300053162 Bacteria 2519
230 Ga0500636_0015677 3300053177 Bacteria 4467
231 Ga0500637_0000159 3300053178 Bacteria 24810
232 Ga0500637_0000504 3300053178 Bacteria 15159
233 Ga0500661_001620 3300055283 Bacteria 4248

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_0266451 Ga0495674_0266451_393_1370 325
2 3300047320 Ga0495672_0026461 Ga0495672_0026461_95_1195 335
3 3300009177 Ga0105248_10018820 Ga0105248_100188202 337
4 3300025941 Ga0207711_10045314 Ga0207711_100453144 337
5 3300044658 Ga0466972_0001204 Ga0466972_0001204_5778_6878 337
6 3300044901 Ga0466960_0019225 Ga0466960_0019225_277_1377 337
7 3300037068 Ga0373925_0090318 Ga0373925_0090318_578_1666 341
8 3300047319 Ga0495674_0257348 Ga0495674_0257348_18_1106 341
9 3300006038 Ga0075365_10058994 Ga0075365_100589943 343
10 3300053150 Ga0500603_014603 Ga0500603_014603_29_1129 343
11 3300053102 Ga0500554_036044 Ga0500554_036044_206_1306 345
12 3300053119 Ga0500595_002440 Ga0500595_002440_1102_2202 345
13 3300053162 Ga0500638_032514 Ga0500638_032514_901_2001 345
14 3300053178 Ga0500637_0000504 Ga0500637_0000504_7067_8167 345
15 3300055283 Ga0500661_001620 Ga0500661_001620_3023_4123 345
16 3300007076 Ga0075435_100206649 Ga0075435_1002066492 346
17 3300009551 Ga0105238_10074851 Ga0105238_100748512 346
18 3300025924 Ga0207694_10116946 Ga0207694_101169462 346
19 3300046455 Ga0495603_0107948 Ga0495603_0107948_287_1387 347
20 3300053080 Ga0500635_0006069 Ga0500635_0006069_1869_2969 347
21 3300053102 Ga0500554_010933 Ga0500554_010933_890_1990 347
22 3300053150 Ga0500603_001811 Ga0500603_001811_242_1342 347
23 3300053178 Ga0500637_0000159 Ga0500637_0000159_23439_24539 347
24 3300005548 Ga0070665_100103283 Ga0070665_1001032833 349
25 3300028379 Ga0268266_10094649 Ga0268266_100946493 349
26 3300035118 Ga0373954_0137718 Ga0373954_0137718_21_1121 349
27 3300035170 Ga0373943_0005797 Ga0373943_0005797_2872_4005 349
28 3300035171 Ga0373946_0024843 Ga0373946_0024843_1121_2221 349
29 3300035172 Ga0373955_0078536 Ga0373955_0078536_377_1477 349
30 3300035725 Ga0373947_0000118 Ga0373947_0000118_7435_8535 349
31 3300046454 Ga0495592_0002158 Ga0495592_0002158_1605_2738 349
32 3300046455 Ga0495603_0000053 Ga0495603_0000053_28035_29135 349
33 3300046459 Ga0495629_0000879 Ga0495629_0000879_13098_14198 349
34 3300046461 Ga0495641_0001147 Ga0495641_0001147_7754_8854 349
35 3300046473 Ga0495582_0000186 Ga0495582_0000186_11537_12637 349
36 3300046475 Ga0495639_0000078 Ga0495639_0000078_38671_39804 349
37 3300046476 Ga0495662_0000360 Ga0495662_0000360_18168_19268 349
38 3300046477 Ga0495664_0014571 Ga0495664_0014571_223_1323 349
39 3300046499 Ga0495594_0000103 Ga0495594_0000103_9745_10845 349
40 3300046511 Ga0495608_0129020 Ga0495608_0129020_113_1213 349
41 3300046516 Ga0495628_0147749 Ga0495628_0147749_211_1311 349
42 3300046517 Ga0495630_0003914 Ga0495630_0003914_6763_7896 349
43 3300046531 Ga0495665_0000190 Ga0495665_0000190_22466_23599 349
44 3300046533 Ga0495640_0001297 Ga0495640_0001297_11745_12845 349
45 3300046557 Ga0495622_0001547 Ga0495622_0001547_686_1786 349
46 3300046559 Ga0495667_0016490 Ga0495667_0016490_753_1886 349
47 3300046674 Ga0495588_0009772 Ga0495588_0009772_2672_3805 349
48 3300046680 Ga0495646_0098874 Ga0495646_0098874_396_1529 349
49 3300046681 Ga0495647_0000720 Ga0495647_0000720_1961_3061 349
50 3300046689 Ga0495613_0004274 Ga0495613_0004274_2985_4085 349
51 3300046690 Ga0495624_0000504 Ga0495624_0000504_12411_13544 349
52 3300047319 Ga0495674_0000228 Ga0495674_0000228_25695_26795 349
53 3300047321 Ga0495676_0085156 Ga0495676_0085156_1095_2228 349
54 3300047673 Ga0495593_0000033 Ga0495593_0000033_48209_49309 349
55 3300048917 Ga0496114_0118087 Ga0496114_0118087_986_2074 349
56 3300053085 Ga0495619_0004738 Ga0495619_0004738_7387_8520 349
57 3300005618 Ga0068864_100148595 Ga0068864_1001485952 350
58 3300005844 Ga0068862_100130028 Ga0068862_1001300282 350
59 3300013308 Ga0157375_10261499 Ga0157375_102614992 350
60 3300014325 Ga0163163_10127735 Ga0163163_101277353 350
61 3300014326 Ga0157380_10154733 Ga0157380_101547332 350
62 3300025931 Ga0207644_10145583 Ga0207644_101455832 350
63 3300025942 Ga0207689_10078822 Ga0207689_100788223 350
64 3300026095 Ga0207676_10249392 Ga0207676_102493922 350
65 3300028379 Ga0268266_10004561 Ga0268266_1000456111 350
66 3300028380 Ga0268265_10066320 Ga0268265_100663203 350
67 3300028794 Ga0307515_10044437 Ga0307515_100444375 350
68 3300035695 Ga0373927_0000121 Ga0373927_0000121_10782_11915 350
69 3300048905 Ga0496102_0338401 Ga0496102_0338401_165_1265 350
70 3300048924 Ga0496121_0002398 Ga0496121_0002398_10861_11958 350
71 3300050512 nmdc:mga0n895_298631_c1 nmdc:mga0n895_298631_c1_485_1570 350
72 3300005347 Ga0070668_100178027 Ga0070668_1001780272 351
73 3300005577 Ga0068857_100232302 Ga0068857_1002323021 351
74 3300005844 Ga0068862_100014814 Ga0068862_1000148146 351
75 3300009094 Ga0111539_10140486 Ga0111539_101404862 351
76 3300025901 Ga0207688_10057286 Ga0207688_100572864 351
77 3300025940 Ga0207691_10110305 Ga0207691_101103052 351
78 3300026116 Ga0207674_10402367 Ga0207674_104023671 351
79 3300026118 Ga0207675_100282637 Ga0207675_1002826372 351
80 3300028380 Ga0268265_10023012 Ga0268265_100230124 351
81 3300028381 Ga0268264_10314671 Ga0268264_103146712 351
82 3300048924 Ga0496121_0000886 Ga0496121_0000886_26170_27270 351
83 3300050511 nmdc:mga08y16_133959_c1 nmdc:mga08y16_133959_c1_1382_2482 351
84 3300028379 Ga0268266_10111482 Ga0268266_101114822 352
85 3300046460 Ga0495638_0029451 Ga0495638_0029451_217_1317 352
86 3300046474 Ga0495605_0095138 Ga0495605_0095138_34_1134 352
87 3300046513 Ga0495616_0083903 Ga0495616_0083903_160_1260 352
88 3300049589 Ga0501073_0118337 Ga0501073_0118337_703_1806 352
89 3300005983 Ga0081540_1015672 Ga0081540_10156725 353
90 3300013297 Ga0157378_10008982 Ga0157378_100089824 353
91 3300048922 Ga0496119_0127657 Ga0496119_0127657_200_1300 353
92 3300053096 Ga0500641_0034102 Ga0500641_0034102_518_1618 353
93 3300053119 Ga0500595_001238 Ga0500595_001238_5372_6433 353
94 3300003659 JGI25404J52841_10018999 JGI25404J52841_100189991 354
95 3300005983 Ga0081540_1000575 Ga0081540_100057518 354
96 3300026121 Ga0207683_10115719 Ga0207683_101157193 354
97 3300009092 Ga0105250_10049522 Ga0105250_100495223 355
98 3300009553 Ga0105249_10274462 Ga0105249_102744622 355
99 3300014326 Ga0157380_10036759 Ga0157380_100367594 355
100 3300017792 Ga0163161_10118096 Ga0163161_101180963 355
101 3300028786 Ga0307517_10001174 Ga0307517_100011743 355
102 3300031730 Ga0307516_10022701 Ga0307516_100227016 355
103 3300049589 Ga0501073_0015437 Ga0501073_0015437_377_1480 355
104 3300053119 Ga0500595_002480 Ga0500595_002480_3861_4961 355
105 3300053119 Ga0500595_030694 Ga0500595_030694_481_1581 355
106 3300005338 Ga0068868_100355140 Ga0068868_1003551401 356
107 3300005355 Ga0070671_100041174 Ga0070671_1000411743 356
108 3300014325 Ga0163163_10272994 Ga0163163_102729942 356
109 3300014969 Ga0157376_10029316 Ga0157376_100293164 356
110 3300031548 Ga0307408_100077510 Ga0307408_1000775103 357
111 3300046492 Ga0495585_0149359 Ga0495585_0149359_22_1155 358
112 iso_pu_bacteria 2513237101 2513695821 362
113 iso_pu_bacteria 2513237104 2513719403 362
114 iso_pu_bacteria 2524023205 2524436365 362
115 iso_pu_bacteria 2721755755 2723847361 362
116 iso_pu_bacteria 2744054633 2745080681 362
117 iso_pu_bacteria 2791355199 2793084122 362
118 iso_pu_bacteria 2874604998 2874607310 362
119 iso_pu_bacteria 2876808645 2876814546 362
120 iso_pu_bacteria 2879110137 2879114638 362
121 iso_pu_bacteria 2889033259 2889038099 362
122 iso_pu_bacteria 2922361189 2922368599 362
123 iso_pu_bacteria 2922386360 2922387428 362
124 iso_pu_bacteria 8006926726 8006929163 362
125 iso_pu_bacteria 8006964411 8006970993 362
126 iso_pu_bacteria 8006984368 8006989186 362
127 iso_pu_bacteria 8006994254 8006994799 362
128 iso_pu_bacteria 8056673599 8056681030 362
129 3300005548 Ga0070665_100052114 Ga0070665_1000521143 365
130 3300005937 Ga0081455_10007484 Ga0081455_100074848 365
131 3300046475 Ga0495639_0055385 Ga0495639_0055385_350_1447 365
132 3300046558 Ga0495633_0112891 Ga0495633_0112891_86_1183 365
133 3300003203 JGI25406J46586_10002395 JGI25406J46586_100023958 366
134 3300003659 JGI25404J52841_10003472 JGI25404J52841_100034722 366
135 3300003659 JGI25404J52841_10013464 JGI25404J52841_100134642 366
136 3300005327 Ga0070658_10286854 Ga0070658_102868541 366
137 3300005328 Ga0070676_10099500 Ga0070676_100995002 366
138 3300005329 Ga0070683_100086998 Ga0070683_1000869982 366
139 3300005337 Ga0070682_100040751 Ga0070682_1000407513 366
140 3300005338 Ga0068868_100008495 Ga0068868_1000084956 366
141 3300005344 Ga0070661_100096914 Ga0070661_1000969142 366
142 3300005353 Ga0070669_100226026 Ga0070669_1002260261 366
143 3300005355 Ga0070671_100263491 Ga0070671_1002634911 366
144 3300005356 Ga0070674_100175433 Ga0070674_1001754332 366
145 3300005439 Ga0070711_100183737 Ga0070711_1001837372 366
146 3300005445 Ga0070708_100366934 Ga0070708_1003669342 366
147 3300005455 Ga0070663_100002806 Ga0070663_1000028066 366
148 3300005456 Ga0070678_100045278 Ga0070678_1000452783 366
149 3300005456 Ga0070678_100296976 Ga0070678_1002969761 366
150 3300005459 Ga0068867_100307926 Ga0068867_1003079261 366
151 3300005535 Ga0070684_100034698 Ga0070684_1000346984 366
152 3300005539 Ga0068853_100411734 Ga0068853_1004117341 366
153 3300005548 Ga0070665_100072899 Ga0070665_1000728993 366
154 3300005548 Ga0070665_100072924 Ga0070665_1000729241 366
155 3300005617 Ga0068859_100014858 Ga0068859_1000148587 366
156 3300005618 Ga0068864_100073961 Ga0068864_1000739612 366
157 3300005719 Ga0068861_100038217 Ga0068861_1000382174 366
158 3300005842 Ga0068858_100282406 Ga0068858_1002824062 366
159 3300005844 Ga0068862_100096819 Ga0068862_1000968194 366
160 3300005983 Ga0081540_1002052 Ga0081540_100205210 366
161 3300005983 Ga0081540_1003503 Ga0081540_10035035 366
162 3300005983 Ga0081540_1003756 Ga0081540_10037565 366
163 3300005983 Ga0081540_1011065 Ga0081540_10110653 366
164 3300005983 Ga0081540_1011979 Ga0081540_10119794 366
165 3300005985 Ga0081539_10000341 Ga0081539_1000034160 366
166 3300006178 Ga0075367_10044908 Ga0075367_100449083 366
167 3300006178 Ga0075367_10073889 Ga0075367_100738894 366
168 3300006358 Ga0068871_100096258 Ga0068871_1000962583 366
169 3300006931 Ga0097620_100014858 Ga0097620_1000148585 366
170 3300009094 Ga0111539_10679107 Ga0111539_106791072 366
171 3300009098 Ga0105245_10009648 Ga0105245_100096486 366
172 3300009101 Ga0105247_10099267 Ga0105247_100992672 366
173 3300009147 Ga0114129_10199113 Ga0114129_101991132 366
174 3300009176 Ga0105242_10059965 Ga0105242_100599653 366
175 3300009177 Ga0105248_10328685 Ga0105248_103286852 366
176 3300009545 Ga0105237_10094434 Ga0105237_100944342 366
177 3300009553 Ga0105249_10192063 Ga0105249_101920633 366
178 3300010159 Ga0099796_10045394 Ga0099796_100453942 366
179 3300010375 Ga0105239_10012289 Ga0105239_100122895 366
180 3300010375 Ga0105239_10035774 Ga0105239_100357743 366
181 3300011119 Ga0105246_10002429 Ga0105246_100024295 366
182 3300013306 Ga0163162_10016120 Ga0163162_100161204 366
183 3300013306 Ga0163162_10401250 Ga0163162_104012502 366
184 3300013306 Ga0163162_10408839 Ga0163162_104088392 366
185 3300013308 Ga0157375_10117168 Ga0157375_101171682 366
186 3300013308 Ga0157375_10176118 Ga0157375_101761183 366
187 3300014325 Ga0163163_10053494 Ga0163163_100534945 366
188 3300014969 Ga0157376_10043981 Ga0157376_100439813 366
189 3300017792 Ga0163161_10061966 Ga0163161_100619662 366
190 3300017792 Ga0163161_10196922 Ga0163161_101969222 366
191 3300025901 Ga0207688_10137165 Ga0207688_101371652 366
192 3300025920 Ga0207649_10186090 Ga0207649_101860902 366
193 3300025923 Ga0207681_10265578 Ga0207681_102655782 366
194 3300025937 Ga0207669_10172669 Ga0207669_101726692 366
195 3300025941 Ga0207711_10348215 Ga0207711_103482151 366
196 3300025944 Ga0207661_10061479 Ga0207661_100614794 366
197 3300025961 Ga0207712_10050947 Ga0207712_100509472 366
198 3300025972 Ga0207668_10092943 Ga0207668_100929432 366
199 3300026023 Ga0207677_10030660 Ga0207677_100306604 366
200 3300026067 Ga0207678_10017844 Ga0207678_100178444 366
201 3300026075 Ga0207708_10297232 Ga0207708_102972321 366
202 3300026089 Ga0207648_10114973 Ga0207648_101149734 366
203 3300026095 Ga0207676_10011817 Ga0207676_100118174 366
204 3300026118 Ga0207675_100092080 Ga0207675_1000920803 366
205 3300026121 Ga0207683_10044454 Ga0207683_100444543 366
206 3300026142 Ga0207698_10164818 Ga0207698_101648183 366
207 3300028379 Ga0268266_10019523 Ga0268266_100195233 366
208 3300031507 Ga0307509_10072001 Ga0307509_100720013 366
209 3300031616 Ga0307508_10079265 Ga0307508_100792652 366
210 3300032004 Ga0307414_10078197 Ga0307414_100781973 366
211 3300032126 Ga0307415_100120377 Ga0307415_1001203773 366
212 3300033180 Ga0307510_10047417 Ga0307510_100474175 366
213 3300033180 Ga0307510_10090157 Ga0307510_100901572 366
214 3300035691 Ga0373931_0079883 Ga0373931_0079883_331_1431 366
215 3300035695 Ga0373927_0081199 Ga0373927_0081199_536_1636 366
216 3300037068 Ga0373925_0170393 Ga0373925_0170393_243_1343 366
217 3300046472 Ga0495580_0177107 Ga0495580_0177107_246_1346 366
218 3300046518 Ga0495631_0079444 Ga0495631_0079444_47_1147 366
219 3300046531 Ga0495665_0104954 Ga0495665_0104954_183_1283 366
220 3300046615 Ga0495656_0068626 Ga0495656_0068626_362_1462 366
221 3300048904 Ga0496101_0005528 Ga0496101_0005528_1257_2357 366
222 3300048904 Ga0496101_0228648 Ga0496101_0228648_265_1365 366
223 3300048905 Ga0496102_0014871 Ga0496102_0014871_4536_5636 366
224 3300048905 Ga0496102_0074461 Ga0496102_0074461_295_1395 366
225 3300048907 Ga0496104_0240784 Ga0496104_0240784_199_1299 366
226 3300048908 Ga0496105_0075997 Ga0496105_0075997_124_1224 366
227 3300048908 Ga0496105_0145193 Ga0496105_0145193_96_1196 366
228 3300048909 Ga0496106_0099619 Ga0496106_0099619_470_1570 366
229 3300048910 Ga0496107_0003484 Ga0496107_0003484_8877_9977 366
230 3300048910 Ga0496107_0069933 Ga0496107_0069933_294_1394 366
231 3300048911 Ga0496108_0024677 Ga0496108_0024677_2341_3441 366
232 3300048912 Ga0496109_0157762 Ga0496109_0157762_282_1382 366
233 3300048912 Ga0496109_0207964 Ga0496109_0207964_184_1284 366
234 3300048913 Ga0496110_0108854 Ga0496110_0108854_172_1272 366
235 3300048914 Ga0496111_0054852 Ga0496111_0054852_1648_2748 366
236 3300048914 Ga0496111_0173080 Ga0496111_0173080_351_1451 366
237 3300048916 Ga0496113_0163496 Ga0496113_0163496_127_1227 366
238 3300048917 Ga0496114_0013267 Ga0496114_0013267_1616_2716 366
239 3300048917 Ga0496114_0087710 Ga0496114_0087710_745_1845 366
240 3300048918 Ga0496115_0001082 Ga0496115_0001082_13947_15047 366
241 3300048918 Ga0496115_0028332 Ga0496115_0028332_1706_2806 366
242 3300048924 Ga0496121_0061244 Ga0496121_0061244_213_1313 366
243 3300048928 Ga0496125_0103196 Ga0496125_0103196_147_1247 366
244 3300048929 Ga0496126_0014744 Ga0496126_0014744_5907_7007 366
245 3300049585 Ga0501069_0107638 Ga0501069_0107638_250_1350 366
246 3300050492 nmdc:mga0yw44_224195_c1 nmdc:mga0yw44_224195_c1_134_1234 366
247 3300050494 nmdc:mga06z11_90098_c1 nmdc:mga06z11_90098_c1_52_1170 366
248 3300053096 Ga0500641_0018102 Ga0500641_0018102_858_1958 366
249 3300053139 Ga0500568_0021172 Ga0500568_0021172_390_1490 366
250 3300053177 Ga0500636_0015677 Ga0500636_0015677_1966_3066 366

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyc-assembly1.cif.gz_v2 cryo-em structure of the xenopus egg 80s ribosome 0.774 301 366
6teo-assembly2.cif.gz_C crystal structure of a yeast snu114-prp8 complex 0.7553 301 364
3jb9-assembly1.cif.gz_B cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.7518 301 366
6bk8-assembly1.cif.gz_B s. cerevisiae spliceosomal post-catalytic p complex 0.7451 301 365
7dco-assembly1.cif.gz_C cryo-em structure of the activated spliceosome (bact complex) at an atomic resolution of 2.5 angstrom 0.731 301 364
ID Description Score Start End Superfamily
af_Q9MAR2_174_250_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7645 304 361 3.30.70.240
af_Q57559_8_68_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7563 305 361 3.30.70.240
af_P36048_853_976_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.741 301 362 3.30.70.240
af_Q57559_8_68_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7045 305 361 3.30.70.240
3rrkA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6969 301 361 3.30.70.2750
ID Description Score Start End GO Terms
AF-A0A7Z2SLX5-F1-model_v4 Uncharacterized protein 0.9694 1 366
AF-A0A2V7HY68-F1-model_v4 Uncharacterized protein 0.948 284 366
AF-A0A2V6TIQ4-F1-model_v4 Uncharacterized protein 0.9394 256 366
AF-A0A2V6TIQ4-F1-model_v4 Uncharacterized protein 0.9314 256 366
AF-X5XH88-F1-model_v4 Uncharacterized protein 0.9306 274 364

Feature Viewer

pLDDT pTM Quality
86.45 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map