F361413
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 181 | 233 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100411734|Ga0068853_1004117341 |
| Length | 377 |
| Sequence | MCWRRGRGPSLMLRWLRRILAVVAILIALSVLVPLAYIEGTCRPSSGAATASAPAVTLPAIDEPGYRRKLNNTFFTFPEWYIVYSFEDFGRFLDRSSESHFGYLGHIFGFWRSFCTINRAVPATGESLTEVKTMIYIIGISYSVEYAVKGFYENTVGRVFEWIRGKKRTPQDEFGRAVLQDYAAFLYTIPWYKYPFREKLDGLMAISAPTPSKLRSWERDFALGAEYFVKIGYAALIQKALDAGGDEEPRDIMFAVATLPPQALAKEPRIKPIRPLNAQWQLVQAPRYKALTEILQGLLDQGIGLAEIAGNHDILVTVIAPDAAKLDIKGTTELFSLELDARPGFRRAGLKARVEQLVDINRELKAKGASIEHFYDY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 3 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 4 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 5 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 6 | 2791355199 | |||
| 7 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 8 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 9 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 10 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 11 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 12 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 92 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 93 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 94 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 95 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 96 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 97 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 98 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 99 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 100 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 101 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 102 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 103 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 104 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 105 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 106 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 107 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 109 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 110 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 146 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 147 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 148 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 156 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 157 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 158 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 163 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 167 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 169 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 170 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 171 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 172 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 173 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 174 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 175 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 176 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 177 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 178 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 179 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 180 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 181 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.57 |
| Metatranscriptomes | 0 |
| Isolates | 6.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.8 |
| Nodule | 4.4 |
| Rhizoplane | 9.2 |
| Rhizosphere | 70 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10002395 | 3300003203 | Bacteria | 8863 |
| 2 | JGI25404J52841_10003472 | 3300003659 | Bacteria | 3120 |
| 3 | JGI25404J52841_10013464 | 3300003659 | Bacteria | 1774 |
| 4 | JGI25404J52841_10018999 | 3300003659 | Bacteria | 1489 |
| 5 | Ga0070658_10286854 | 3300005327 | Bacteria | 1402 |
| 6 | Ga0070676_10099500 | 3300005328 | Bacteria | 1794 |
| 7 | Ga0070683_100086998 | 3300005329 | Bacteria | 2930 |
| 8 | Ga0070682_100040751 | 3300005337 | Bacteria | 2859 |
| 9 | Ga0068868_100008495 | 3300005338 | Bacteria | 7352 |
| 10 | Ga0068868_100355140 | 3300005338 | Bacteria | 1256 |
| 11 | Ga0070661_100096914 | 3300005344 | Bacteria | 2189 |
| 12 | Ga0070668_100178027 | 3300005347 | Bacteria | 1735 |
| 13 | Ga0070669_100226026 | 3300005353 | Bacteria | 1481 |
| 14 | Ga0070671_100041174 | 3300005355 | Bacteria | 3839 |
| 15 | Ga0070671_100263491 | 3300005355 | Bacteria | 1465 |
| 16 | Ga0070674_100175433 | 3300005356 | Bacteria | 1637 |
| 17 | Ga0070711_100183737 | 3300005439 | Bacteria | 1602 |
| 18 | Ga0070708_100366934 | 3300005445 | Bacteria | 1357 |
| 19 | Ga0070663_100002806 | 3300005455 | Bacteria | 9886 |
| 20 | Ga0070678_100045278 | 3300005456 | Bacteria | 3147 |
| 21 | Ga0070678_100296976 | 3300005456 | Bacteria | 1371 |
| 22 | Ga0068867_100307926 | 3300005459 | Bacteria | 1308 |
| 23 | Ga0070684_100034698 | 3300005535 | Bacteria | 4315 |
| 24 | Ga0068853_100411734 | 3300005539 | Bacteria | 1267 |
| 25 | Ga0070665_100052114 | 3300005548 | Bacteria | 4105 |
| 26 | Ga0070665_100072899 | 3300005548 | Bacteria | 3441 |
| 27 | Ga0070665_100072924 | 3300005548 | Bacteria | 3441 |
| 28 | Ga0070665_100103283 | 3300005548 | Bacteria | 2853 |
| 29 | Ga0068857_100232302 | 3300005577 | Bacteria | 1687 |
| 30 | Ga0068859_100014858 | 3300005617 | Bacteria | 7818 |
| 31 | Ga0068864_100073961 | 3300005618 | Bacteria | 2972 |
| 32 | Ga0068864_100148595 | 3300005618 | Bacteria | 2121 |
| 33 | Ga0068861_100038217 | 3300005719 | Bacteria | 3572 |
| 34 | Ga0068858_100282406 | 3300005842 | Bacteria | 1581 |
| 35 | Ga0068862_100014814 | 3300005844 | Bacteria | 6476 |
| 36 | Ga0068862_100096819 | 3300005844 | Bacteria | 2576 |
| 37 | Ga0068862_100130028 | 3300005844 | Bacteria | 2226 |
| 38 | Ga0081455_10007484 | 3300005937 | Bacteria | 11492 |
| 39 | Ga0081540_1000575 | 3300005983 | Bacteria | 35551 |
| 40 | Ga0081540_1002052 | 3300005983 | Bacteria | 16799 |
| 41 | Ga0081540_1003503 | 3300005983 | Bacteria | 12388 |
| 42 | Ga0081540_1003756 | 3300005983 | Bacteria | 11902 |
| 43 | Ga0081540_1011065 | 3300005983 | Bacteria | 6057 |
| 44 | Ga0081540_1011979 | 3300005983 | Bacteria | 5748 |
| 45 | Ga0081540_1015672 | 3300005983 | Bacteria | 4786 |
| 46 | Ga0081539_10000341 | 3300005985 | Bacteria | 103044 |
| 47 | Ga0075365_10058994 | 3300006038 | Bacteria | 2556 |
| 48 | Ga0075367_10044908 | 3300006178 | Unclassified | 2592 |
| 49 | Ga0075367_10073889 | 3300006178 | Bacteria | 2055 |
| 50 | Ga0068871_100096258 | 3300006358 | Bacteria | 2473 |
| 51 | Ga0097620_100014858 | 3300006931 | Bacteria | 7818 |
| 52 | Ga0075435_100206649 | 3300007076 | Bacteria | 1665 |
| 53 | Ga0105250_10049522 | 3300009092 | Bacteria | 1685 |
| 54 | Ga0111539_10140486 | 3300009094 | Bacteria | 2828 |
| 55 | Ga0111539_10679107 | 3300009094 | Bacteria | 1199 |
| 56 | Ga0105245_10009648 | 3300009098 | Bacteria | 8417 |
| 57 | Ga0105247_10099267 | 3300009101 | Bacteria | 1859 |
| 58 | Ga0114129_10199113 | 3300009147 | Bacteria | 2714 |
| 59 | Ga0105242_10059965 | 3300009176 | Bacteria | 3124 |
| 60 | Ga0105248_10018820 | 3300009177 | Bacteria | 7638 |
| 61 | Ga0105248_10328685 | 3300009177 | Bacteria | 1722 |
| 62 | Ga0105237_10094434 | 3300009545 | Bacteria | 2980 |
| 63 | Ga0105238_10074851 | 3300009551 | Bacteria | 3379 |
| 64 | Ga0105249_10192063 | 3300009553 | Bacteria | 1993 |
| 65 | Ga0105249_10274462 | 3300009553 | Bacteria | 1681 |
| 66 | Ga0099796_10045394 | 3300010159 | Bacteria | 1505 |
| 67 | Ga0105239_10012289 | 3300010375 | Bacteria | 9536 |
| 68 | Ga0105239_10035774 | 3300010375 | Bacteria | 5453 |
| 69 | Ga0105246_10002429 | 3300011119 | Bacteria | 11234 |
| 70 | Ga0157378_10008982 | 3300013297 | Bacteria | 8699 |
| 71 | Ga0163162_10016120 | 3300013306 | Bacteria | 7305 |
| 72 | Ga0163162_10401250 | 3300013306 | Bacteria | 1504 |
| 73 | Ga0163162_10408839 | 3300013306 | Bacteria | 1490 |
| 74 | Ga0157375_10117168 | 3300013308 | Bacteria | 2769 |
| 75 | Ga0157375_10176118 | 3300013308 | Bacteria | 2288 |
| 76 | Ga0157375_10261499 | 3300013308 | Bacteria | 1892 |
| 77 | Ga0163163_10053494 | 3300014325 | Bacteria | 3985 |
| 78 | Ga0163163_10127735 | 3300014325 | Bacteria | 2581 |
| 79 | Ga0163163_10272994 | 3300014325 | Bacteria | 1742 |
| 80 | Ga0157380_10036759 | 3300014326 | Bacteria | 3791 |
| 81 | Ga0157380_10154733 | 3300014326 | Bacteria | 1986 |
| 82 | Ga0157376_10029316 | 3300014969 | Bacteria | 4383 |
| 83 | Ga0157376_10043981 | 3300014969 | Bacteria | 3668 |
| 84 | Ga0163161_10061966 | 3300017792 | Bacteria | 2724 |
| 85 | Ga0163161_10118096 | 3300017792 | Bacteria | 1990 |
| 86 | Ga0163161_10196922 | 3300017792 | Bacteria | 1551 |
| 87 | Ga0207688_10057286 | 3300025901 | Bacteria | 2190 |
| 88 | Ga0207688_10137165 | 3300025901 | Bacteria | 1438 |
| 89 | Ga0207649_10186090 | 3300025920 | Bacteria | 1457 |
| 90 | Ga0207681_10265578 | 3300025923 | Bacteria | 1345 |
| 91 | Ga0207694_10116946 | 3300025924 | Bacteria | 2125 |
| 92 | Ga0207644_10145583 | 3300025931 | Bacteria | 1829 |
| 93 | Ga0207669_10172669 | 3300025937 | Bacteria | 1540 |
| 94 | Ga0207691_10110305 | 3300025940 | Bacteria | 2447 |
| 95 | Ga0207711_10045314 | 3300025941 | Bacteria | 3759 |
| 96 | Ga0207711_10348215 | 3300025941 | Bacteria | 1372 |
| 97 | Ga0207689_10078822 | 3300025942 | Bacteria | 2707 |
| 98 | Ga0207661_10061479 | 3300025944 | Bacteria | 3035 |
| 99 | Ga0207712_10050947 | 3300025961 | Bacteria | 2893 |
| 100 | Ga0207668_10092943 | 3300025972 | Bacteria | 2221 |
| 101 | Ga0207677_10030660 | 3300026023 | Bacteria | 3436 |
| 102 | Ga0207678_10017844 | 3300026067 | Bacteria | 6232 |
| 103 | Ga0207708_10297232 | 3300026075 | Bacteria | 1312 |
| 104 | Ga0207648_10114973 | 3300026089 | Bacteria | 2364 |
| 105 | Ga0207676_10011817 | 3300026095 | Bacteria | 6247 |
| 106 | Ga0207676_10249392 | 3300026095 | Bacteria | 1597 |
| 107 | Ga0207674_10402367 | 3300026116 | Bacteria | 1323 |
| 108 | Ga0207675_100092080 | 3300026118 | Bacteria | 2851 |
| 109 | Ga0207675_100282637 | 3300026118 | Bacteria | 1613 |
| 110 | Ga0207683_10044454 | 3300026121 | Bacteria | 3883 |
| 111 | Ga0207683_10115719 | 3300026121 | Bacteria | 2404 |
| 112 | Ga0207698_10164818 | 3300026142 | Bacteria | 1943 |
| 113 | Ga0268266_10004561 | 3300028379 | Bacteria | 13235 |
| 114 | Ga0268266_10019523 | 3300028379 | Bacteria | 5776 |
| 115 | Ga0268266_10094649 | 3300028379 | Bacteria | 2622 |
| 116 | Ga0268266_10111482 | 3300028379 | Bacteria | 2424 |
| 117 | Ga0268265_10023012 | 3300028380 | Bacteria | 4387 |
| 118 | Ga0268265_10066320 | 3300028380 | Bacteria | 2790 |
| 119 | Ga0268264_10314671 | 3300028381 | Bacteria | 1478 |
| 120 | Ga0307517_10001174 | 3300028786 | Bacteria | 44101 |
| 121 | Ga0307515_10044437 | 3300028794 | Bacteria | 6863 |
| 122 | Ga0307509_10072001 | 3300031507 | Bacteria | 3603 |
| 123 | Ga0307408_100077510 | 3300031548 | Bacteria | 2475 |
| 124 | Ga0307508_10079265 | 3300031616 | Bacteria | 2865 |
| 125 | Ga0307516_10022701 | 3300031730 | Bacteria | 6441 |
| 126 | Ga0307414_10078197 | 3300032004 | Bacteria | 2411 |
| 127 | Ga0307415_100120377 | 3300032126 | Bacteria | 1967 |
| 128 | Ga0307510_10047417 | 3300033180 | Bacteria | 4603 |
| 129 | Ga0307510_10090157 | 3300033180 | Bacteria | 2914 |
| 130 | Ga0373954_0137718 | 3300035118 | Bacteria | 1190 |
| 131 | Ga0373943_0005797 | 3300035170 | Bacteria | 5548 |
| 132 | Ga0373946_0024843 | 3300035171 | Bacteria | 2352 |
| 133 | Ga0373955_0078536 | 3300035172 | Bacteria | 1860 |
| 134 | Ga0373931_0079883 | 3300035691 | Bacteria | 1802 |
| 135 | Ga0373927_0000121 | 3300035695 | Bacteria | 59449 |
| 136 | Ga0373927_0081199 | 3300035695 | Bacteria | 2101 |
| 137 | Ga0373947_0000118 | 3300035725 | Bacteria | 39817 |
| 138 | Ga0373925_0090318 | 3300037068 | Bacteria | 2341 |
| 139 | Ga0373925_0170393 | 3300037068 | Bacteria | 1719 |
| 140 | Ga0466972_0001204 | 3300044658 | Bacteria | 12446 |
| 141 | Ga0466960_0019225 | 3300044901 | Bacteria | 3006 |
| 142 | Ga0495592_0002158 | 3300046454 | Bacteria | 13860 |
| 143 | Ga0495603_0000053 | 3300046455 | Bacteria | 49373 |
| 144 | Ga0495603_0107948 | 3300046455 | Bacteria | 1624 |
| 145 | Ga0495629_0000879 | 3300046459 | Bacteria | 24220 |
| 146 | Ga0495638_0029451 | 3300046460 | Bacteria | 3540 |
| 147 | Ga0495641_0001147 | 3300046461 | Bacteria | 22816 |
| 148 | Ga0495580_0177107 | 3300046472 | Bacteria | 1473 |
| 149 | Ga0495582_0000186 | 3300046473 | Bacteria | 34006 |
| 150 | Ga0495605_0095138 | 3300046474 | Bacteria | 1375 |
| 151 | Ga0495639_0000078 | 3300046475 | Bacteria | 46048 |
| 152 | Ga0495639_0055385 | 3300046475 | Bacteria | 1809 |
| 153 | Ga0495662_0000360 | 3300046476 | Bacteria | 19992 |
| 154 | Ga0495664_0014571 | 3300046477 | Bacteria | 4460 |
| 155 | Ga0495585_0149359 | 3300046492 | Bacteria | 1219 |
| 156 | Ga0495594_0000103 | 3300046499 | Bacteria | 39690 |
| 157 | Ga0495608_0129020 | 3300046511 | Bacteria | 1619 |
| 158 | Ga0495616_0083903 | 3300046513 | Bacteria | 1519 |
| 159 | Ga0495628_0147749 | 3300046516 | Bacteria | 1791 |
| 160 | Ga0495630_0003914 | 3300046517 | Bacteria | 10413 |
| 161 | Ga0495631_0079444 | 3300046518 | Bacteria | 1416 |
| 162 | Ga0495665_0000190 | 3300046531 | Bacteria | 31563 |
| 163 | Ga0495665_0104954 | 3300046531 | Bacteria | 1483 |
| 164 | Ga0495640_0001297 | 3300046533 | Bacteria | 19633 |
| 165 | Ga0495622_0001547 | 3300046557 | Bacteria | 11434 |
| 166 | Ga0495633_0112891 | 3300046558 | Bacteria | 1260 |
| 167 | Ga0495667_0016490 | 3300046559 | Bacteria | 4991 |
| 168 | Ga0495656_0068626 | 3300046615 | Bacteria | 1568 |
| 169 | Ga0495588_0009772 | 3300046674 | Bacteria | 4448 |
| 170 | Ga0495646_0098874 | 3300046680 | Bacteria | 1675 |
| 171 | Ga0495647_0000720 | 3300046681 | Bacteria | 9794 |
| 172 | Ga0495613_0004274 | 3300046689 | Bacteria | 10700 |
| 173 | Ga0495624_0000504 | 3300046690 | Bacteria | 30575 |
| 174 | Ga0495674_0000228 | 3300047319 | Bacteria | 46998 |
| 175 | Ga0495674_0257348 | 3300047319 | Bacteria | 1435 |
| 176 | Ga0495674_0266451 | 3300047319 | Bacteria | 1407 |
| 177 | Ga0495672_0026461 | 3300047320 | Bacteria | 3701 |
| 178 | Ga0495676_0085156 | 3300047321 | Bacteria | 2382 |
| 179 | Ga0495593_0000033 | 3300047673 | Bacteria | 58363 |
| 180 | Ga0496101_0005528 | 3300048904 | Bacteria | 8063 |
| 181 | Ga0496101_0228648 | 3300048904 | Bacteria | 1445 |
| 182 | Ga0496102_0014871 | 3300048905 | Bacteria | 6770 |
| 183 | Ga0496102_0074461 | 3300048905 | Bacteria | 3121 |
| 184 | Ga0496102_0338401 | 3300048905 | Bacteria | 1417 |
| 185 | Ga0496104_0240784 | 3300048907 | Bacteria | 1721 |
| 186 | Ga0496105_0075997 | 3300048908 | Bacteria | 2773 |
| 187 | Ga0496105_0145193 | 3300048908 | Bacteria | 1951 |
| 188 | Ga0496106_0099619 | 3300048909 | Bacteria | 2253 |
| 189 | Ga0496107_0003484 | 3300048910 | Bacteria | 10524 |
| 190 | Ga0496107_0069933 | 3300048910 | Bacteria | 2548 |
| 191 | Ga0496108_0024677 | 3300048911 | Bacteria | 4952 |
| 192 | Ga0496109_0157762 | 3300048912 | Bacteria | 2125 |
| 193 | Ga0496109_0207964 | 3300048912 | Bacteria | 1840 |
| 194 | Ga0496110_0108854 | 3300048913 | Bacteria | 2488 |
| 195 | Ga0496111_0054852 | 3300048914 | Bacteria | 2882 |
| 196 | Ga0496111_0173080 | 3300048914 | Bacteria | 1604 |
| 197 | Ga0496113_0163496 | 3300048916 | Bacteria | 1760 |
| 198 | Ga0496114_0013267 | 3300048917 | Bacteria | 6605 |
| 199 | Ga0496114_0087710 | 3300048917 | Bacteria | 2638 |
| 200 | Ga0496114_0118087 | 3300048917 | Bacteria | 2279 |
| 201 | Ga0496115_0001082 | 3300048918 | Bacteria | 19741 |
| 202 | Ga0496115_0028332 | 3300048918 | Bacteria | 4389 |
| 203 | Ga0496119_0127657 | 3300048922 | Bacteria | 1390 |
| 204 | Ga0496121_0000886 | 3300048924 | Bacteria | 54049 |
| 205 | Ga0496121_0002398 | 3300048924 | Bacteria | 28727 |
| 206 | Ga0496121_0061244 | 3300048924 | Bacteria | 3089 |
| 207 | Ga0496125_0103196 | 3300048928 | Bacteria | 2093 |
| 208 | Ga0496126_0014744 | 3300048929 | Bacteria | 7885 |
| 209 | Ga0501069_0107638 | 3300049585 | Bacteria | 1586 |
| 210 | Ga0501073_0015437 | 3300049589 | Bacteria | 5540 |
| 211 | Ga0501073_0118337 | 3300049589 | Bacteria | 1836 |
| 212 | nmdc:mga0yw44_224195_c1 | 3300050492 | Bacteria | 1247 |
| 213 | nmdc:mga06z11_90098_c1 | 3300050494 | Unclassified | 1663 |
| 214 | nmdc:mga08y16_133959_c1 | 3300050511 | Bacteria | 2575 |
| 215 | nmdc:mga0n895_298631_c1 | 3300050512 | Bacteria | 1633 |
| 216 | Ga0500635_0006069 | 3300053080 | Bacteria | 3210 |
| 217 | Ga0495619_0004738 | 3300053085 | Bacteria | 8654 |
| 218 | Ga0500641_0018102 | 3300053096 | Bacteria | 2645 |
| 219 | Ga0500641_0034102 | 3300053096 | Bacteria | 2024 |
| 220 | Ga0500554_010933 | 3300053102 | Bacteria | 2231 |
| 221 | Ga0500554_036044 | 3300053102 | Bacteria | 1492 |
| 222 | Ga0500595_001238 | 3300053119 | Bacteria | 14072 |
| 223 | Ga0500595_002440 | 3300053119 | Bacteria | 9224 |
| 224 | Ga0500595_002480 | 3300053119 | Bacteria | 9129 |
| 225 | Ga0500595_030694 | 3300053119 | Bacteria | 1808 |
| 226 | Ga0500568_0021172 | 3300053139 | Bacteria | 2801 |
| 227 | Ga0500603_001811 | 3300053150 | Bacteria | 4796 |
| 228 | Ga0500603_014603 | 3300053150 | Bacteria | 1837 |
| 229 | Ga0500638_032514 | 3300053162 | Bacteria | 2519 |
| 230 | Ga0500636_0015677 | 3300053177 | Bacteria | 4467 |
| 231 | Ga0500637_0000159 | 3300053178 | Bacteria | 24810 |
| 232 | Ga0500637_0000504 | 3300053178 | Bacteria | 15159 |
| 233 | Ga0500661_001620 | 3300055283 | Bacteria | 4248 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047319 | Ga0495674_0266451 | Ga0495674_0266451_393_1370 | 325 |
| 2 | 3300047320 | Ga0495672_0026461 | Ga0495672_0026461_95_1195 | 335 |
| 3 | 3300009177 | Ga0105248_10018820 | Ga0105248_100188202 | 337 |
| 4 | 3300025941 | Ga0207711_10045314 | Ga0207711_100453144 | 337 |
| 5 | 3300044658 | Ga0466972_0001204 | Ga0466972_0001204_5778_6878 | 337 |
| 6 | 3300044901 | Ga0466960_0019225 | Ga0466960_0019225_277_1377 | 337 |
| 7 | 3300037068 | Ga0373925_0090318 | Ga0373925_0090318_578_1666 | 341 |
| 8 | 3300047319 | Ga0495674_0257348 | Ga0495674_0257348_18_1106 | 341 |
| 9 | 3300006038 | Ga0075365_10058994 | Ga0075365_100589943 | 343 |
| 10 | 3300053150 | Ga0500603_014603 | Ga0500603_014603_29_1129 | 343 |
| 11 | 3300053102 | Ga0500554_036044 | Ga0500554_036044_206_1306 | 345 |
| 12 | 3300053119 | Ga0500595_002440 | Ga0500595_002440_1102_2202 | 345 |
| 13 | 3300053162 | Ga0500638_032514 | Ga0500638_032514_901_2001 | 345 |
| 14 | 3300053178 | Ga0500637_0000504 | Ga0500637_0000504_7067_8167 | 345 |
| 15 | 3300055283 | Ga0500661_001620 | Ga0500661_001620_3023_4123 | 345 |
| 16 | 3300007076 | Ga0075435_100206649 | Ga0075435_1002066492 | 346 |
| 17 | 3300009551 | Ga0105238_10074851 | Ga0105238_100748512 | 346 |
| 18 | 3300025924 | Ga0207694_10116946 | Ga0207694_101169462 | 346 |
| 19 | 3300046455 | Ga0495603_0107948 | Ga0495603_0107948_287_1387 | 347 |
| 20 | 3300053080 | Ga0500635_0006069 | Ga0500635_0006069_1869_2969 | 347 |
| 21 | 3300053102 | Ga0500554_010933 | Ga0500554_010933_890_1990 | 347 |
| 22 | 3300053150 | Ga0500603_001811 | Ga0500603_001811_242_1342 | 347 |
| 23 | 3300053178 | Ga0500637_0000159 | Ga0500637_0000159_23439_24539 | 347 |
| 24 | 3300005548 | Ga0070665_100103283 | Ga0070665_1001032833 | 349 |
| 25 | 3300028379 | Ga0268266_10094649 | Ga0268266_100946493 | 349 |
| 26 | 3300035118 | Ga0373954_0137718 | Ga0373954_0137718_21_1121 | 349 |
| 27 | 3300035170 | Ga0373943_0005797 | Ga0373943_0005797_2872_4005 | 349 |
| 28 | 3300035171 | Ga0373946_0024843 | Ga0373946_0024843_1121_2221 | 349 |
| 29 | 3300035172 | Ga0373955_0078536 | Ga0373955_0078536_377_1477 | 349 |
| 30 | 3300035725 | Ga0373947_0000118 | Ga0373947_0000118_7435_8535 | 349 |
| 31 | 3300046454 | Ga0495592_0002158 | Ga0495592_0002158_1605_2738 | 349 |
| 32 | 3300046455 | Ga0495603_0000053 | Ga0495603_0000053_28035_29135 | 349 |
| 33 | 3300046459 | Ga0495629_0000879 | Ga0495629_0000879_13098_14198 | 349 |
| 34 | 3300046461 | Ga0495641_0001147 | Ga0495641_0001147_7754_8854 | 349 |
| 35 | 3300046473 | Ga0495582_0000186 | Ga0495582_0000186_11537_12637 | 349 |
| 36 | 3300046475 | Ga0495639_0000078 | Ga0495639_0000078_38671_39804 | 349 |
| 37 | 3300046476 | Ga0495662_0000360 | Ga0495662_0000360_18168_19268 | 349 |
| 38 | 3300046477 | Ga0495664_0014571 | Ga0495664_0014571_223_1323 | 349 |
| 39 | 3300046499 | Ga0495594_0000103 | Ga0495594_0000103_9745_10845 | 349 |
| 40 | 3300046511 | Ga0495608_0129020 | Ga0495608_0129020_113_1213 | 349 |
| 41 | 3300046516 | Ga0495628_0147749 | Ga0495628_0147749_211_1311 | 349 |
| 42 | 3300046517 | Ga0495630_0003914 | Ga0495630_0003914_6763_7896 | 349 |
| 43 | 3300046531 | Ga0495665_0000190 | Ga0495665_0000190_22466_23599 | 349 |
| 44 | 3300046533 | Ga0495640_0001297 | Ga0495640_0001297_11745_12845 | 349 |
| 45 | 3300046557 | Ga0495622_0001547 | Ga0495622_0001547_686_1786 | 349 |
| 46 | 3300046559 | Ga0495667_0016490 | Ga0495667_0016490_753_1886 | 349 |
| 47 | 3300046674 | Ga0495588_0009772 | Ga0495588_0009772_2672_3805 | 349 |
| 48 | 3300046680 | Ga0495646_0098874 | Ga0495646_0098874_396_1529 | 349 |
| 49 | 3300046681 | Ga0495647_0000720 | Ga0495647_0000720_1961_3061 | 349 |
| 50 | 3300046689 | Ga0495613_0004274 | Ga0495613_0004274_2985_4085 | 349 |
| 51 | 3300046690 | Ga0495624_0000504 | Ga0495624_0000504_12411_13544 | 349 |
| 52 | 3300047319 | Ga0495674_0000228 | Ga0495674_0000228_25695_26795 | 349 |
| 53 | 3300047321 | Ga0495676_0085156 | Ga0495676_0085156_1095_2228 | 349 |
| 54 | 3300047673 | Ga0495593_0000033 | Ga0495593_0000033_48209_49309 | 349 |
| 55 | 3300048917 | Ga0496114_0118087 | Ga0496114_0118087_986_2074 | 349 |
| 56 | 3300053085 | Ga0495619_0004738 | Ga0495619_0004738_7387_8520 | 349 |
| 57 | 3300005618 | Ga0068864_100148595 | Ga0068864_1001485952 | 350 |
| 58 | 3300005844 | Ga0068862_100130028 | Ga0068862_1001300282 | 350 |
| 59 | 3300013308 | Ga0157375_10261499 | Ga0157375_102614992 | 350 |
| 60 | 3300014325 | Ga0163163_10127735 | Ga0163163_101277353 | 350 |
| 61 | 3300014326 | Ga0157380_10154733 | Ga0157380_101547332 | 350 |
| 62 | 3300025931 | Ga0207644_10145583 | Ga0207644_101455832 | 350 |
| 63 | 3300025942 | Ga0207689_10078822 | Ga0207689_100788223 | 350 |
| 64 | 3300026095 | Ga0207676_10249392 | Ga0207676_102493922 | 350 |
| 65 | 3300028379 | Ga0268266_10004561 | Ga0268266_1000456111 | 350 |
| 66 | 3300028380 | Ga0268265_10066320 | Ga0268265_100663203 | 350 |
| 67 | 3300028794 | Ga0307515_10044437 | Ga0307515_100444375 | 350 |
| 68 | 3300035695 | Ga0373927_0000121 | Ga0373927_0000121_10782_11915 | 350 |
| 69 | 3300048905 | Ga0496102_0338401 | Ga0496102_0338401_165_1265 | 350 |
| 70 | 3300048924 | Ga0496121_0002398 | Ga0496121_0002398_10861_11958 | 350 |
| 71 | 3300050512 | nmdc:mga0n895_298631_c1 | nmdc:mga0n895_298631_c1_485_1570 | 350 |
| 72 | 3300005347 | Ga0070668_100178027 | Ga0070668_1001780272 | 351 |
| 73 | 3300005577 | Ga0068857_100232302 | Ga0068857_1002323021 | 351 |
| 74 | 3300005844 | Ga0068862_100014814 | Ga0068862_1000148146 | 351 |
| 75 | 3300009094 | Ga0111539_10140486 | Ga0111539_101404862 | 351 |
| 76 | 3300025901 | Ga0207688_10057286 | Ga0207688_100572864 | 351 |
| 77 | 3300025940 | Ga0207691_10110305 | Ga0207691_101103052 | 351 |
| 78 | 3300026116 | Ga0207674_10402367 | Ga0207674_104023671 | 351 |
| 79 | 3300026118 | Ga0207675_100282637 | Ga0207675_1002826372 | 351 |
| 80 | 3300028380 | Ga0268265_10023012 | Ga0268265_100230124 | 351 |
| 81 | 3300028381 | Ga0268264_10314671 | Ga0268264_103146712 | 351 |
| 82 | 3300048924 | Ga0496121_0000886 | Ga0496121_0000886_26170_27270 | 351 |
| 83 | 3300050511 | nmdc:mga08y16_133959_c1 | nmdc:mga08y16_133959_c1_1382_2482 | 351 |
| 84 | 3300028379 | Ga0268266_10111482 | Ga0268266_101114822 | 352 |
| 85 | 3300046460 | Ga0495638_0029451 | Ga0495638_0029451_217_1317 | 352 |
| 86 | 3300046474 | Ga0495605_0095138 | Ga0495605_0095138_34_1134 | 352 |
| 87 | 3300046513 | Ga0495616_0083903 | Ga0495616_0083903_160_1260 | 352 |
| 88 | 3300049589 | Ga0501073_0118337 | Ga0501073_0118337_703_1806 | 352 |
| 89 | 3300005983 | Ga0081540_1015672 | Ga0081540_10156725 | 353 |
| 90 | 3300013297 | Ga0157378_10008982 | Ga0157378_100089824 | 353 |
| 91 | 3300048922 | Ga0496119_0127657 | Ga0496119_0127657_200_1300 | 353 |
| 92 | 3300053096 | Ga0500641_0034102 | Ga0500641_0034102_518_1618 | 353 |
| 93 | 3300053119 | Ga0500595_001238 | Ga0500595_001238_5372_6433 | 353 |
| 94 | 3300003659 | JGI25404J52841_10018999 | JGI25404J52841_100189991 | 354 |
| 95 | 3300005983 | Ga0081540_1000575 | Ga0081540_100057518 | 354 |
| 96 | 3300026121 | Ga0207683_10115719 | Ga0207683_101157193 | 354 |
| 97 | 3300009092 | Ga0105250_10049522 | Ga0105250_100495223 | 355 |
| 98 | 3300009553 | Ga0105249_10274462 | Ga0105249_102744622 | 355 |
| 99 | 3300014326 | Ga0157380_10036759 | Ga0157380_100367594 | 355 |
| 100 | 3300017792 | Ga0163161_10118096 | Ga0163161_101180963 | 355 |
| 101 | 3300028786 | Ga0307517_10001174 | Ga0307517_100011743 | 355 |
| 102 | 3300031730 | Ga0307516_10022701 | Ga0307516_100227016 | 355 |
| 103 | 3300049589 | Ga0501073_0015437 | Ga0501073_0015437_377_1480 | 355 |
| 104 | 3300053119 | Ga0500595_002480 | Ga0500595_002480_3861_4961 | 355 |
| 105 | 3300053119 | Ga0500595_030694 | Ga0500595_030694_481_1581 | 355 |
| 106 | 3300005338 | Ga0068868_100355140 | Ga0068868_1003551401 | 356 |
| 107 | 3300005355 | Ga0070671_100041174 | Ga0070671_1000411743 | 356 |
| 108 | 3300014325 | Ga0163163_10272994 | Ga0163163_102729942 | 356 |
| 109 | 3300014969 | Ga0157376_10029316 | Ga0157376_100293164 | 356 |
| 110 | 3300031548 | Ga0307408_100077510 | Ga0307408_1000775103 | 357 |
| 111 | 3300046492 | Ga0495585_0149359 | Ga0495585_0149359_22_1155 | 358 |
| 112 | iso_pu_bacteria | 2513237101 | 2513695821 | 362 |
| 113 | iso_pu_bacteria | 2513237104 | 2513719403 | 362 |
| 114 | iso_pu_bacteria | 2524023205 | 2524436365 | 362 |
| 115 | iso_pu_bacteria | 2721755755 | 2723847361 | 362 |
| 116 | iso_pu_bacteria | 2744054633 | 2745080681 | 362 |
| 117 | iso_pu_bacteria | 2791355199 | 2793084122 | 362 |
| 118 | iso_pu_bacteria | 2874604998 | 2874607310 | 362 |
| 119 | iso_pu_bacteria | 2876808645 | 2876814546 | 362 |
| 120 | iso_pu_bacteria | 2879110137 | 2879114638 | 362 |
| 121 | iso_pu_bacteria | 2889033259 | 2889038099 | 362 |
| 122 | iso_pu_bacteria | 2922361189 | 2922368599 | 362 |
| 123 | iso_pu_bacteria | 2922386360 | 2922387428 | 362 |
| 124 | iso_pu_bacteria | 8006926726 | 8006929163 | 362 |
| 125 | iso_pu_bacteria | 8006964411 | 8006970993 | 362 |
| 126 | iso_pu_bacteria | 8006984368 | 8006989186 | 362 |
| 127 | iso_pu_bacteria | 8006994254 | 8006994799 | 362 |
| 128 | iso_pu_bacteria | 8056673599 | 8056681030 | 362 |
| 129 | 3300005548 | Ga0070665_100052114 | Ga0070665_1000521143 | 365 |
| 130 | 3300005937 | Ga0081455_10007484 | Ga0081455_100074848 | 365 |
| 131 | 3300046475 | Ga0495639_0055385 | Ga0495639_0055385_350_1447 | 365 |
| 132 | 3300046558 | Ga0495633_0112891 | Ga0495633_0112891_86_1183 | 365 |
| 133 | 3300003203 | JGI25406J46586_10002395 | JGI25406J46586_100023958 | 366 |
| 134 | 3300003659 | JGI25404J52841_10003472 | JGI25404J52841_100034722 | 366 |
| 135 | 3300003659 | JGI25404J52841_10013464 | JGI25404J52841_100134642 | 366 |
| 136 | 3300005327 | Ga0070658_10286854 | Ga0070658_102868541 | 366 |
| 137 | 3300005328 | Ga0070676_10099500 | Ga0070676_100995002 | 366 |
| 138 | 3300005329 | Ga0070683_100086998 | Ga0070683_1000869982 | 366 |
| 139 | 3300005337 | Ga0070682_100040751 | Ga0070682_1000407513 | 366 |
| 140 | 3300005338 | Ga0068868_100008495 | Ga0068868_1000084956 | 366 |
| 141 | 3300005344 | Ga0070661_100096914 | Ga0070661_1000969142 | 366 |
| 142 | 3300005353 | Ga0070669_100226026 | Ga0070669_1002260261 | 366 |
| 143 | 3300005355 | Ga0070671_100263491 | Ga0070671_1002634911 | 366 |
| 144 | 3300005356 | Ga0070674_100175433 | Ga0070674_1001754332 | 366 |
| 145 | 3300005439 | Ga0070711_100183737 | Ga0070711_1001837372 | 366 |
| 146 | 3300005445 | Ga0070708_100366934 | Ga0070708_1003669342 | 366 |
| 147 | 3300005455 | Ga0070663_100002806 | Ga0070663_1000028066 | 366 |
| 148 | 3300005456 | Ga0070678_100045278 | Ga0070678_1000452783 | 366 |
| 149 | 3300005456 | Ga0070678_100296976 | Ga0070678_1002969761 | 366 |
| 150 | 3300005459 | Ga0068867_100307926 | Ga0068867_1003079261 | 366 |
| 151 | 3300005535 | Ga0070684_100034698 | Ga0070684_1000346984 | 366 |
| 152 | 3300005539 | Ga0068853_100411734 | Ga0068853_1004117341 | 366 |
| 153 | 3300005548 | Ga0070665_100072899 | Ga0070665_1000728993 | 366 |
| 154 | 3300005548 | Ga0070665_100072924 | Ga0070665_1000729241 | 366 |
| 155 | 3300005617 | Ga0068859_100014858 | Ga0068859_1000148587 | 366 |
| 156 | 3300005618 | Ga0068864_100073961 | Ga0068864_1000739612 | 366 |
| 157 | 3300005719 | Ga0068861_100038217 | Ga0068861_1000382174 | 366 |
| 158 | 3300005842 | Ga0068858_100282406 | Ga0068858_1002824062 | 366 |
| 159 | 3300005844 | Ga0068862_100096819 | Ga0068862_1000968194 | 366 |
| 160 | 3300005983 | Ga0081540_1002052 | Ga0081540_100205210 | 366 |
| 161 | 3300005983 | Ga0081540_1003503 | Ga0081540_10035035 | 366 |
| 162 | 3300005983 | Ga0081540_1003756 | Ga0081540_10037565 | 366 |
| 163 | 3300005983 | Ga0081540_1011065 | Ga0081540_10110653 | 366 |
| 164 | 3300005983 | Ga0081540_1011979 | Ga0081540_10119794 | 366 |
| 165 | 3300005985 | Ga0081539_10000341 | Ga0081539_1000034160 | 366 |
| 166 | 3300006178 | Ga0075367_10044908 | Ga0075367_100449083 | 366 |
| 167 | 3300006178 | Ga0075367_10073889 | Ga0075367_100738894 | 366 |
| 168 | 3300006358 | Ga0068871_100096258 | Ga0068871_1000962583 | 366 |
| 169 | 3300006931 | Ga0097620_100014858 | Ga0097620_1000148585 | 366 |
| 170 | 3300009094 | Ga0111539_10679107 | Ga0111539_106791072 | 366 |
| 171 | 3300009098 | Ga0105245_10009648 | Ga0105245_100096486 | 366 |
| 172 | 3300009101 | Ga0105247_10099267 | Ga0105247_100992672 | 366 |
| 173 | 3300009147 | Ga0114129_10199113 | Ga0114129_101991132 | 366 |
| 174 | 3300009176 | Ga0105242_10059965 | Ga0105242_100599653 | 366 |
| 175 | 3300009177 | Ga0105248_10328685 | Ga0105248_103286852 | 366 |
| 176 | 3300009545 | Ga0105237_10094434 | Ga0105237_100944342 | 366 |
| 177 | 3300009553 | Ga0105249_10192063 | Ga0105249_101920633 | 366 |
| 178 | 3300010159 | Ga0099796_10045394 | Ga0099796_100453942 | 366 |
| 179 | 3300010375 | Ga0105239_10012289 | Ga0105239_100122895 | 366 |
| 180 | 3300010375 | Ga0105239_10035774 | Ga0105239_100357743 | 366 |
| 181 | 3300011119 | Ga0105246_10002429 | Ga0105246_100024295 | 366 |
| 182 | 3300013306 | Ga0163162_10016120 | Ga0163162_100161204 | 366 |
| 183 | 3300013306 | Ga0163162_10401250 | Ga0163162_104012502 | 366 |
| 184 | 3300013306 | Ga0163162_10408839 | Ga0163162_104088392 | 366 |
| 185 | 3300013308 | Ga0157375_10117168 | Ga0157375_101171682 | 366 |
| 186 | 3300013308 | Ga0157375_10176118 | Ga0157375_101761183 | 366 |
| 187 | 3300014325 | Ga0163163_10053494 | Ga0163163_100534945 | 366 |
| 188 | 3300014969 | Ga0157376_10043981 | Ga0157376_100439813 | 366 |
| 189 | 3300017792 | Ga0163161_10061966 | Ga0163161_100619662 | 366 |
| 190 | 3300017792 | Ga0163161_10196922 | Ga0163161_101969222 | 366 |
| 191 | 3300025901 | Ga0207688_10137165 | Ga0207688_101371652 | 366 |
| 192 | 3300025920 | Ga0207649_10186090 | Ga0207649_101860902 | 366 |
| 193 | 3300025923 | Ga0207681_10265578 | Ga0207681_102655782 | 366 |
| 194 | 3300025937 | Ga0207669_10172669 | Ga0207669_101726692 | 366 |
| 195 | 3300025941 | Ga0207711_10348215 | Ga0207711_103482151 | 366 |
| 196 | 3300025944 | Ga0207661_10061479 | Ga0207661_100614794 | 366 |
| 197 | 3300025961 | Ga0207712_10050947 | Ga0207712_100509472 | 366 |
| 198 | 3300025972 | Ga0207668_10092943 | Ga0207668_100929432 | 366 |
| 199 | 3300026023 | Ga0207677_10030660 | Ga0207677_100306604 | 366 |
| 200 | 3300026067 | Ga0207678_10017844 | Ga0207678_100178444 | 366 |
| 201 | 3300026075 | Ga0207708_10297232 | Ga0207708_102972321 | 366 |
| 202 | 3300026089 | Ga0207648_10114973 | Ga0207648_101149734 | 366 |
| 203 | 3300026095 | Ga0207676_10011817 | Ga0207676_100118174 | 366 |
| 204 | 3300026118 | Ga0207675_100092080 | Ga0207675_1000920803 | 366 |
| 205 | 3300026121 | Ga0207683_10044454 | Ga0207683_100444543 | 366 |
| 206 | 3300026142 | Ga0207698_10164818 | Ga0207698_101648183 | 366 |
| 207 | 3300028379 | Ga0268266_10019523 | Ga0268266_100195233 | 366 |
| 208 | 3300031507 | Ga0307509_10072001 | Ga0307509_100720013 | 366 |
| 209 | 3300031616 | Ga0307508_10079265 | Ga0307508_100792652 | 366 |
| 210 | 3300032004 | Ga0307414_10078197 | Ga0307414_100781973 | 366 |
| 211 | 3300032126 | Ga0307415_100120377 | Ga0307415_1001203773 | 366 |
| 212 | 3300033180 | Ga0307510_10047417 | Ga0307510_100474175 | 366 |
| 213 | 3300033180 | Ga0307510_10090157 | Ga0307510_100901572 | 366 |
| 214 | 3300035691 | Ga0373931_0079883 | Ga0373931_0079883_331_1431 | 366 |
| 215 | 3300035695 | Ga0373927_0081199 | Ga0373927_0081199_536_1636 | 366 |
| 216 | 3300037068 | Ga0373925_0170393 | Ga0373925_0170393_243_1343 | 366 |
| 217 | 3300046472 | Ga0495580_0177107 | Ga0495580_0177107_246_1346 | 366 |
| 218 | 3300046518 | Ga0495631_0079444 | Ga0495631_0079444_47_1147 | 366 |
| 219 | 3300046531 | Ga0495665_0104954 | Ga0495665_0104954_183_1283 | 366 |
| 220 | 3300046615 | Ga0495656_0068626 | Ga0495656_0068626_362_1462 | 366 |
| 221 | 3300048904 | Ga0496101_0005528 | Ga0496101_0005528_1257_2357 | 366 |
| 222 | 3300048904 | Ga0496101_0228648 | Ga0496101_0228648_265_1365 | 366 |
| 223 | 3300048905 | Ga0496102_0014871 | Ga0496102_0014871_4536_5636 | 366 |
| 224 | 3300048905 | Ga0496102_0074461 | Ga0496102_0074461_295_1395 | 366 |
| 225 | 3300048907 | Ga0496104_0240784 | Ga0496104_0240784_199_1299 | 366 |
| 226 | 3300048908 | Ga0496105_0075997 | Ga0496105_0075997_124_1224 | 366 |
| 227 | 3300048908 | Ga0496105_0145193 | Ga0496105_0145193_96_1196 | 366 |
| 228 | 3300048909 | Ga0496106_0099619 | Ga0496106_0099619_470_1570 | 366 |
| 229 | 3300048910 | Ga0496107_0003484 | Ga0496107_0003484_8877_9977 | 366 |
| 230 | 3300048910 | Ga0496107_0069933 | Ga0496107_0069933_294_1394 | 366 |
| 231 | 3300048911 | Ga0496108_0024677 | Ga0496108_0024677_2341_3441 | 366 |
| 232 | 3300048912 | Ga0496109_0157762 | Ga0496109_0157762_282_1382 | 366 |
| 233 | 3300048912 | Ga0496109_0207964 | Ga0496109_0207964_184_1284 | 366 |
| 234 | 3300048913 | Ga0496110_0108854 | Ga0496110_0108854_172_1272 | 366 |
| 235 | 3300048914 | Ga0496111_0054852 | Ga0496111_0054852_1648_2748 | 366 |
| 236 | 3300048914 | Ga0496111_0173080 | Ga0496111_0173080_351_1451 | 366 |
| 237 | 3300048916 | Ga0496113_0163496 | Ga0496113_0163496_127_1227 | 366 |
| 238 | 3300048917 | Ga0496114_0013267 | Ga0496114_0013267_1616_2716 | 366 |
| 239 | 3300048917 | Ga0496114_0087710 | Ga0496114_0087710_745_1845 | 366 |
| 240 | 3300048918 | Ga0496115_0001082 | Ga0496115_0001082_13947_15047 | 366 |
| 241 | 3300048918 | Ga0496115_0028332 | Ga0496115_0028332_1706_2806 | 366 |
| 242 | 3300048924 | Ga0496121_0061244 | Ga0496121_0061244_213_1313 | 366 |
| 243 | 3300048928 | Ga0496125_0103196 | Ga0496125_0103196_147_1247 | 366 |
| 244 | 3300048929 | Ga0496126_0014744 | Ga0496126_0014744_5907_7007 | 366 |
| 245 | 3300049585 | Ga0501069_0107638 | Ga0501069_0107638_250_1350 | 366 |
| 246 | 3300050492 | nmdc:mga0yw44_224195_c1 | nmdc:mga0yw44_224195_c1_134_1234 | 366 |
| 247 | 3300050494 | nmdc:mga06z11_90098_c1 | nmdc:mga06z11_90098_c1_52_1170 | 366 |
| 248 | 3300053096 | Ga0500641_0018102 | Ga0500641_0018102_858_1958 | 366 |
| 249 | 3300053139 | Ga0500568_0021172 | Ga0500568_0021172_390_1490 | 366 |
| 250 | 3300053177 | Ga0500636_0015677 | Ga0500636_0015677_1966_3066 | 366 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oyc-assembly1.cif.gz_v2 | cryo-em structure of the xenopus egg 80s ribosome | 0.774 | 301 | 366 |
| 6teo-assembly2.cif.gz_C | crystal structure of a yeast snu114-prp8 complex | 0.7553 | 301 | 364 |
| 3jb9-assembly1.cif.gz_B | cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution | 0.7518 | 301 | 366 |
| 6bk8-assembly1.cif.gz_B | s. cerevisiae spliceosomal post-catalytic p complex | 0.7451 | 301 | 365 |
| 7dco-assembly1.cif.gz_C | cryo-em structure of the activated spliceosome (bact complex) at an atomic resolution of 2.5 angstrom | 0.731 | 301 | 364 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9MAR2_174_250_3.30.70.240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7645 | 304 | 361 | 3.30.70.240 |
| af_Q57559_8_68_3.30.70.240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7563 | 305 | 361 | 3.30.70.240 |
| af_P36048_853_976_3.30.70.240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.741 | 301 | 362 | 3.30.70.240 |
| af_Q57559_8_68_3.30.70.240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7045 | 305 | 361 | 3.30.70.240 |
| 3rrkA03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6969 | 301 | 361 | 3.30.70.2750 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z2SLX5-F1-model_v4 | Uncharacterized protein | 0.9694 | 1 | 366 |
|
| AF-A0A2V7HY68-F1-model_v4 | Uncharacterized protein | 0.948 | 284 | 366 |
|
| AF-A0A2V6TIQ4-F1-model_v4 | Uncharacterized protein | 0.9394 | 256 | 366 |
|
| AF-A0A2V6TIQ4-F1-model_v4 | Uncharacterized protein | 0.9314 | 256 | 366 |
|
| AF-X5XH88-F1-model_v4 | Uncharacterized protein | 0.9306 | 274 | 364 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar