F361348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 178 | 245 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300005345|Ga0070692_10358647|Ga0070692_103586471 |
| Length | 111 |
| Sequence | MNLKPLGDRLIVLPLDEEQTTSAGIVLPDTALERPQRGSVVAVGPGERSRDTGEVIPLDVAEGDVVVYSKYGGTEIKIEGDEFLILRESDVLAKVVGSESKSKRQPAGATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 2 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003383 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM | Metagenome | Rhizosphere |
| 10 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 92 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 93 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 94 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 95 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 96 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 97 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 99 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 100 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 101 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 102 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 103 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 104 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 105 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 123 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 124 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 125 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 128 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 129 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 130 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 131 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 132 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 133 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 134 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 166 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 175 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 178 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.2 |
| Metatranscriptomes | 22.8 |
| Isolates | 2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.2 |
| Nodule | 0 |
| Rhizoplane | 9.2 |
| Rhizosphere | 84.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000928 | 3300002737 | Bacteria | 18824 |
| 2 | JGI25164J39214_1001942 | 3300002772 | Bacteria | 3793 |
| 3 | JGI25165J46597_1000426 | 3300003214 | Bacteria | 43457 |
| 4 | rootH2_10048205 | 3300003320 | Bacteria | 1091 |
| 5 | JGI26140J50224_103234 | 3300003383 | Bacteria | 603 |
| 6 | Ga0058859_11678356 | 3300004798 | Bacteria | 528 |
| 7 | Ga0058859_11809115 | 3300004798 | Bacteria | 552 |
| 8 | Ga0058861_11932866 | 3300004800 | Bacteria | 501 |
| 9 | Ga0058862_12860229 | 3300004803 | Bacteria | 671 |
| 10 | Ga0065714_10153700 | 3300005288 | Bacteria | 1086 |
| 11 | Ga0065715_10006393 | 3300005293 | Bacteria | 3458 |
| 12 | Ga0070670_100080939 | 3300005331 | Bacteria | 2791 |
| 13 | Ga0070680_100472537 | 3300005336 | Bacteria | 1071 |
| 14 | Ga0070680_101100388 | 3300005336 | Bacteria | 687 |
| 15 | Ga0070689_100937381 | 3300005340 | Bacteria | 767 |
| 16 | Ga0070692_10358647 | 3300005345 | Bacteria | 908 |
| 17 | Ga0070668_100149845 | 3300005347 | Bacteria | 1885 |
| 18 | Ga0070713_101641459 | 3300005436 | Bacteria | 624 |
| 19 | Ga0070705_100143396 | 3300005440 | Bacteria | 1575 |
| 20 | Ga0070705_100817771 | 3300005440 | Bacteria | 743 |
| 21 | Ga0070705_101369633 | 3300005440 | Bacteria | 589 |
| 22 | Ga0070708_100058216 | 3300005445 | Bacteria | 3442 |
| 23 | Ga0070708_100617694 | 3300005445 | Bacteria | 1022 |
| 24 | Ga0070706_100025469 | 3300005467 | Bacteria | 5445 |
| 25 | Ga0070706_101162510 | 3300005467 | Bacteria | 710 |
| 26 | Ga0070707_100033146 | 3300005468 | Bacteria | 4924 |
| 27 | Ga0070707_100113889 | 3300005468 | Bacteria | 2624 |
| 28 | Ga0070707_100941906 | 3300005468 | Bacteria | 828 |
| 29 | Ga0070698_100536691 | 3300005471 | Bacteria | 1109 |
| 30 | Ga0070698_101113826 | 3300005471 | Bacteria | 738 |
| 31 | Ga0070699_100107311 | 3300005518 | Bacteria | 2450 |
| 32 | Ga0070697_100133924 | 3300005536 | Bacteria | 2080 |
| 33 | Ga0070697_101589380 | 3300005536 | Bacteria | 585 |
| 34 | Ga0070695_101076522 | 3300005545 | Bacteria | 657 |
| 35 | Ga0068856_100000668 | 3300005614 | Bacteria | 37241 |
| 36 | Ga0068856_101342833 | 3300005614 | Bacteria | 730 |
| 37 | Ga0068864_100370444 | 3300005618 | Bacteria | 1355 |
| 38 | Ga0068860_100326484 | 3300005843 | Bacteria | 1507 |
| 39 | Ga0068862_100607523 | 3300005844 | Bacteria | 1051 |
| 40 | Ga0081455_10304261 | 3300005937 | Bacteria | 1142 |
| 41 | Ga0070717_10826335 | 3300006028 | Unclassified | 843 |
| 42 | Ga0070712_101027347 | 3300006175 | Bacteria | 714 |
| 43 | Ga0075428_100108792 | 3300006844 | Bacteria | 3021 |
| 44 | Ga0075430_100001230 | 3300006846 | Bacteria | 20604 |
| 45 | Ga0075431_100020433 | 3300006847 | Bacteria | 6765 |
| 46 | Ga0075433_10056211 | 3300006852 | Bacteria | 3436 |
| 47 | Ga0075429_100002525 | 3300006880 | Bacteria | 15404 |
| 48 | Ga0075436_100330079 | 3300006914 | Bacteria | 1097 |
| 49 | Ga0075436_100534529 | 3300006914 | Bacteria | 860 |
| 50 | Ga0111539_10575995 | 3300009094 | Bacteria | 1311 |
| 51 | Ga0105245_10620477 | 3300009098 | Bacteria | 1109 |
| 52 | Ga0105245_10646222 | 3300009098 | Bacteria | 1088 |
| 53 | Ga0105245_10784263 | 3300009098 | Bacteria | 990 |
| 54 | Ga0114129_10078196 | 3300009147 | Bacteria | 4602 |
| 55 | Ga0114129_12193337 | 3300009147 | Bacteria | 665 |
| 56 | Ga0105243_10488209 | 3300009148 | Bacteria | 1164 |
| 57 | Ga0105241_11193062 | 3300009174 | Bacteria | 721 |
| 58 | Ga0105242_11573764 | 3300009176 | Bacteria | 690 |
| 59 | Ga0105248_11591891 | 3300009177 | Bacteria | 740 |
| 60 | Ga0105238_10403767 | 3300009551 | Bacteria | 1360 |
| 61 | Ga0105238_10420830 | 3300009551 | Bacteria | 1331 |
| 62 | Ga0105249_10304287 | 3300009553 | Bacteria | 1600 |
| 63 | Ga0105249_11334897 | 3300009553 | Bacteria | 789 |
| 64 | Ga0105246_12120815 | 3300011119 | Bacteria | 545 |
| 65 | Ga0157371_10134117 | 3300013102 | Bacteria | 1763 |
| 66 | Ga0163162_10174728 | 3300013306 | Bacteria | 2273 |
| 67 | Ga0163162_10593172 | 3300013306 | Bacteria | 1234 |
| 68 | Ga0163162_13201410 | 3300013306 | Bacteria | 525 |
| 69 | Ga0157372_10001702 | 3300013307 | Bacteria | 23833 |
| 70 | Ga0157372_10023651 | 3300013307 | Bacteria | 6665 |
| 71 | Ga0157372_12066549 | 3300013307 | Bacteria | 655 |
| 72 | Ga0157375_11383001 | 3300013308 | Bacteria | 829 |
| 73 | Ga0163163_10935242 | 3300014325 | Bacteria | 930 |
| 74 | Ga0163163_12126785 | 3300014325 | Bacteria | 621 |
| 75 | Ga0157380_11277191 | 3300014326 | Bacteria | 780 |
| 76 | Ga0157379_12204802 | 3300014968 | Bacteria | 547 |
| 77 | Ga0197907_10143387 | 3300020069 | Bacteria | 731 |
| 78 | Ga0206349_1068238 | 3300020075 | Bacteria | 1087 |
| 79 | Ga0206349_1124073 | 3300020075 | Bacteria | 886 |
| 80 | Ga0206349_1770243 | 3300020075 | Bacteria | 995 |
| 81 | Ga0206349_1921572 | 3300020075 | Bacteria | 550 |
| 82 | Ga0206351_10418530 | 3300020077 | Bacteria | 564 |
| 83 | Ga0206351_10558637 | 3300020077 | Bacteria | 1052 |
| 84 | Ga0206351_10572317 | 3300020077 | Bacteria | 1035 |
| 85 | Ga0206351_10943640 | 3300020077 | Bacteria | 555 |
| 86 | Ga0206352_11305611 | 3300020078 | Bacteria | 657 |
| 87 | Ga0206350_10107687 | 3300020080 | Bacteria | 553 |
| 88 | Ga0206350_10119221 | 3300020080 | Bacteria | 989 |
| 89 | Ga0206350_10225158 | 3300020080 | Bacteria | 1015 |
| 90 | Ga0206350_10665992 | 3300020080 | Bacteria | 745 |
| 91 | Ga0206350_11006689 | 3300020080 | Bacteria | 833 |
| 92 | Ga0206350_11594385 | 3300020080 | Bacteria | 541 |
| 93 | Ga0206353_10136228 | 3300020082 | Bacteria | 987 |
| 94 | Ga0206353_10606271 | 3300020082 | Bacteria | 914 |
| 95 | Ga0154015_1085439 | 3300020610 | Bacteria | 765 |
| 96 | Ga0224712_10084632 | 3300022467 | Bacteria | 1316 |
| 97 | Ga0224712_10145314 | 3300022467 | Bacteria | 1047 |
| 98 | Ga0224712_10525131 | 3300022467 | Bacteria | 574 |
| 99 | Ga0224712_10596600 | 3300022467 | Bacteria | 539 |
| 100 | Ga0209563_109687 | 3300025230 | Bacteria | 1444 |
| 101 | Ga0207427_100204 | 3300025231 | Bacteria | 54529 |
| 102 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 103 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 104 | Ga0207642_10392991 | 3300025899 | Bacteria | 828 |
| 105 | Ga0207645_10285609 | 3300025907 | Bacteria | 1096 |
| 106 | Ga0207645_10364765 | 3300025907 | Bacteria | 968 |
| 107 | Ga0207643_10047251 | 3300025908 | Bacteria | 2434 |
| 108 | Ga0207705_10224810 | 3300025909 | Bacteria | 1426 |
| 109 | Ga0207684_10028581 | 3300025910 | Bacteria | 4751 |
| 110 | Ga0207654_11086448 | 3300025911 | Bacteria | 583 |
| 111 | Ga0207695_10492265 | 3300025913 | Bacteria | 1108 |
| 112 | Ga0207652_10776632 | 3300025921 | Bacteria | 852 |
| 113 | Ga0207646_10056638 | 3300025922 | Bacteria | 3503 |
| 114 | Ga0207646_10084681 | 3300025922 | Bacteria | 2837 |
| 115 | Ga0207646_10193011 | 3300025922 | Bacteria | 1839 |
| 116 | Ga0207694_10390667 | 3300025924 | Bacteria | 1156 |
| 117 | Ga0207694_10941380 | 3300025924 | Bacteria | 731 |
| 118 | Ga0207687_10692534 | 3300025927 | Bacteria | 864 |
| 119 | Ga0207709_11261213 | 3300025935 | Bacteria | 610 |
| 120 | Ga0207670_10363269 | 3300025936 | Bacteria | 1149 |
| 121 | Ga0207711_11716967 | 3300025941 | Bacteria | 571 |
| 122 | Ga0207661_10967565 | 3300025944 | Bacteria | 784 |
| 123 | Ga0207702_10001661 | 3300026078 | Bacteria | 21973 |
| 124 | Ga0207702_11655267 | 3300026078 | Bacteria | 633 |
| 125 | Ga0207698_10067142 | 3300026142 | Bacteria | 2827 |
| 126 | Ga0268265_10578255 | 3300028380 | Bacteria | 1070 |
| 127 | Ga0268264_11316737 | 3300028381 | Bacteria | 733 |
| 128 | Ga0265338_10102435 | 3300028800 | Bacteria | 2328 |
| 129 | Ga0265338_11055207 | 3300028800 | Bacteria | 549 |
| 130 | Ga0265339_10014127 | 3300031249 | Bacteria | 4819 |
| 131 | Ga0316575_10289158 | 3300031665 | Bacteria | 692 |
| 132 | Ga0307413_10432164 | 3300031824 | Bacteria | 1040 |
| 133 | Ga0307409_101849372 | 3300031995 | Bacteria | 633 |
| 134 | Ga0307416_102021617 | 3300032002 | Bacteria | 679 |
| 135 | Ga0307414_10001946 | 3300032004 | Bacteria | 10687 |
| 136 | Ga0307414_11060038 | 3300032004 | Bacteria | 747 |
| 137 | Ga0316596_1035716 | 3300033541 | Bacteria | 1299 |
| 138 | Ga0316596_1088635 | 3300033541 | Bacteria | 833 |
| 139 | Ga0373962_0348857 | 3300035242 | Unclassified | 535 |
| 140 | Ga0316574_0045101 | 3300035398 | Bacteria | 2729 |
| 141 | Ga0316584_0420386 | 3300036712 | Bacteria | 949 |
| 142 | Ga0436363_1594160 | 3300039450 | Bacteria | 1494 |
| 143 | Ga0439435_0097692 | 3300042436 | Bacteria | 899 |
| 144 | Ga0466961_0822082 | 3300044693 | Bacteria | 554 |
| 145 | Ga0466960_0641266 | 3300044901 | Bacteria | 633 |
| 146 | Ga0451576_2725156 | 3300045051 | Unclassified | 503 |
| 147 | Ga0466967_1339861 | 3300045976 | Bacteria | 713 |
| 148 | Ga0466967_1348347 | 3300045976 | Bacteria | 710 |
| 149 | Ga0495603_0261786 | 3300046455 | Bacteria | 995 |
| 150 | Ga0495629_0187653 | 3300046459 | Bacteria | 1432 |
| 151 | Ga0495629_0209789 | 3300046459 | Bacteria | 1345 |
| 152 | Ga0495641_0045067 | 3300046461 | Bacteria | 2032 |
| 153 | Ga0495651_0986806 | 3300046462 | Bacteria | 512 |
| 154 | Ga0495606_0007210 | 3300046507 | Bacteria | 10022 |
| 155 | Ga0495630_0272315 | 3300046517 | Bacteria | 1293 |
| 156 | Ga0495586_0100524 | 3300046535 | Bacteria | 1604 |
| 157 | Ga0495656_0069825 | 3300046615 | Bacteria | 1557 |
| 158 | Ga0495634_0086688 | 3300046642 | Bacteria | 2039 |
| 159 | Ga0495611_0412585 | 3300046648 | Bacteria | 617 |
| 160 | Ga0495661_0428254 | 3300046665 | Bacteria | 640 |
| 161 | Ga0495647_0311869 | 3300046681 | Bacteria | 711 |
| 162 | Ga0495674_0626027 | 3300047319 | Bacteria | 850 |
| 163 | Ga0496100_0590201 | 3300048903 | Bacteria | 862 |
| 164 | Ga0496101_0254794 | 3300048904 | Bacteria | 1368 |
| 165 | Ga0496102_1523292 | 3300048905 | Bacteria | 587 |
| 166 | Ga0496104_0181751 | 3300048907 | Bacteria | 2013 |
| 167 | Ga0496104_0314380 | 3300048907 | Bacteria | 1479 |
| 168 | Ga0496104_1359666 | 3300048907 | Bacteria | 613 |
| 169 | Ga0496105_0296545 | 3300048908 | Bacteria | 1301 |
| 170 | Ga0496105_1233959 | 3300048908 | Bacteria | 549 |
| 171 | Ga0496108_0066485 | 3300048911 | Bacteria | 3040 |
| 172 | Ga0496108_0161708 | 3300048911 | Bacteria | 1935 |
| 173 | Ga0496109_0029200 | 3300048912 | Bacteria | 4938 |
| 174 | Ga0496109_0029556 | 3300048912 | Bacteria | 4909 |
| 175 | Ga0496109_0151215 | 3300048912 | Bacteria | 2173 |
| 176 | Ga0496110_0299132 | 3300048913 | Bacteria | 1466 |
| 177 | Ga0496110_0315732 | 3300048913 | Bacteria | 1423 |
| 178 | Ga0496110_1068366 | 3300048913 | Bacteria | 715 |
| 179 | Ga0496111_0040074 | 3300048914 | Bacteria | 3360 |
| 180 | Ga0496111_0347885 | 3300048914 | Bacteria | 1097 |
| 181 | Ga0496111_1195010 | 3300048914 | Bacteria | 539 |
| 182 | Ga0496112_0207083 | 3300048915 | Bacteria | 1919 |
| 183 | Ga0496113_0412330 | 3300048916 | Bacteria | 1085 |
| 184 | Ga0496113_0438196 | 3300048916 | Bacteria | 1050 |
| 185 | Ga0496115_0371769 | 3300048918 | Bacteria | 1163 |
| 186 | Ga0496122_0105832 | 3300048925 | Bacteria | 1864 |
| 187 | Ga0496126_0369398 | 3300048929 | Bacteria | 1170 |
| 188 | Ga0501306_004100 | 3300049127 | Bacteria | 1614 |
| 189 | Ga0501306_005631 | 3300049127 | Bacteria | 1445 |
| 190 | Ga0501308_002296 | 3300049128 | Bacteria | 1662 |
| 191 | Ga0501310_005228 | 3300049130 | Bacteria | 1328 |
| 192 | Ga0501307_003363 | 3300049162 | Bacteria | 1564 |
| 193 | Ga0501307_070618 | 3300049162 | Bacteria | 556 |
| 194 | Ga0501311_003860 | 3300049527 | Bacteria | 1563 |
| 195 | Ga0501311_017916 | 3300049527 | Bacteria | 936 |
| 196 | Ga0501312_005201 | 3300049528 | Bacteria | 1571 |
| 197 | Ga0501313_013643 | 3300049529 | Bacteria | 956 |
| 198 | Ga0501313_042331 | 3300049529 | Bacteria | 615 |
| 199 | Ga0501314_042153 | 3300049530 | Bacteria | 535 |
| 200 | Ga0501315_003381 | 3300049531 | Bacteria | 1591 |
| 201 | Ga0501316_003256 | 3300049532 | Bacteria | 1565 |
| 202 | Ga0501318_003597 | 3300049534 | Bacteria | 1432 |
| 203 | Ga0501318_032972 | 3300049534 | Bacteria | 712 |
| 204 | Ga0501318_034577 | 3300049534 | Bacteria | 701 |
| 205 | Ga0501319_010826 | 3300049535 | Bacteria | 730 |
| 206 | Ga0501320_056844 | 3300049536 | Bacteria | 543 |
| 207 | Ga0501321_089089 | 3300049537 | Bacteria | 501 |
| 208 | Ga0501322_013657 | 3300049538 | Bacteria | 657 |
| 209 | Ga0501323_006181 | 3300049539 | Bacteria | 1334 |
| 210 | Ga0501324_026942 | 3300049540 | Bacteria | 612 |
| 211 | Ga0501331_06733 | 3300049547 | Bacteria | 674 |
| 212 | Ga0501332_09271 | 3300049548 | Bacteria | 647 |
| 213 | Ga0501335_009298 | 3300049551 | Bacteria | 935 |
| 214 | Ga0501335_045637 | 3300049551 | Bacteria | 525 |
| 215 | Ga0501336_008607 | 3300049552 | Bacteria | 792 |
| 216 | Ga0501031_0955092 | 3300049568 | Bacteria | 548 |
| 217 | Ga0501032_0765045 | 3300049569 | Bacteria | 611 |
| 218 | Ga0501037_0903569 | 3300049573 | Bacteria | 579 |
| 219 | Ga0501038_0115324 | 3300049574 | Bacteria | 2221 |
| 220 | Ga0501038_1182615 | 3300049574 | Bacteria | 556 |
| 221 | Ga0501041_0131086 | 3300049577 | Bacteria | 1561 |
| 222 | Ga0501041_0227131 | 3300049577 | Bacteria | 1172 |
| 223 | Ga0501042_0405317 | 3300049578 | Bacteria | 988 |
| 224 | Ga0501048_0548294 | 3300049582 | Bacteria | 829 |
| 225 | Ga0501067_0542580 | 3300049583 | Bacteria | 651 |
| 226 | Ga0501071_0651627 | 3300049587 | Bacteria | 810 |
| 227 | Ga0501076_0135841 | 3300049592 | Bacteria | 1996 |
| 228 | Ga0501076_1196576 | 3300049592 | Bacteria | 625 |
| 229 | Ga0501202_184662 | 3300049652 | Bacteria | 564 |
| 230 | Ga0501081_0040520 | 3300049743 | Bacteria | 3189 |
| 231 | Ga0501081_0539584 | 3300049743 | Bacteria | 871 |
| 232 | Ga0501083_0318818 | 3300049744 | Bacteria | 1011 |
| 233 | Ga0501035_0055468 | 3300049822 | Bacteria | 3538 |
| 234 | nmdc:mga05p37_180623_c1 | 3300050507 | Bacteria | 2567 |
| 235 | nmdc:mga09592_16106_c1 | 3300050508 | Bacteria | 6110 |
| 236 | nmdc:mga0qj67_5495_c1 | 3300050509 | Bacteria | 9266 |
| 237 | nmdc:mga06r32_34995_c1 | 3300050510 | Bacteria | 4739 |
| 238 | nmdc:mga08x19_300929_c1 | 3300050514 | Bacteria | 1114 |
| 239 | Ga0500608_091261 | 3300053122 | Bacteria | 1424 |
| 240 | Ga0501084_0109115 | 3300054114 | Bacteria | 2325 |
| 241 | Ga0501082_0704448 | 3300060353 | Bacteria | 884 |
| 242 | Ga0501082_1633832 | 3300060353 | Bacteria | 562 |
| 243 | Ga0501082_1638686 | 3300060353 | Bacteria | 562 |
| 244 | Ga0530510_0109550 | 3300061734 | Bacteria | 2022 |
| 245 | Ga0530510_1056928 | 3300061734 | Bacteria | 622 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013102 | Ga0157371_10134117 | Ga0157371_101341172 | 78 |
| 2 | 3300013307 | Ga0157372_10001702 | Ga0157372_1000170215 | 78 |
| 3 | 3300006844 | Ga0075428_100108792 | Ga0075428_1001087922 | 81 |
| 4 | 3300006846 | Ga0075430_100001230 | Ga0075430_10000123020 | 81 |
| 5 | 3300006847 | Ga0075431_100020433 | Ga0075431_1000204336 | 81 |
| 6 | 3300006880 | Ga0075429_100002525 | Ga0075429_10000252515 | 81 |
| 7 | 3300009147 | Ga0114129_10078196 | Ga0114129_100781969 | 81 |
| 8 | 3300050507 | nmdc:mga05p37_180623_c1 | nmdc:mga05p37_180623_c1_927_1229 | 81 |
| 9 | 3300050508 | nmdc:mga09592_16106_c1 | nmdc:mga09592_16106_c1_2759_3061 | 81 |
| 10 | 3300050509 | nmdc:mga0qj67_5495_c1 | nmdc:mga0qj67_5495_c1_1122_1424 | 81 |
| 11 | 3300050510 | nmdc:mga06r32_34995_c1 | nmdc:mga06r32_34995_c1_4125_4427 | 81 |
| 12 | 3300061734 | Ga0530510_1056928 | Ga0530510_1056928_260_559 | 81 |
| 13 | 3300049127 | Ga0501306_004100 | Ga0501306_004100_21_299 | 82 |
| 14 | 3300049128 | Ga0501308_002296 | Ga0501308_002296_19_297 | 82 |
| 15 | 3300049162 | Ga0501307_003363 | Ga0501307_003363_19_297 | 82 |
| 16 | 3300049527 | Ga0501311_003860 | Ga0501311_003860_19_297 | 82 |
| 17 | 3300049528 | Ga0501312_005201 | Ga0501312_005201_20_298 | 82 |
| 18 | 3300049529 | Ga0501313_013643 | Ga0501313_013643_10_288 | 82 |
| 19 | 3300049529 | Ga0501313_042331 | Ga0501313_042331_10_288 | 82 |
| 20 | 3300049531 | Ga0501315_003381 | Ga0501315_003381_32_307 | 82 |
| 21 | 3300049532 | Ga0501316_003256 | Ga0501316_003256_19_297 | 82 |
| 22 | 3300049538 | Ga0501322_013657 | Ga0501322_013657_19_297 | 82 |
| 23 | 3300049540 | Ga0501324_026942 | Ga0501324_026942_18_296 | 82 |
| 24 | 3300049547 | Ga0501331_06733 | Ga0501331_06733_19_297 | 82 |
| 25 | 3300049551 | Ga0501335_009298 | Ga0501335_009298_17_295 | 82 |
| 26 | 3300049552 | Ga0501336_008607 | Ga0501336_008607_16_294 | 82 |
| 27 | 3300049652 | Ga0501202_184662 | Ga0501202_184662_242_520 | 82 |
| 28 | 3300005937 | Ga0081455_10304261 | Ga0081455_103042612 | 83 |
| 29 | 3300009174 | Ga0105241_11193062 | Ga0105241_111930622 | 83 |
| 30 | 3300013307 | Ga0157372_10023651 | Ga0157372_100236514 | 83 |
| 31 | 3300025911 | Ga0207654_11086448 | Ga0207654_110864481 | 83 |
| 32 | 3300049548 | Ga0501332_09271 | Ga0501332_09271_19_297 | 83 |
| 33 | 3300049569 | Ga0501032_0765045 | Ga0501032_0765045_34_309 | 84 |
| 34 | 3300049573 | Ga0501037_0903569 | Ga0501037_0903569_223_498 | 84 |
| 35 | 3300049743 | Ga0501081_0539584 | Ga0501081_0539584_221_496 | 84 |
| 36 | 3300060353 | Ga0501082_0704448 | Ga0501082_0704448_24_299 | 84 |
| 37 | 3300049574 | Ga0501038_1182615 | Ga0501038_1182615_189_473 | 87 |
| 38 | 3300049577 | Ga0501041_0227131 | Ga0501041_0227131_345_629 | 87 |
| 39 | iso_pu_bacteria | 2852623160 | 2852625598 | 87 |
| 40 | iso_pu_bacteria | 2884933994 | 2884934597 | 87 |
| 41 | iso_pu_bacteria | 8036736890 | 8036737254 | 87 |
| 42 | 3300025899 | Ga0207642_10392991 | Ga0207642_103929912 | 88 |
| 43 | 3300031665 | Ga0316575_10289158 | Ga0316575_102891582 | 88 |
| 44 | 3300049534 | Ga0501318_034577 | Ga0501318_034577_188_553 | 88 |
| 45 | 3300049574 | Ga0501038_0115324 | Ga0501038_0115324_994_1278 | 88 |
| 46 | 3300049577 | Ga0501041_0131086 | Ga0501041_0131086_147_431 | 88 |
| 47 | 3300049578 | Ga0501042_0405317 | Ga0501042_0405317_534_818 | 88 |
| 48 | 3300049582 | Ga0501048_0548294 | Ga0501048_0548294_78_362 | 88 |
| 49 | 3300049583 | Ga0501067_0542580 | Ga0501067_0542580_309_593 | 88 |
| 50 | 3300049587 | Ga0501071_0651627 | Ga0501071_0651627_270_554 | 88 |
| 51 | 3300049592 | Ga0501076_0135841 | Ga0501076_0135841_623_907 | 88 |
| 52 | 3300049743 | Ga0501081_0040520 | Ga0501081_0040520_138_422 | 88 |
| 53 | 3300049744 | Ga0501083_0318818 | Ga0501083_0318818_411_695 | 88 |
| 54 | 3300054114 | Ga0501084_0109115 | Ga0501084_0109115_462_746 | 88 |
| 55 | 3300060353 | Ga0501082_1633832 | Ga0501082_1633832_99_383 | 88 |
| 56 | 3300061734 | Ga0530510_0109550 | Ga0530510_0109550_709_993 | 88 |
| 57 | iso_pu_bacteria | 2884634485 | 2884636520 | 88 |
| 58 | iso_pu_bacteria | 2919692658 | 2919696456 | 88 |
| 59 | 3300004798 | Ga0058859_11809115 | Ga0058859_118091152 | 89 |
| 60 | 3300004803 | Ga0058862_12860229 | Ga0058862_128602292 | 89 |
| 61 | 3300005331 | Ga0070670_100080939 | Ga0070670_1000809392 | 89 |
| 62 | 3300005336 | Ga0070680_101100388 | Ga0070680_1011003882 | 89 |
| 63 | 3300005345 | Ga0070692_10358647 | Ga0070692_103586471 | 89 |
| 64 | 3300005436 | Ga0070713_101641459 | Ga0070713_1016414591 | 89 |
| 65 | 3300005440 | Ga0070705_101369633 | Ga0070705_1013696331 | 89 |
| 66 | 3300005471 | Ga0070698_100536691 | Ga0070698_1005366912 | 89 |
| 67 | 3300005536 | Ga0070697_101589380 | Ga0070697_1015893801 | 89 |
| 68 | 3300005844 | Ga0068862_100607523 | Ga0068862_1006075232 | 89 |
| 69 | 3300006028 | Ga0070717_10826335 | Ga0070717_108263352 | 89 |
| 70 | 3300006175 | Ga0070712_101027347 | Ga0070712_1010273472 | 89 |
| 71 | 3300006852 | Ga0075433_10056211 | Ga0075433_100562113 | 89 |
| 72 | 3300006914 | Ga0075436_100534529 | Ga0075436_1005345292 | 89 |
| 73 | 3300009098 | Ga0105245_10620477 | Ga0105245_106204772 | 89 |
| 74 | 3300009148 | Ga0105243_10488209 | Ga0105243_104882092 | 89 |
| 75 | 3300009176 | Ga0105242_11573764 | Ga0105242_115737642 | 89 |
| 76 | 3300009177 | Ga0105248_11591891 | Ga0105248_115918912 | 89 |
| 77 | 3300009553 | Ga0105249_11334897 | Ga0105249_113348972 | 89 |
| 78 | 3300011119 | Ga0105246_12120815 | Ga0105246_121208152 | 89 |
| 79 | 3300013306 | Ga0163162_13201410 | Ga0163162_132014101 | 89 |
| 80 | 3300013307 | Ga0157372_12066549 | Ga0157372_120665492 | 89 |
| 81 | 3300013308 | Ga0157375_11383001 | Ga0157375_113830011 | 89 |
| 82 | 3300014325 | Ga0163163_12126785 | Ga0163163_121267851 | 89 |
| 83 | 3300014326 | Ga0157380_11277191 | Ga0157380_112771912 | 89 |
| 84 | 3300014968 | Ga0157379_12204802 | Ga0157379_122048021 | 89 |
| 85 | 3300020069 | Ga0197907_10143387 | Ga0197907_101433872 | 89 |
| 86 | 3300020075 | Ga0206349_1068238 | Ga0206349_10682382 | 89 |
| 87 | 3300020075 | Ga0206349_1124073 | Ga0206349_11240732 | 89 |
| 88 | 3300020075 | Ga0206349_1770243 | Ga0206349_17702431 | 89 |
| 89 | 3300020075 | Ga0206349_1921572 | Ga0206349_19215721 | 89 |
| 90 | 3300020077 | Ga0206351_10418530 | Ga0206351_104185302 | 89 |
| 91 | 3300020077 | Ga0206351_10558637 | Ga0206351_105586371 | 89 |
| 92 | 3300020077 | Ga0206351_10572317 | Ga0206351_105723172 | 89 |
| 93 | 3300020077 | Ga0206351_10943640 | Ga0206351_109436402 | 89 |
| 94 | 3300020078 | Ga0206352_11305611 | Ga0206352_113056111 | 89 |
| 95 | 3300020080 | Ga0206350_10107687 | Ga0206350_101076872 | 89 |
| 96 | 3300020080 | Ga0206350_10119221 | Ga0206350_101192212 | 89 |
| 97 | 3300020080 | Ga0206350_10225158 | Ga0206350_102251582 | 89 |
| 98 | 3300020080 | Ga0206350_10665992 | Ga0206350_106659922 | 89 |
| 99 | 3300020080 | Ga0206350_11006689 | Ga0206350_110066892 | 89 |
| 100 | 3300020080 | Ga0206350_11594385 | Ga0206350_115943852 | 89 |
| 101 | 3300020082 | Ga0206353_10136228 | Ga0206353_101362282 | 89 |
| 102 | 3300020082 | Ga0206353_10606271 | Ga0206353_106062712 | 89 |
| 103 | 3300020610 | Ga0154015_1085439 | Ga0154015_10854391 | 89 |
| 104 | 3300022467 | Ga0224712_10084632 | Ga0224712_100846322 | 89 |
| 105 | 3300022467 | Ga0224712_10145314 | Ga0224712_101453141 | 89 |
| 106 | 3300022467 | Ga0224712_10525131 | Ga0224712_105251311 | 89 |
| 107 | 3300022467 | Ga0224712_10596600 | Ga0224712_105966001 | 89 |
| 108 | 3300025907 | Ga0207645_10364765 | Ga0207645_103647652 | 89 |
| 109 | 3300025921 | Ga0207652_10776632 | Ga0207652_107766322 | 89 |
| 110 | 3300025927 | Ga0207687_10692534 | Ga0207687_106925341 | 89 |
| 111 | 3300025941 | Ga0207711_11716967 | Ga0207711_117169672 | 89 |
| 112 | 3300028380 | Ga0268265_10578255 | Ga0268265_105782552 | 89 |
| 113 | 3300028800 | Ga0265338_10102435 | Ga0265338_101024352 | 89 |
| 114 | 3300028800 | Ga0265338_11055207 | Ga0265338_110552071 | 89 |
| 115 | 3300031249 | Ga0265339_10014127 | Ga0265339_100141272 | 89 |
| 116 | 3300031995 | Ga0307409_101849372 | Ga0307409_1018493721 | 89 |
| 117 | 3300035242 | Ga0373962_0348857 | Ga0373962_0348857_68_388 | 89 |
| 118 | 3300039450 | Ga0436363_1594160 | Ga0436363_1594160_891_1226 | 89 |
| 119 | 3300042436 | Ga0439435_0097692 | Ga0439435_0097692_410_718 | 89 |
| 120 | 3300044693 | Ga0466961_0822082 | Ga0466961_0822082_29_364 | 89 |
| 121 | 3300044901 | Ga0466960_0641266 | Ga0466960_0641266_240_560 | 89 |
| 122 | 3300045051 | Ga0451576_2725156 | Ga0451576_2725156_87_395 | 89 |
| 123 | 3300045976 | Ga0466967_1339861 | Ga0466967_1339861_148_483 | 89 |
| 124 | 3300045976 | Ga0466967_1348347 | Ga0466967_1348347_290_610 | 89 |
| 125 | 3300046455 | Ga0495603_0261786 | Ga0495603_0261786_104_424 | 89 |
| 126 | 3300046459 | Ga0495629_0187653 | Ga0495629_0187653_124_444 | 89 |
| 127 | 3300046459 | Ga0495629_0209789 | Ga0495629_0209789_291_611 | 89 |
| 128 | 3300046461 | Ga0495641_0045067 | Ga0495641_0045067_233_553 | 89 |
| 129 | 3300046462 | Ga0495651_0986806 | Ga0495651_0986806_22_342 | 89 |
| 130 | 3300046517 | Ga0495630_0272315 | Ga0495630_0272315_776_1096 | 89 |
| 131 | 3300046535 | Ga0495586_0100524 | Ga0495586_0100524_154_474 | 89 |
| 132 | 3300046642 | Ga0495634_0086688 | Ga0495634_0086688_1570_1890 | 89 |
| 133 | 3300047319 | Ga0495674_0626027 | Ga0495674_0626027_113_433 | 89 |
| 134 | 3300048903 | Ga0496100_0590201 | Ga0496100_0590201_307_627 | 89 |
| 135 | 3300048904 | Ga0496101_0254794 | Ga0496101_0254794_1019_1339 | 89 |
| 136 | 3300048905 | Ga0496102_1523292 | Ga0496102_1523292_225_545 | 89 |
| 137 | 3300048907 | Ga0496104_0181751 | Ga0496104_0181751_457_777 | 89 |
| 138 | 3300048907 | Ga0496104_1359666 | Ga0496104_1359666_155_475 | 89 |
| 139 | 3300048912 | Ga0496109_0151215 | Ga0496109_0151215_163_483 | 89 |
| 140 | 3300048913 | Ga0496110_0299132 | Ga0496110_0299132_164_490 | 89 |
| 141 | 3300048913 | Ga0496110_1068366 | Ga0496110_1068366_100_420 | 89 |
| 142 | 3300048914 | Ga0496111_0347885 | Ga0496111_0347885_667_987 | 89 |
| 143 | 3300048914 | Ga0496111_1195010 | Ga0496111_1195010_111_431 | 89 |
| 144 | 3300048915 | Ga0496112_0207083 | Ga0496112_0207083_871_1191 | 89 |
| 145 | 3300048916 | Ga0496113_0438196 | Ga0496113_0438196_190_510 | 89 |
| 146 | 3300004798 | Ga0058859_11678356 | Ga0058859_116783561 | 90 |
| 147 | 3300005336 | Ga0070680_100472537 | Ga0070680_1004725372 | 90 |
| 148 | 3300005340 | Ga0070689_100937381 | Ga0070689_1009373811 | 90 |
| 149 | 3300005347 | Ga0070668_100149845 | Ga0070668_1001498451 | 90 |
| 150 | 3300005440 | Ga0070705_100143396 | Ga0070705_1001433961 | 90 |
| 151 | 3300005440 | Ga0070705_100817771 | Ga0070705_1008177712 | 90 |
| 152 | 3300005445 | Ga0070708_100058216 | Ga0070708_1000582162 | 90 |
| 153 | 3300005445 | Ga0070708_100617694 | Ga0070708_1006176941 | 90 |
| 154 | 3300005467 | Ga0070706_100025469 | Ga0070706_1000254696 | 90 |
| 155 | 3300005467 | Ga0070706_101162510 | Ga0070706_1011625101 | 90 |
| 156 | 3300005468 | Ga0070707_100033146 | Ga0070707_1000331465 | 90 |
| 157 | 3300005468 | Ga0070707_100113889 | Ga0070707_1001138891 | 90 |
| 158 | 3300005468 | Ga0070707_100941906 | Ga0070707_1009419061 | 90 |
| 159 | 3300005471 | Ga0070698_101113826 | Ga0070698_1011138261 | 90 |
| 160 | 3300005518 | Ga0070699_100107311 | Ga0070699_1001073112 | 90 |
| 161 | 3300005536 | Ga0070697_100133924 | Ga0070697_1001339242 | 90 |
| 162 | 3300005545 | Ga0070695_101076522 | Ga0070695_1010765221 | 90 |
| 163 | 3300005843 | Ga0068860_100326484 | Ga0068860_1003264842 | 90 |
| 164 | 3300009098 | Ga0105245_10646222 | Ga0105245_106462222 | 90 |
| 165 | 3300009098 | Ga0105245_10784263 | Ga0105245_107842633 | 90 |
| 166 | 3300009553 | Ga0105249_10304287 | Ga0105249_103042872 | 90 |
| 167 | 3300013306 | Ga0163162_10593172 | Ga0163162_105931722 | 90 |
| 168 | 3300025907 | Ga0207645_10285609 | Ga0207645_102856092 | 90 |
| 169 | 3300025908 | Ga0207643_10047251 | Ga0207643_100472512 | 90 |
| 170 | 3300025910 | Ga0207684_10028581 | Ga0207684_100285814 | 90 |
| 171 | 3300025922 | Ga0207646_10056638 | Ga0207646_100566384 | 90 |
| 172 | 3300025922 | Ga0207646_10084681 | Ga0207646_100846812 | 90 |
| 173 | 3300025922 | Ga0207646_10193011 | Ga0207646_101930113 | 90 |
| 174 | 3300025936 | Ga0207670_10363269 | Ga0207670_103632692 | 90 |
| 175 | 3300035398 | Ga0316574_0045101 | Ga0316574_0045101_1315_1617 | 90 |
| 176 | 3300036712 | Ga0316584_0420386 | Ga0316584_0420386_342_644 | 90 |
| 177 | 3300046615 | Ga0495656_0069825 | Ga0495656_0069825_764_1063 | 90 |
| 178 | 3300046648 | Ga0495611_0412585 | Ga0495611_0412585_191_490 | 90 |
| 179 | 3300046665 | Ga0495661_0428254 | Ga0495661_0428254_129_428 | 90 |
| 180 | 3300046681 | Ga0495647_0311869 | Ga0495647_0311869_32_373 | 90 |
| 181 | 3300048907 | Ga0496104_0314380 | Ga0496104_0314380_1149_1448 | 90 |
| 182 | 3300048908 | Ga0496105_0296545 | Ga0496105_0296545_417_716 | 90 |
| 183 | 3300048908 | Ga0496105_1233959 | Ga0496105_1233959_191_529 | 90 |
| 184 | 3300048911 | Ga0496108_0066485 | Ga0496108_0066485_2170_2508 | 90 |
| 185 | 3300048911 | Ga0496108_0161708 | Ga0496108_0161708_406_705 | 90 |
| 186 | 3300048912 | Ga0496109_0029200 | Ga0496109_0029200_1284_1583 | 90 |
| 187 | 3300048912 | Ga0496109_0029556 | Ga0496109_0029556_1174_1512 | 90 |
| 188 | 3300048913 | Ga0496110_0315732 | Ga0496110_0315732_726_1064 | 90 |
| 189 | 3300048914 | Ga0496111_0040074 | Ga0496111_0040074_2522_2860 | 90 |
| 190 | 3300048916 | Ga0496113_0412330 | Ga0496113_0412330_691_1029 | 90 |
| 191 | 3300002737 | JGI25162J39368_1000928 | JGI25162J39368_100092811 | 91 |
| 192 | 3300002772 | JGI25164J39214_1001942 | JGI25164J39214_10019424 | 91 |
| 193 | 3300003214 | JGI25165J46597_1000426 | JGI25165J46597_100042639 | 91 |
| 194 | 3300003320 | rootH2_10048205 | rootH2_100482052 | 91 |
| 195 | 3300003383 | JGI26140J50224_103234 | JGI26140J50224_1032341 | 91 |
| 196 | 3300004800 | Ga0058861_11932866 | Ga0058861_119328661 | 91 |
| 197 | 3300005288 | Ga0065714_10153700 | Ga0065714_101537001 | 91 |
| 198 | 3300005293 | Ga0065715_10006393 | Ga0065715_100063932 | 91 |
| 199 | 3300005614 | Ga0068856_100000668 | Ga0068856_10000066822 | 91 |
| 200 | 3300005614 | Ga0068856_101342833 | Ga0068856_1013428332 | 91 |
| 201 | 3300005618 | Ga0068864_100370444 | Ga0068864_1003704443 | 91 |
| 202 | 3300006914 | Ga0075436_100330079 | Ga0075436_1003300792 | 91 |
| 203 | 3300009094 | Ga0111539_10575995 | Ga0111539_105759952 | 91 |
| 204 | 3300009147 | Ga0114129_12193337 | Ga0114129_121933371 | 91 |
| 205 | 3300009551 | Ga0105238_10403767 | Ga0105238_104037673 | 91 |
| 206 | 3300009551 | Ga0105238_10420830 | Ga0105238_104208302 | 91 |
| 207 | 3300013306 | Ga0163162_10174728 | Ga0163162_101747283 | 91 |
| 208 | 3300014325 | Ga0163163_10935242 | Ga0163163_109352422 | 91 |
| 209 | 3300025230 | Ga0209563_109687 | Ga0209563_1096872 | 91 |
| 210 | 3300025231 | Ga0207427_100204 | Ga0207427_10020411 | 91 |
| 211 | 3300025233 | Ga0209437_100048 | Ga0209437_100048333 | 91 |
| 212 | 3300025261 | Ga0209233_1000029 | Ga0209233_100002943 | 91 |
| 213 | 3300025909 | Ga0207705_10224810 | Ga0207705_102248102 | 91 |
| 214 | 3300025913 | Ga0207695_10492265 | Ga0207695_104922652 | 91 |
| 215 | 3300025924 | Ga0207694_10390667 | Ga0207694_103906671 | 91 |
| 216 | 3300025924 | Ga0207694_10941380 | Ga0207694_109413801 | 91 |
| 217 | 3300025935 | Ga0207709_11261213 | Ga0207709_112612131 | 91 |
| 218 | 3300025944 | Ga0207661_10967565 | Ga0207661_109675652 | 91 |
| 219 | 3300026078 | Ga0207702_10001661 | Ga0207702_100016613 | 91 |
| 220 | 3300026078 | Ga0207702_11655267 | Ga0207702_116552671 | 91 |
| 221 | 3300026142 | Ga0207698_10067142 | Ga0207698_100671422 | 91 |
| 222 | 3300028381 | Ga0268264_11316737 | Ga0268264_113167372 | 91 |
| 223 | 3300031824 | Ga0307413_10432164 | Ga0307413_104321642 | 91 |
| 224 | 3300032002 | Ga0307416_102021617 | Ga0307416_1020216171 | 91 |
| 225 | 3300032004 | Ga0307414_10001946 | Ga0307414_100019464 | 91 |
| 226 | 3300032004 | Ga0307414_11060038 | Ga0307414_110600382 | 91 |
| 227 | 3300033541 | Ga0316596_1035716 | Ga0316596_10357162 | 91 |
| 228 | 3300033541 | Ga0316596_1088635 | Ga0316596_10886352 | 91 |
| 229 | 3300046507 | Ga0495606_0007210 | Ga0495606_0007210_476_751 | 91 |
| 230 | 3300048918 | Ga0496115_0371769 | Ga0496115_0371769_289_591 | 91 |
| 231 | 3300048925 | Ga0496122_0105832 | Ga0496122_0105832_146_421 | 91 |
| 232 | 3300048929 | Ga0496126_0369398 | Ga0496126_0369398_572_847 | 91 |
| 233 | 3300049127 | Ga0501306_005631 | Ga0501306_005631_64_375 | 91 |
| 234 | 3300049130 | Ga0501310_005228 | Ga0501310_005228_963_1274 | 91 |
| 235 | 3300049162 | Ga0501307_070618 | Ga0501307_070618_42_368 | 91 |
| 236 | 3300049527 | Ga0501311_017916 | Ga0501311_017916_624_920 | 91 |
| 237 | 3300049530 | Ga0501314_042153 | Ga0501314_042153_27_305 | 91 |
| 238 | 3300049534 | Ga0501318_003597 | Ga0501318_003597_56_367 | 91 |
| 239 | 3300049534 | Ga0501318_032972 | Ga0501318_032972_50_391 | 91 |
| 240 | 3300049535 | Ga0501319_010826 | Ga0501319_010826_55_366 | 91 |
| 241 | 3300049536 | Ga0501320_056844 | Ga0501320_056844_170_481 | 91 |
| 242 | 3300049537 | Ga0501321_089089 | Ga0501321_089089_30_356 | 91 |
| 243 | 3300049539 | Ga0501323_006181 | Ga0501323_006181_971_1282 | 91 |
| 244 | 3300049551 | Ga0501335_045637 | Ga0501335_045637_137_478 | 91 |
| 245 | 3300049568 | Ga0501031_0955092 | Ga0501031_0955092_110_436 | 91 |
| 246 | 3300049592 | Ga0501076_1196576 | Ga0501076_1196576_114_419 | 91 |
| 247 | 3300049822 | Ga0501035_0055468 | Ga0501035_0055468_1376_1711 | 91 |
| 248 | 3300050514 | nmdc:mga08x19_300929_c1 | nmdc:mga08x19_300929_c1_431_733 | 91 |
| 249 | 3300053122 | Ga0500608_091261 | Ga0500608_091261_1013_1288 | 91 |
| 250 | 3300060353 | Ga0501082_1638686 | Ga0501082_1638686_92_397 | 91 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wnr-assembly1.cif.gz_E | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.8462 | 5 | 91 |
| 1wnr-assembly1.cif.gz_G | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.845 | 5 | 91 |
| 1wnr-assembly1.cif.gz_C | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.8423 | 5 | 91 |
| 1wnr-assembly1.cif.gz_G | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.8176 | 5 | 91 |
| 1wnr-assembly1.cif.gz_C | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.8143 | 5 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8582 | 5 | 91 | 2.30.33.40 |
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8251 | 5 | 91 | 2.30.33.40 |
| af_Q9VU35_1_103_2.30.33.40 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8102 | 4 | 91 | 2.30.33.40 |
| 3nx6A00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8097 | 5 | 91 | 2.30.33.40 |
| af_C0PKD9_55_155_2.30.33.40 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8025 | 5 | 91 | 2.30.33.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4UPP3-F1-model_v4 | Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) | 0.9401 | 5 | 91 |
GO:0005524
GO:0005737 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A800BSC9-F1-model_v4 | Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) | 0.9393 | 2 | 91 |
GO:0005524
GO:0005737 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-T0N8G6-F1-model_v4 | deleted | 0.9389 | 2 | 91 |
|
| AF-A0A536ND37-F1-model_v4 | Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) | 0.9335 | 2 | 91 |
GO:0005524
GO:0005737 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A1V5XL32-F1-model_v4 | Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) | 0.927 | 1 | 91 |
GO:0005524
GO:0005737 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar