F361348

General Info

Members Datasets Scaffolds Average Seq Length
250 178 245 99

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10358647|Ga0070692_103586471
Length 111
Sequence MNLKPLGDRLIVLPLDEEQTTSAGIVLPDTALERPQRGSVVAVGPGERSRDTGEVIPLDVAEGDVVVYSKYGGTEIKIEGDEFLILRESDVLAKVVGSESKSKRQPAGATA

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.2
Metatranscriptomes 22.8
Isolates 2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 9.2
Rhizosphere 84.8
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000928 3300002737 Bacteria 18824
2 JGI25164J39214_1001942 3300002772 Bacteria 3793
3 JGI25165J46597_1000426 3300003214 Bacteria 43457
4 rootH2_10048205 3300003320 Bacteria 1091
5 JGI26140J50224_103234 3300003383 Bacteria 603
6 Ga0058859_11678356 3300004798 Bacteria 528
7 Ga0058859_11809115 3300004798 Bacteria 552
8 Ga0058861_11932866 3300004800 Bacteria 501
9 Ga0058862_12860229 3300004803 Bacteria 671
10 Ga0065714_10153700 3300005288 Bacteria 1086
11 Ga0065715_10006393 3300005293 Bacteria 3458
12 Ga0070670_100080939 3300005331 Bacteria 2791
13 Ga0070680_100472537 3300005336 Bacteria 1071
14 Ga0070680_101100388 3300005336 Bacteria 687
15 Ga0070689_100937381 3300005340 Bacteria 767
16 Ga0070692_10358647 3300005345 Bacteria 908
17 Ga0070668_100149845 3300005347 Bacteria 1885
18 Ga0070713_101641459 3300005436 Bacteria 624
19 Ga0070705_100143396 3300005440 Bacteria 1575
20 Ga0070705_100817771 3300005440 Bacteria 743
21 Ga0070705_101369633 3300005440 Bacteria 589
22 Ga0070708_100058216 3300005445 Bacteria 3442
23 Ga0070708_100617694 3300005445 Bacteria 1022
24 Ga0070706_100025469 3300005467 Bacteria 5445
25 Ga0070706_101162510 3300005467 Bacteria 710
26 Ga0070707_100033146 3300005468 Bacteria 4924
27 Ga0070707_100113889 3300005468 Bacteria 2624
28 Ga0070707_100941906 3300005468 Bacteria 828
29 Ga0070698_100536691 3300005471 Bacteria 1109
30 Ga0070698_101113826 3300005471 Bacteria 738
31 Ga0070699_100107311 3300005518 Bacteria 2450
32 Ga0070697_100133924 3300005536 Bacteria 2080
33 Ga0070697_101589380 3300005536 Bacteria 585
34 Ga0070695_101076522 3300005545 Bacteria 657
35 Ga0068856_100000668 3300005614 Bacteria 37241
36 Ga0068856_101342833 3300005614 Bacteria 730
37 Ga0068864_100370444 3300005618 Bacteria 1355
38 Ga0068860_100326484 3300005843 Bacteria 1507
39 Ga0068862_100607523 3300005844 Bacteria 1051
40 Ga0081455_10304261 3300005937 Bacteria 1142
41 Ga0070717_10826335 3300006028 Unclassified 843
42 Ga0070712_101027347 3300006175 Bacteria 714
43 Ga0075428_100108792 3300006844 Bacteria 3021
44 Ga0075430_100001230 3300006846 Bacteria 20604
45 Ga0075431_100020433 3300006847 Bacteria 6765
46 Ga0075433_10056211 3300006852 Bacteria 3436
47 Ga0075429_100002525 3300006880 Bacteria 15404
48 Ga0075436_100330079 3300006914 Bacteria 1097
49 Ga0075436_100534529 3300006914 Bacteria 860
50 Ga0111539_10575995 3300009094 Bacteria 1311
51 Ga0105245_10620477 3300009098 Bacteria 1109
52 Ga0105245_10646222 3300009098 Bacteria 1088
53 Ga0105245_10784263 3300009098 Bacteria 990
54 Ga0114129_10078196 3300009147 Bacteria 4602
55 Ga0114129_12193337 3300009147 Bacteria 665
56 Ga0105243_10488209 3300009148 Bacteria 1164
57 Ga0105241_11193062 3300009174 Bacteria 721
58 Ga0105242_11573764 3300009176 Bacteria 690
59 Ga0105248_11591891 3300009177 Bacteria 740
60 Ga0105238_10403767 3300009551 Bacteria 1360
61 Ga0105238_10420830 3300009551 Bacteria 1331
62 Ga0105249_10304287 3300009553 Bacteria 1600
63 Ga0105249_11334897 3300009553 Bacteria 789
64 Ga0105246_12120815 3300011119 Bacteria 545
65 Ga0157371_10134117 3300013102 Bacteria 1763
66 Ga0163162_10174728 3300013306 Bacteria 2273
67 Ga0163162_10593172 3300013306 Bacteria 1234
68 Ga0163162_13201410 3300013306 Bacteria 525
69 Ga0157372_10001702 3300013307 Bacteria 23833
70 Ga0157372_10023651 3300013307 Bacteria 6665
71 Ga0157372_12066549 3300013307 Bacteria 655
72 Ga0157375_11383001 3300013308 Bacteria 829
73 Ga0163163_10935242 3300014325 Bacteria 930
74 Ga0163163_12126785 3300014325 Bacteria 621
75 Ga0157380_11277191 3300014326 Bacteria 780
76 Ga0157379_12204802 3300014968 Bacteria 547
77 Ga0197907_10143387 3300020069 Bacteria 731
78 Ga0206349_1068238 3300020075 Bacteria 1087
79 Ga0206349_1124073 3300020075 Bacteria 886
80 Ga0206349_1770243 3300020075 Bacteria 995
81 Ga0206349_1921572 3300020075 Bacteria 550
82 Ga0206351_10418530 3300020077 Bacteria 564
83 Ga0206351_10558637 3300020077 Bacteria 1052
84 Ga0206351_10572317 3300020077 Bacteria 1035
85 Ga0206351_10943640 3300020077 Bacteria 555
86 Ga0206352_11305611 3300020078 Bacteria 657
87 Ga0206350_10107687 3300020080 Bacteria 553
88 Ga0206350_10119221 3300020080 Bacteria 989
89 Ga0206350_10225158 3300020080 Bacteria 1015
90 Ga0206350_10665992 3300020080 Bacteria 745
91 Ga0206350_11006689 3300020080 Bacteria 833
92 Ga0206350_11594385 3300020080 Bacteria 541
93 Ga0206353_10136228 3300020082 Bacteria 987
94 Ga0206353_10606271 3300020082 Bacteria 914
95 Ga0154015_1085439 3300020610 Bacteria 765
96 Ga0224712_10084632 3300022467 Bacteria 1316
97 Ga0224712_10145314 3300022467 Bacteria 1047
98 Ga0224712_10525131 3300022467 Bacteria 574
99 Ga0224712_10596600 3300022467 Bacteria 539
100 Ga0209563_109687 3300025230 Bacteria 1444
101 Ga0207427_100204 3300025231 Bacteria 54529
102 Ga0209437_100048 3300025233 Bacteria 405107
103 Ga0209233_1000029 3300025261 Bacteria 641642
104 Ga0207642_10392991 3300025899 Bacteria 828
105 Ga0207645_10285609 3300025907 Bacteria 1096
106 Ga0207645_10364765 3300025907 Bacteria 968
107 Ga0207643_10047251 3300025908 Bacteria 2434
108 Ga0207705_10224810 3300025909 Bacteria 1426
109 Ga0207684_10028581 3300025910 Bacteria 4751
110 Ga0207654_11086448 3300025911 Bacteria 583
111 Ga0207695_10492265 3300025913 Bacteria 1108
112 Ga0207652_10776632 3300025921 Bacteria 852
113 Ga0207646_10056638 3300025922 Bacteria 3503
114 Ga0207646_10084681 3300025922 Bacteria 2837
115 Ga0207646_10193011 3300025922 Bacteria 1839
116 Ga0207694_10390667 3300025924 Bacteria 1156
117 Ga0207694_10941380 3300025924 Bacteria 731
118 Ga0207687_10692534 3300025927 Bacteria 864
119 Ga0207709_11261213 3300025935 Bacteria 610
120 Ga0207670_10363269 3300025936 Bacteria 1149
121 Ga0207711_11716967 3300025941 Bacteria 571
122 Ga0207661_10967565 3300025944 Bacteria 784
123 Ga0207702_10001661 3300026078 Bacteria 21973
124 Ga0207702_11655267 3300026078 Bacteria 633
125 Ga0207698_10067142 3300026142 Bacteria 2827
126 Ga0268265_10578255 3300028380 Bacteria 1070
127 Ga0268264_11316737 3300028381 Bacteria 733
128 Ga0265338_10102435 3300028800 Bacteria 2328
129 Ga0265338_11055207 3300028800 Bacteria 549
130 Ga0265339_10014127 3300031249 Bacteria 4819
131 Ga0316575_10289158 3300031665 Bacteria 692
132 Ga0307413_10432164 3300031824 Bacteria 1040
133 Ga0307409_101849372 3300031995 Bacteria 633
134 Ga0307416_102021617 3300032002 Bacteria 679
135 Ga0307414_10001946 3300032004 Bacteria 10687
136 Ga0307414_11060038 3300032004 Bacteria 747
137 Ga0316596_1035716 3300033541 Bacteria 1299
138 Ga0316596_1088635 3300033541 Bacteria 833
139 Ga0373962_0348857 3300035242 Unclassified 535
140 Ga0316574_0045101 3300035398 Bacteria 2729
141 Ga0316584_0420386 3300036712 Bacteria 949
142 Ga0436363_1594160 3300039450 Bacteria 1494
143 Ga0439435_0097692 3300042436 Bacteria 899
144 Ga0466961_0822082 3300044693 Bacteria 554
145 Ga0466960_0641266 3300044901 Bacteria 633
146 Ga0451576_2725156 3300045051 Unclassified 503
147 Ga0466967_1339861 3300045976 Bacteria 713
148 Ga0466967_1348347 3300045976 Bacteria 710
149 Ga0495603_0261786 3300046455 Bacteria 995
150 Ga0495629_0187653 3300046459 Bacteria 1432
151 Ga0495629_0209789 3300046459 Bacteria 1345
152 Ga0495641_0045067 3300046461 Bacteria 2032
153 Ga0495651_0986806 3300046462 Bacteria 512
154 Ga0495606_0007210 3300046507 Bacteria 10022
155 Ga0495630_0272315 3300046517 Bacteria 1293
156 Ga0495586_0100524 3300046535 Bacteria 1604
157 Ga0495656_0069825 3300046615 Bacteria 1557
158 Ga0495634_0086688 3300046642 Bacteria 2039
159 Ga0495611_0412585 3300046648 Bacteria 617
160 Ga0495661_0428254 3300046665 Bacteria 640
161 Ga0495647_0311869 3300046681 Bacteria 711
162 Ga0495674_0626027 3300047319 Bacteria 850
163 Ga0496100_0590201 3300048903 Bacteria 862
164 Ga0496101_0254794 3300048904 Bacteria 1368
165 Ga0496102_1523292 3300048905 Bacteria 587
166 Ga0496104_0181751 3300048907 Bacteria 2013
167 Ga0496104_0314380 3300048907 Bacteria 1479
168 Ga0496104_1359666 3300048907 Bacteria 613
169 Ga0496105_0296545 3300048908 Bacteria 1301
170 Ga0496105_1233959 3300048908 Bacteria 549
171 Ga0496108_0066485 3300048911 Bacteria 3040
172 Ga0496108_0161708 3300048911 Bacteria 1935
173 Ga0496109_0029200 3300048912 Bacteria 4938
174 Ga0496109_0029556 3300048912 Bacteria 4909
175 Ga0496109_0151215 3300048912 Bacteria 2173
176 Ga0496110_0299132 3300048913 Bacteria 1466
177 Ga0496110_0315732 3300048913 Bacteria 1423
178 Ga0496110_1068366 3300048913 Bacteria 715
179 Ga0496111_0040074 3300048914 Bacteria 3360
180 Ga0496111_0347885 3300048914 Bacteria 1097
181 Ga0496111_1195010 3300048914 Bacteria 539
182 Ga0496112_0207083 3300048915 Bacteria 1919
183 Ga0496113_0412330 3300048916 Bacteria 1085
184 Ga0496113_0438196 3300048916 Bacteria 1050
185 Ga0496115_0371769 3300048918 Bacteria 1163
186 Ga0496122_0105832 3300048925 Bacteria 1864
187 Ga0496126_0369398 3300048929 Bacteria 1170
188 Ga0501306_004100 3300049127 Bacteria 1614
189 Ga0501306_005631 3300049127 Bacteria 1445
190 Ga0501308_002296 3300049128 Bacteria 1662
191 Ga0501310_005228 3300049130 Bacteria 1328
192 Ga0501307_003363 3300049162 Bacteria 1564
193 Ga0501307_070618 3300049162 Bacteria 556
194 Ga0501311_003860 3300049527 Bacteria 1563
195 Ga0501311_017916 3300049527 Bacteria 936
196 Ga0501312_005201 3300049528 Bacteria 1571
197 Ga0501313_013643 3300049529 Bacteria 956
198 Ga0501313_042331 3300049529 Bacteria 615
199 Ga0501314_042153 3300049530 Bacteria 535
200 Ga0501315_003381 3300049531 Bacteria 1591
201 Ga0501316_003256 3300049532 Bacteria 1565
202 Ga0501318_003597 3300049534 Bacteria 1432
203 Ga0501318_032972 3300049534 Bacteria 712
204 Ga0501318_034577 3300049534 Bacteria 701
205 Ga0501319_010826 3300049535 Bacteria 730
206 Ga0501320_056844 3300049536 Bacteria 543
207 Ga0501321_089089 3300049537 Bacteria 501
208 Ga0501322_013657 3300049538 Bacteria 657
209 Ga0501323_006181 3300049539 Bacteria 1334
210 Ga0501324_026942 3300049540 Bacteria 612
211 Ga0501331_06733 3300049547 Bacteria 674
212 Ga0501332_09271 3300049548 Bacteria 647
213 Ga0501335_009298 3300049551 Bacteria 935
214 Ga0501335_045637 3300049551 Bacteria 525
215 Ga0501336_008607 3300049552 Bacteria 792
216 Ga0501031_0955092 3300049568 Bacteria 548
217 Ga0501032_0765045 3300049569 Bacteria 611
218 Ga0501037_0903569 3300049573 Bacteria 579
219 Ga0501038_0115324 3300049574 Bacteria 2221
220 Ga0501038_1182615 3300049574 Bacteria 556
221 Ga0501041_0131086 3300049577 Bacteria 1561
222 Ga0501041_0227131 3300049577 Bacteria 1172
223 Ga0501042_0405317 3300049578 Bacteria 988
224 Ga0501048_0548294 3300049582 Bacteria 829
225 Ga0501067_0542580 3300049583 Bacteria 651
226 Ga0501071_0651627 3300049587 Bacteria 810
227 Ga0501076_0135841 3300049592 Bacteria 1996
228 Ga0501076_1196576 3300049592 Bacteria 625
229 Ga0501202_184662 3300049652 Bacteria 564
230 Ga0501081_0040520 3300049743 Bacteria 3189
231 Ga0501081_0539584 3300049743 Bacteria 871
232 Ga0501083_0318818 3300049744 Bacteria 1011
233 Ga0501035_0055468 3300049822 Bacteria 3538
234 nmdc:mga05p37_180623_c1 3300050507 Bacteria 2567
235 nmdc:mga09592_16106_c1 3300050508 Bacteria 6110
236 nmdc:mga0qj67_5495_c1 3300050509 Bacteria 9266
237 nmdc:mga06r32_34995_c1 3300050510 Bacteria 4739
238 nmdc:mga08x19_300929_c1 3300050514 Bacteria 1114
239 Ga0500608_091261 3300053122 Bacteria 1424
240 Ga0501084_0109115 3300054114 Bacteria 2325
241 Ga0501082_0704448 3300060353 Bacteria 884
242 Ga0501082_1633832 3300060353 Bacteria 562
243 Ga0501082_1638686 3300060353 Bacteria 562
244 Ga0530510_0109550 3300061734 Bacteria 2022
245 Ga0530510_1056928 3300061734 Bacteria 622

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10134117 Ga0157371_101341172 78
2 3300013307 Ga0157372_10001702 Ga0157372_1000170215 78
3 3300006844 Ga0075428_100108792 Ga0075428_1001087922 81
4 3300006846 Ga0075430_100001230 Ga0075430_10000123020 81
5 3300006847 Ga0075431_100020433 Ga0075431_1000204336 81
6 3300006880 Ga0075429_100002525 Ga0075429_10000252515 81
7 3300009147 Ga0114129_10078196 Ga0114129_100781969 81
8 3300050507 nmdc:mga05p37_180623_c1 nmdc:mga05p37_180623_c1_927_1229 81
9 3300050508 nmdc:mga09592_16106_c1 nmdc:mga09592_16106_c1_2759_3061 81
10 3300050509 nmdc:mga0qj67_5495_c1 nmdc:mga0qj67_5495_c1_1122_1424 81
11 3300050510 nmdc:mga06r32_34995_c1 nmdc:mga06r32_34995_c1_4125_4427 81
12 3300061734 Ga0530510_1056928 Ga0530510_1056928_260_559 81
13 3300049127 Ga0501306_004100 Ga0501306_004100_21_299 82
14 3300049128 Ga0501308_002296 Ga0501308_002296_19_297 82
15 3300049162 Ga0501307_003363 Ga0501307_003363_19_297 82
16 3300049527 Ga0501311_003860 Ga0501311_003860_19_297 82
17 3300049528 Ga0501312_005201 Ga0501312_005201_20_298 82
18 3300049529 Ga0501313_013643 Ga0501313_013643_10_288 82
19 3300049529 Ga0501313_042331 Ga0501313_042331_10_288 82
20 3300049531 Ga0501315_003381 Ga0501315_003381_32_307 82
21 3300049532 Ga0501316_003256 Ga0501316_003256_19_297 82
22 3300049538 Ga0501322_013657 Ga0501322_013657_19_297 82
23 3300049540 Ga0501324_026942 Ga0501324_026942_18_296 82
24 3300049547 Ga0501331_06733 Ga0501331_06733_19_297 82
25 3300049551 Ga0501335_009298 Ga0501335_009298_17_295 82
26 3300049552 Ga0501336_008607 Ga0501336_008607_16_294 82
27 3300049652 Ga0501202_184662 Ga0501202_184662_242_520 82
28 3300005937 Ga0081455_10304261 Ga0081455_103042612 83
29 3300009174 Ga0105241_11193062 Ga0105241_111930622 83
30 3300013307 Ga0157372_10023651 Ga0157372_100236514 83
31 3300025911 Ga0207654_11086448 Ga0207654_110864481 83
32 3300049548 Ga0501332_09271 Ga0501332_09271_19_297 83
33 3300049569 Ga0501032_0765045 Ga0501032_0765045_34_309 84
34 3300049573 Ga0501037_0903569 Ga0501037_0903569_223_498 84
35 3300049743 Ga0501081_0539584 Ga0501081_0539584_221_496 84
36 3300060353 Ga0501082_0704448 Ga0501082_0704448_24_299 84
37 3300049574 Ga0501038_1182615 Ga0501038_1182615_189_473 87
38 3300049577 Ga0501041_0227131 Ga0501041_0227131_345_629 87
39 iso_pu_bacteria 2852623160 2852625598 87
40 iso_pu_bacteria 2884933994 2884934597 87
41 iso_pu_bacteria 8036736890 8036737254 87
42 3300025899 Ga0207642_10392991 Ga0207642_103929912 88
43 3300031665 Ga0316575_10289158 Ga0316575_102891582 88
44 3300049534 Ga0501318_034577 Ga0501318_034577_188_553 88
45 3300049574 Ga0501038_0115324 Ga0501038_0115324_994_1278 88
46 3300049577 Ga0501041_0131086 Ga0501041_0131086_147_431 88
47 3300049578 Ga0501042_0405317 Ga0501042_0405317_534_818 88
48 3300049582 Ga0501048_0548294 Ga0501048_0548294_78_362 88
49 3300049583 Ga0501067_0542580 Ga0501067_0542580_309_593 88
50 3300049587 Ga0501071_0651627 Ga0501071_0651627_270_554 88
51 3300049592 Ga0501076_0135841 Ga0501076_0135841_623_907 88
52 3300049743 Ga0501081_0040520 Ga0501081_0040520_138_422 88
53 3300049744 Ga0501083_0318818 Ga0501083_0318818_411_695 88
54 3300054114 Ga0501084_0109115 Ga0501084_0109115_462_746 88
55 3300060353 Ga0501082_1633832 Ga0501082_1633832_99_383 88
56 3300061734 Ga0530510_0109550 Ga0530510_0109550_709_993 88
57 iso_pu_bacteria 2884634485 2884636520 88
58 iso_pu_bacteria 2919692658 2919696456 88
59 3300004798 Ga0058859_11809115 Ga0058859_118091152 89
60 3300004803 Ga0058862_12860229 Ga0058862_128602292 89
61 3300005331 Ga0070670_100080939 Ga0070670_1000809392 89
62 3300005336 Ga0070680_101100388 Ga0070680_1011003882 89
63 3300005345 Ga0070692_10358647 Ga0070692_103586471 89
64 3300005436 Ga0070713_101641459 Ga0070713_1016414591 89
65 3300005440 Ga0070705_101369633 Ga0070705_1013696331 89
66 3300005471 Ga0070698_100536691 Ga0070698_1005366912 89
67 3300005536 Ga0070697_101589380 Ga0070697_1015893801 89
68 3300005844 Ga0068862_100607523 Ga0068862_1006075232 89
69 3300006028 Ga0070717_10826335 Ga0070717_108263352 89
70 3300006175 Ga0070712_101027347 Ga0070712_1010273472 89
71 3300006852 Ga0075433_10056211 Ga0075433_100562113 89
72 3300006914 Ga0075436_100534529 Ga0075436_1005345292 89
73 3300009098 Ga0105245_10620477 Ga0105245_106204772 89
74 3300009148 Ga0105243_10488209 Ga0105243_104882092 89
75 3300009176 Ga0105242_11573764 Ga0105242_115737642 89
76 3300009177 Ga0105248_11591891 Ga0105248_115918912 89
77 3300009553 Ga0105249_11334897 Ga0105249_113348972 89
78 3300011119 Ga0105246_12120815 Ga0105246_121208152 89
79 3300013306 Ga0163162_13201410 Ga0163162_132014101 89
80 3300013307 Ga0157372_12066549 Ga0157372_120665492 89
81 3300013308 Ga0157375_11383001 Ga0157375_113830011 89
82 3300014325 Ga0163163_12126785 Ga0163163_121267851 89
83 3300014326 Ga0157380_11277191 Ga0157380_112771912 89
84 3300014968 Ga0157379_12204802 Ga0157379_122048021 89
85 3300020069 Ga0197907_10143387 Ga0197907_101433872 89
86 3300020075 Ga0206349_1068238 Ga0206349_10682382 89
87 3300020075 Ga0206349_1124073 Ga0206349_11240732 89
88 3300020075 Ga0206349_1770243 Ga0206349_17702431 89
89 3300020075 Ga0206349_1921572 Ga0206349_19215721 89
90 3300020077 Ga0206351_10418530 Ga0206351_104185302 89
91 3300020077 Ga0206351_10558637 Ga0206351_105586371 89
92 3300020077 Ga0206351_10572317 Ga0206351_105723172 89
93 3300020077 Ga0206351_10943640 Ga0206351_109436402 89
94 3300020078 Ga0206352_11305611 Ga0206352_113056111 89
95 3300020080 Ga0206350_10107687 Ga0206350_101076872 89
96 3300020080 Ga0206350_10119221 Ga0206350_101192212 89
97 3300020080 Ga0206350_10225158 Ga0206350_102251582 89
98 3300020080 Ga0206350_10665992 Ga0206350_106659922 89
99 3300020080 Ga0206350_11006689 Ga0206350_110066892 89
100 3300020080 Ga0206350_11594385 Ga0206350_115943852 89
101 3300020082 Ga0206353_10136228 Ga0206353_101362282 89
102 3300020082 Ga0206353_10606271 Ga0206353_106062712 89
103 3300020610 Ga0154015_1085439 Ga0154015_10854391 89
104 3300022467 Ga0224712_10084632 Ga0224712_100846322 89
105 3300022467 Ga0224712_10145314 Ga0224712_101453141 89
106 3300022467 Ga0224712_10525131 Ga0224712_105251311 89
107 3300022467 Ga0224712_10596600 Ga0224712_105966001 89
108 3300025907 Ga0207645_10364765 Ga0207645_103647652 89
109 3300025921 Ga0207652_10776632 Ga0207652_107766322 89
110 3300025927 Ga0207687_10692534 Ga0207687_106925341 89
111 3300025941 Ga0207711_11716967 Ga0207711_117169672 89
112 3300028380 Ga0268265_10578255 Ga0268265_105782552 89
113 3300028800 Ga0265338_10102435 Ga0265338_101024352 89
114 3300028800 Ga0265338_11055207 Ga0265338_110552071 89
115 3300031249 Ga0265339_10014127 Ga0265339_100141272 89
116 3300031995 Ga0307409_101849372 Ga0307409_1018493721 89
117 3300035242 Ga0373962_0348857 Ga0373962_0348857_68_388 89
118 3300039450 Ga0436363_1594160 Ga0436363_1594160_891_1226 89
119 3300042436 Ga0439435_0097692 Ga0439435_0097692_410_718 89
120 3300044693 Ga0466961_0822082 Ga0466961_0822082_29_364 89
121 3300044901 Ga0466960_0641266 Ga0466960_0641266_240_560 89
122 3300045051 Ga0451576_2725156 Ga0451576_2725156_87_395 89
123 3300045976 Ga0466967_1339861 Ga0466967_1339861_148_483 89
124 3300045976 Ga0466967_1348347 Ga0466967_1348347_290_610 89
125 3300046455 Ga0495603_0261786 Ga0495603_0261786_104_424 89
126 3300046459 Ga0495629_0187653 Ga0495629_0187653_124_444 89
127 3300046459 Ga0495629_0209789 Ga0495629_0209789_291_611 89
128 3300046461 Ga0495641_0045067 Ga0495641_0045067_233_553 89
129 3300046462 Ga0495651_0986806 Ga0495651_0986806_22_342 89
130 3300046517 Ga0495630_0272315 Ga0495630_0272315_776_1096 89
131 3300046535 Ga0495586_0100524 Ga0495586_0100524_154_474 89
132 3300046642 Ga0495634_0086688 Ga0495634_0086688_1570_1890 89
133 3300047319 Ga0495674_0626027 Ga0495674_0626027_113_433 89
134 3300048903 Ga0496100_0590201 Ga0496100_0590201_307_627 89
135 3300048904 Ga0496101_0254794 Ga0496101_0254794_1019_1339 89
136 3300048905 Ga0496102_1523292 Ga0496102_1523292_225_545 89
137 3300048907 Ga0496104_0181751 Ga0496104_0181751_457_777 89
138 3300048907 Ga0496104_1359666 Ga0496104_1359666_155_475 89
139 3300048912 Ga0496109_0151215 Ga0496109_0151215_163_483 89
140 3300048913 Ga0496110_0299132 Ga0496110_0299132_164_490 89
141 3300048913 Ga0496110_1068366 Ga0496110_1068366_100_420 89
142 3300048914 Ga0496111_0347885 Ga0496111_0347885_667_987 89
143 3300048914 Ga0496111_1195010 Ga0496111_1195010_111_431 89
144 3300048915 Ga0496112_0207083 Ga0496112_0207083_871_1191 89
145 3300048916 Ga0496113_0438196 Ga0496113_0438196_190_510 89
146 3300004798 Ga0058859_11678356 Ga0058859_116783561 90
147 3300005336 Ga0070680_100472537 Ga0070680_1004725372 90
148 3300005340 Ga0070689_100937381 Ga0070689_1009373811 90
149 3300005347 Ga0070668_100149845 Ga0070668_1001498451 90
150 3300005440 Ga0070705_100143396 Ga0070705_1001433961 90
151 3300005440 Ga0070705_100817771 Ga0070705_1008177712 90
152 3300005445 Ga0070708_100058216 Ga0070708_1000582162 90
153 3300005445 Ga0070708_100617694 Ga0070708_1006176941 90
154 3300005467 Ga0070706_100025469 Ga0070706_1000254696 90
155 3300005467 Ga0070706_101162510 Ga0070706_1011625101 90
156 3300005468 Ga0070707_100033146 Ga0070707_1000331465 90
157 3300005468 Ga0070707_100113889 Ga0070707_1001138891 90
158 3300005468 Ga0070707_100941906 Ga0070707_1009419061 90
159 3300005471 Ga0070698_101113826 Ga0070698_1011138261 90
160 3300005518 Ga0070699_100107311 Ga0070699_1001073112 90
161 3300005536 Ga0070697_100133924 Ga0070697_1001339242 90
162 3300005545 Ga0070695_101076522 Ga0070695_1010765221 90
163 3300005843 Ga0068860_100326484 Ga0068860_1003264842 90
164 3300009098 Ga0105245_10646222 Ga0105245_106462222 90
165 3300009098 Ga0105245_10784263 Ga0105245_107842633 90
166 3300009553 Ga0105249_10304287 Ga0105249_103042872 90
167 3300013306 Ga0163162_10593172 Ga0163162_105931722 90
168 3300025907 Ga0207645_10285609 Ga0207645_102856092 90
169 3300025908 Ga0207643_10047251 Ga0207643_100472512 90
170 3300025910 Ga0207684_10028581 Ga0207684_100285814 90
171 3300025922 Ga0207646_10056638 Ga0207646_100566384 90
172 3300025922 Ga0207646_10084681 Ga0207646_100846812 90
173 3300025922 Ga0207646_10193011 Ga0207646_101930113 90
174 3300025936 Ga0207670_10363269 Ga0207670_103632692 90
175 3300035398 Ga0316574_0045101 Ga0316574_0045101_1315_1617 90
176 3300036712 Ga0316584_0420386 Ga0316584_0420386_342_644 90
177 3300046615 Ga0495656_0069825 Ga0495656_0069825_764_1063 90
178 3300046648 Ga0495611_0412585 Ga0495611_0412585_191_490 90
179 3300046665 Ga0495661_0428254 Ga0495661_0428254_129_428 90
180 3300046681 Ga0495647_0311869 Ga0495647_0311869_32_373 90
181 3300048907 Ga0496104_0314380 Ga0496104_0314380_1149_1448 90
182 3300048908 Ga0496105_0296545 Ga0496105_0296545_417_716 90
183 3300048908 Ga0496105_1233959 Ga0496105_1233959_191_529 90
184 3300048911 Ga0496108_0066485 Ga0496108_0066485_2170_2508 90
185 3300048911 Ga0496108_0161708 Ga0496108_0161708_406_705 90
186 3300048912 Ga0496109_0029200 Ga0496109_0029200_1284_1583 90
187 3300048912 Ga0496109_0029556 Ga0496109_0029556_1174_1512 90
188 3300048913 Ga0496110_0315732 Ga0496110_0315732_726_1064 90
189 3300048914 Ga0496111_0040074 Ga0496111_0040074_2522_2860 90
190 3300048916 Ga0496113_0412330 Ga0496113_0412330_691_1029 90
191 3300002737 JGI25162J39368_1000928 JGI25162J39368_100092811 91
192 3300002772 JGI25164J39214_1001942 JGI25164J39214_10019424 91
193 3300003214 JGI25165J46597_1000426 JGI25165J46597_100042639 91
194 3300003320 rootH2_10048205 rootH2_100482052 91
195 3300003383 JGI26140J50224_103234 JGI26140J50224_1032341 91
196 3300004800 Ga0058861_11932866 Ga0058861_119328661 91
197 3300005288 Ga0065714_10153700 Ga0065714_101537001 91
198 3300005293 Ga0065715_10006393 Ga0065715_100063932 91
199 3300005614 Ga0068856_100000668 Ga0068856_10000066822 91
200 3300005614 Ga0068856_101342833 Ga0068856_1013428332 91
201 3300005618 Ga0068864_100370444 Ga0068864_1003704443 91
202 3300006914 Ga0075436_100330079 Ga0075436_1003300792 91
203 3300009094 Ga0111539_10575995 Ga0111539_105759952 91
204 3300009147 Ga0114129_12193337 Ga0114129_121933371 91
205 3300009551 Ga0105238_10403767 Ga0105238_104037673 91
206 3300009551 Ga0105238_10420830 Ga0105238_104208302 91
207 3300013306 Ga0163162_10174728 Ga0163162_101747283 91
208 3300014325 Ga0163163_10935242 Ga0163163_109352422 91
209 3300025230 Ga0209563_109687 Ga0209563_1096872 91
210 3300025231 Ga0207427_100204 Ga0207427_10020411 91
211 3300025233 Ga0209437_100048 Ga0209437_100048333 91
212 3300025261 Ga0209233_1000029 Ga0209233_100002943 91
213 3300025909 Ga0207705_10224810 Ga0207705_102248102 91
214 3300025913 Ga0207695_10492265 Ga0207695_104922652 91
215 3300025924 Ga0207694_10390667 Ga0207694_103906671 91
216 3300025924 Ga0207694_10941380 Ga0207694_109413801 91
217 3300025935 Ga0207709_11261213 Ga0207709_112612131 91
218 3300025944 Ga0207661_10967565 Ga0207661_109675652 91
219 3300026078 Ga0207702_10001661 Ga0207702_100016613 91
220 3300026078 Ga0207702_11655267 Ga0207702_116552671 91
221 3300026142 Ga0207698_10067142 Ga0207698_100671422 91
222 3300028381 Ga0268264_11316737 Ga0268264_113167372 91
223 3300031824 Ga0307413_10432164 Ga0307413_104321642 91
224 3300032002 Ga0307416_102021617 Ga0307416_1020216171 91
225 3300032004 Ga0307414_10001946 Ga0307414_100019464 91
226 3300032004 Ga0307414_11060038 Ga0307414_110600382 91
227 3300033541 Ga0316596_1035716 Ga0316596_10357162 91
228 3300033541 Ga0316596_1088635 Ga0316596_10886352 91
229 3300046507 Ga0495606_0007210 Ga0495606_0007210_476_751 91
230 3300048918 Ga0496115_0371769 Ga0496115_0371769_289_591 91
231 3300048925 Ga0496122_0105832 Ga0496122_0105832_146_421 91
232 3300048929 Ga0496126_0369398 Ga0496126_0369398_572_847 91
233 3300049127 Ga0501306_005631 Ga0501306_005631_64_375 91
234 3300049130 Ga0501310_005228 Ga0501310_005228_963_1274 91
235 3300049162 Ga0501307_070618 Ga0501307_070618_42_368 91
236 3300049527 Ga0501311_017916 Ga0501311_017916_624_920 91
237 3300049530 Ga0501314_042153 Ga0501314_042153_27_305 91
238 3300049534 Ga0501318_003597 Ga0501318_003597_56_367 91
239 3300049534 Ga0501318_032972 Ga0501318_032972_50_391 91
240 3300049535 Ga0501319_010826 Ga0501319_010826_55_366 91
241 3300049536 Ga0501320_056844 Ga0501320_056844_170_481 91
242 3300049537 Ga0501321_089089 Ga0501321_089089_30_356 91
243 3300049539 Ga0501323_006181 Ga0501323_006181_971_1282 91
244 3300049551 Ga0501335_045637 Ga0501335_045637_137_478 91
245 3300049568 Ga0501031_0955092 Ga0501031_0955092_110_436 91
246 3300049592 Ga0501076_1196576 Ga0501076_1196576_114_419 91
247 3300049822 Ga0501035_0055468 Ga0501035_0055468_1376_1711 91
248 3300050514 nmdc:mga08x19_300929_c1 nmdc:mga08x19_300929_c1_431_733 91
249 3300053122 Ga0500608_091261 Ga0500608_091261_1013_1288 91
250 3300060353 Ga0501082_1638686 Ga0501082_1638686_92_397 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00166

Cpn10

Chaperonin 10 Kd subunit

2

95

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.8462 5 91
1wnr-assembly1.cif.gz_G crystal structure of the cpn10 from thermus thermophilus hb8 0.845 5 91
1wnr-assembly1.cif.gz_C crystal structure of the cpn10 from thermus thermophilus hb8 0.8423 5 91
1wnr-assembly1.cif.gz_G crystal structure of the cpn10 from thermus thermophilus hb8 0.8176 5 91
1wnr-assembly1.cif.gz_C crystal structure of the cpn10 from thermus thermophilus hb8 0.8143 5 91
ID Description Score Start End Superfamily
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8582 5 91 2.30.33.40
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8251 5 91 2.30.33.40
af_Q9VU35_1_103_2.30.33.40 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8102 4 91 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8097 5 91 2.30.33.40
af_C0PKD9_55_155_2.30.33.40 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8025 5 91 2.30.33.40
ID Description Score Start End GO Terms
AF-A0A6J4UPP3-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9401 5 91 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-A0A800BSC9-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9393 2 91 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-T0N8G6-F1-model_v4 deleted 0.9389 2 91
AF-A0A536ND37-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9335 2 91 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-A0A1V5XL32-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.927 1 91 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087

Feature Viewer

pLDDT pTM Quality
81.22 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map