F361140

General Info

Members Datasets Scaffolds Average Seq Length
249 202 490 176

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0000015|Ga0500583_0000015_123732_124358
Length 208
Sequence MIIVKFLPGVCILNCPNFKYHFFTIKLYFMDSPYIGSIVLFAGNFAPRGWMLCQGQLLSIAQNTALFSILGTTYGGNGTSTFALPDLRGRVPISQGQGPGLSDYVLGETIGTENVTLLSTEMPAHIHNVMVSTGQADSATANNNYLANSVGSLAGDAVTVNTYNGTPNGLLGGGSISPSGGNLPHANMQPSLCINYIIAIVGLFPSRN

Samples

Sample ID Description Type Environment
1 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
88 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
153 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
177 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
178 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
179 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
180 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
183 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
202 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.35
Metatranscriptomes 10.84
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.63
Nodule 0.4
Rhizoplane 1.2
Rhizosphere 84.74
Stem 0
Stem Tuber 0
Unclassified 14.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500583_0000015 3300053092 Bacteria 147804
2 rootL2_10238781 3300003322 Unclassified 2670
3 rootH1_10019681 3300003323 Bacteria 3294
4 rootH1_10029739 3300003323 Bacteria 4355
5 rootH1_10301498 3300003323 Bacteria 1453
6 Ga0065714_10065637 3300005288 Bacteria 9081
7 Ga0065704_10116920 3300005289 Unclassified 1844
8 Ga0065715_10347606 3300005293 Archaea 956
9 Ga0070658_10605929 3300005327 Bacteria 949
10 Ga0070670_100052585 3300005331 Unclassified 3497
11 Ga0070680_100002403 3300005336 Bacteria 13864
12 Ga0070660_100099033 3300005339 Bacteria 2308
13 Ga0070660_100261956 3300005339 Bacteria 1412
14 Ga0070689_100051459 3300005340 Unclassified 3184
15 Ga0070668_100144811 3300005347 Unclassified 1917
16 Ga0070669_100566694 3300005353 Archaea 948
17 Ga0070675_100073992 3300005354 Unclassified 2829
18 Ga0070688_100264635 3300005365 Bacteria 1229
19 Ga0070714_100089349 3300005435 Bacteria 2697
20 Ga0070713_100474926 3300005436 Bacteria 1177
21 Ga0070700_100740533 3300005441 Unclassified 785
22 Ga0070681_10154921 3300005458 Bacteria 2217
23 Ga0070685_10019779 3300005466 Unclassified 3637
24 Ga0068855_100000887 3300005563 Bacteria 37113
25 Ga0068855_100011794 3300005563 Bacteria 10567
26 Ga0068855_100627503 3300005563 Bacteria 1157
27 Ga0068854_100858729 3300005578 Unclassified 795
28 Ga0068856_100084394 3300005614 Bacteria 3155
29 Ga0068856_100178897 3300005614 Bacteria 2134
30 Ga0068852_100091225 3300005616 Bacteria 2726
31 Ga0068859_100076478 3300005617 Unclassified 3388
32 Ga0068864_100054439 3300005618 Bacteria 3453
33 Ga0068870_10852334 3300005840 Unclassified 640
34 Ga0068863_100094492 3300005841 Unclassified 2838
35 Ga0068858_100129756 3300005842 Unclassified 2363
36 Ga0070717_10019354 3300006028 Bacteria 5338
37 Ga0075363_100072223 3300006048 Bacteria 1876
38 Ga0075364_10037562 3300006051 Bacteria 3136
39 Ga0075362_10104367 3300006177 Bacteria 1328
40 Ga0075367_10005418 3300006178 Bacteria 6333
41 Ga0075367_10186866 3300006178 Bacteria 1292
42 Ga0075370_10071566 3300006353 Bacteria 1984
43 Ga0097620_100076475 3300006931 Unclassified 3388
44 Ga0105240_10456765 3300009093 Bacteria 1428
45 Ga0105249_10007444 3300009553 Bacteria 9551
46 Ga0157370_10001584 3300013104 Bacteria 28151
47 Ga0157370_10913195 3300013104 Bacteria 796
48 Ga0157369_10001714 3300013105 Bacteria 26692
49 Ga0163162_10216013 3300013306 Bacteria 2048
50 Ga0157372_10072871 3300013307 Bacteria 3871
51 Ga0157372_10115786 3300013307 Bacteria 3073
52 Ga0157372_10586650 3300013307 Bacteria 1299
53 Ga0163163_10270277 3300014325 Bacteria 1751
54 Ga0182005_1033598 3300015265 Bacteria 1395
55 Ga0213872_10011865 3300021361 Unclassified 4115
56 Ga0209646_1000725 3300025246 Bacteria 11650
57 Ga0207707_10328637 3300025912 Bacteria 1319
58 Ga0207707_10479612 3300025912 Bacteria 1062
59 Ga0207660_10207993 3300025917 Bacteria 1531
60 Ga0207657_10106983 3300025919 Bacteria 2314
61 Ga0207681_10389053 3300025923 Archaea 1124
62 Ga0207650_10096114 3300025925 Unclassified 2272
63 Ga0207664_10120015 3300025929 Unclassified 2199
64 Ga0207690_10867360 3300025932 Unclassified 748
65 Ga0207670_10442894 3300025936 Bacteria 1046
66 Ga0207667_10000009 3300025949 Bacteria 603135
67 Ga0207667_10075856 3300025949 Unclassified 3490
68 Ga0207667_10451042 3300025949 Bacteria 1307
69 Ga0207712_10131958 3300025961 Unclassified 1905
70 Ga0207668_10317210 3300025972 Bacteria 1292
71 Ga0207668_10739429 3300025972 Bacteria 867
72 Ga0207703_10220222 3300026035 Unclassified 1696
73 Ga0207702_10179384 3300026078 Unclassified 1949
74 Ga0207641_10178709 3300026088 Unclassified 1942
75 Ga0207676_10066725 3300026095 Bacteria 2871
76 Ga0207676_10119161 3300026095 Unclassified 2222
77 Ga0207675_100083716 3300026118 Unclassified 2992
78 Ga0207698_10194378 3300026142 Bacteria 1811
79 Ga0268265_11706941 3300028380 Unclassified 636
80 Ga0265338_10260964 3300028800 Bacteria 1274
81 Ga0265331_10038061 3300031250 Unclassified 2353
82 Ga0307513_10021585 3300031456 Bacteria 7598
83 Ga0307408_100002644 3300031548 Bacteria 12435
84 Ga0307408_100280816 3300031548 Bacteria 1387
85 Ga0307508_10236349 3300031616 Bacteria 1425
86 Ga0307516_10108321 3300031730 Bacteria 2586
87 Ga0307410_10351935 3300031852 Bacteria 1177
88 Ga0307409_100613156 3300031995 Bacteria 1077
89 Ga0307411_10989864 3300032005 Unclassified 752
90 Ga0373943_0114808 3300035170 Bacteria 1425
91 Ga0373955_0031560 3300035172 Bacteria 2776
92 Ga0373955_0510447 3300035172 Bacteria 734
93 Ga0373924_0209144 3300035410 Bacteria 861
94 Ga0373935_0298481 3300035692 Bacteria 1138
95 Ga0373927_0253755 3300035695 Viruses 1156
96 Ga0373933_0015219 3300035724 Bacteria 4288
97 Ga0373947_0083237 3300035725 Bacteria 1984
98 Ga0373947_0098950 3300035725 Unclassified 1830
99 Ga0373937_0010746 3300036401 Bacteria 8009
100 Ga0373937_0535785 3300036401 Viruses 1112
101 Ga0373925_0162604 3300037068 Bacteria 1759
102 Ga0373925_0341097 3300037068 Bacteria 1215
103 Ga0395900_0331501 3300037418 Bacteria 1500
104 Ga0395898_0331515 3300037466 Unclassified 1451
105 Ga0395905_0000018 3300037471 Bacteria 369321
106 Ga0436361_0783981 3300039447 Bacteria 11018
107 Ga0451841_0569857 3300041498 Bacteria 2359
108 Ga0451849_0344282 3300041505 Bacteria 5361
109 Ga0451853_3452920 3300041512 Bacteria 15729
110 Ga0451577_0048875 3300042876 Bacteria 3777
111 Ga0466972_0000028 3300044658 Bacteria 171140
112 Ga0453684_0851412 3300044712 Bacteria 980
113 Ga0466957_0000587 3300044842 Bacteria 18435
114 Ga0466967_0195088 3300045976 Bacteria 1915
115 Ga0495627_014600 3300046453 Bacteria 2735
116 Ga0495592_0032690 3300046454 Bacteria 3923
117 Ga0495629_0270519 3300046459 Bacteria 1167
118 Ga0495638_0028393 3300046460 Bacteria 3613
119 Ga0495651_0003356 3300046462 Bacteria 12293
120 Ga0495651_0241865 3300046462 Bacteria 1237
121 Ga0495605_0031036 3300046474 Bacteria 2732
122 Ga0495605_0100788 3300046474 Bacteria 1328
123 Ga0495662_0141214 3300046476 Bacteria 1185
124 Ga0495664_0071517 3300046477 Bacteria 2072
125 Ga0495584_0005141 3300046491 Bacteria 6944
126 Ga0495584_0035842 3300046491 Bacteria 2507
127 Ga0495585_0004520 3300046492 Bacteria 9013
128 Ga0495594_0019820 3300046499 Bacteria 3577
129 Ga0495596_0110491 3300046500 Bacteria 1067
130 Ga0495606_0018238 3300046507 Bacteria 5271
131 Ga0495616_0065501 3300046513 Bacteria 1770
132 Ga0495618_0321320 3300046514 Bacteria 959
133 Ga0495628_0133051 3300046516 Bacteria 1901
134 Ga0495630_0272756 3300046517 Bacteria 1292
135 Ga0495631_0024488 3300046518 Bacteria 2787
136 Ga0495632_0033128 3300046519 Bacteria 2655
137 Ga0495643_0441718 3300046522 Bacteria 567
138 Ga0495644_0091788 3300046523 Bacteria 1146
139 Ga0495663_0032819 3300046525 Bacteria 1547
140 Ga0495642_0005421 3300046528 Bacteria 4899
141 Ga0495642_0009441 3300046528 Bacteria 3734
142 Ga0495652_0169667 3300046529 Viruses 1685
143 Ga0495654_0223273 3300046530 Bacteria 796
144 Ga0495665_0057779 3300046531 Bacteria 2048
145 Ga0495640_0224386 3300046533 Bacteria 1184
146 Ga0495640_0233760 3300046533 Bacteria 1155
147 Ga0495586_0056742 3300046535 Bacteria 2124
148 Ga0495609_0007198 3300046538 Bacteria 5584
149 Ga0495597_0007643 3300046542 Bacteria 5470
150 Ga0495645_0006048 3300046543 Bacteria 8369
151 Ga0495622_0198083 3300046557 Bacteria 896
152 Ga0495633_0053000 3300046558 Bacteria 1910
153 Ga0495633_0059544 3300046558 Bacteria 1790
154 Ga0495668_0016685 3300046616 Bacteria 4269
155 Ga0495668_0052488 3300046616 Bacteria 2255
156 Ga0495611_0001002 3300046648 Bacteria 15013
157 Ga0495611_0001961 3300046648 Bacteria 9768
158 Ga0495611_0178114 3300046648 Bacteria 993
159 Ga0495625_0221082 3300046660 Bacteria 1241
160 Ga0495635_0061065 3300046663 Bacteria 2589
161 Ga0495661_0036928 3300046665 Bacteria 3053
162 Ga0495661_0236734 3300046665 Bacteria 938
163 Ga0495588_0035496 3300046674 Bacteria 2526
164 Ga0495599_0107715 3300046678 Bacteria 1736
165 Ga0495623_0365249 3300046679 Unclassified 783
166 Ga0495646_0175102 3300046680 Bacteria 1180
167 Ga0495613_0420199 3300046689 Bacteria 910
168 Ga0495670_0007264 3300046691 Bacteria 5446
169 Ga0495670_0040248 3300046691 Bacteria 2331
170 Ga0495589_0014557 3300046794 Bacteria 4047
171 Ga0495600_0204839 3300046809 Bacteria 1266
172 Ga0495581_0015881 3300047315 Bacteria 4375
173 Ga0495604_0211565 3300047317 Bacteria 1340
174 Ga0495604_0358933 3300047317 Bacteria 967
175 Ga0495674_0206709 3300047319 Bacteria 1627
176 Ga0495674_0378948 3300047319 Bacteria 1145
177 Ga0495674_0963749 3300047319 Unclassified 655
178 Ga0495680_0191122 3300047322 Bacteria 1473
179 Ga0495680_0501713 3300047322 Bacteria 824
180 Ga0495683_0039687 3300047323 Bacteria 2379
181 Ga0495675_0252324 3300047444 Bacteria 1059
182 Ga0495677_0004872 3300047445 Bacteria 5118
183 Ga0495677_0011369 3300047445 Bacteria 3257
184 Ga0495681_0013381 3300047470 Bacteria 4763
185 Ga0495684_0080468 3300047471 Bacteria 2473
186 Ga0495593_0050402 3300047673 Bacteria 2205
187 Ga0495614_0060832 3300048089 Bacteria 1622
188 Ga0495614_0477520 3300048089 Bacteria 592
189 Ga0495615_0061063 3300048090 Bacteria 994
190 Ga0495615_0151666 3300048090 Bacteria 690
191 Ga0495626_0004390 3300048091 Bacteria 8680
192 Ga0496102_1037521 3300048905 Bacteria 740
193 Ga0496109_0588629 3300048912 Bacteria 1048
194 Ga0496113_0364392 3300048916 Unclassified 1160
195 Ga0496119_0388651 3300048922 Unclassified 668
196 Ga0496124_0002606 3300048927 Bacteria 23295
197 Ga0496124_0196933 3300048927 Bacteria 1536
198 Ga0501308_035344 3300049128 Bacteria 686
199 Ga0501309_023956 3300049129 Bacteria 870
200 Ga0501304_007730 3300049160 Bacteria 893
201 Ga0501305_009610 3300049161 Bacteria 1275
202 Ga0501312_001599 3300049528 Bacteria 2265
203 Ga0501034_0556485 3300049571 Bacteria 1056
204 Ga0501047_0045752 3300049581 Bacteria 4231
205 Ga0501067_0067258 3300049583 Bacteria 1983
206 Ga0501249_005971 3300049679 Bacteria 2498
207 Ga0501035_0000842 3300049822 Bacteria 32791
208 Ga0501035_0234036 3300049822 Bacteria 1565
209 Ga0501044_0014119 3300049823 Bacteria 8623
210 nmdc:mga03683_9560_c1 3300050489 Bacteria 3453
211 nmdc:mga06z11_33523_c1 3300050494 Bacteria 2513
212 nmdc:mga06z11_497317_c1 3300050494 Bacteria 739
213 nmdc:mga05p37_20103_c1 3300050507 Bacteria 8080
214 Ga0495601_0293896 3300053077 Bacteria 1059
215 Ga0500644_0000070 3300053088 Bacteria 61261
216 Ga0500646_0244636 3300053090 Bacteria 629
217 Ga0500562_045292 3300053108 Bacteria 1172
218 Ga0500569_161822 3300053109 Viruses 757
219 Ga0500594_0029107 3300053118 Bacteria 1442
220 Ga0500652_098873 3300053131 Bacteria 1220
221 Ga0500658_0104637 3300053134 Viruses 1239
222 Ga0500559_0040508 3300053136 Bacteria 2029
223 Ga0500577_0003017 3300053142 Bacteria 4345
224 Ga0590071_075929 3300059421 Unclassified 832
225 Ga0587084_005482 3300059477 Bacteria 1504
226 Ga0587066_019625 3300059490 Bacteria 1102
227 Ga0587070_006949 3300059491 Bacteria 1550
228 Ga0587083_0014847 3300059505 Bacteria 1348
229 Ga0587085_002763 3300059506 Bacteria 1826
230 Ga0587085_018303 3300059506 Bacteria 1037
231 Ga0587091_021354 3300059511 Bacteria 1133
232 Ga0587092_000582 3300059512 Bacteria 3048
233 Ga0587094_019349 3300059513 Bacteria 976
234 Ga0587125_001463 3300059607 Bacteria 1717
235 Ga0587101_010589 3300059623 Bacteria 1162
236 Ga0587062_001956 3300059639 Bacteria 1892
237 Ga0587062_029387 3300059639 Unclassified 833
238 Ga0587067_008930 3300059640 Bacteria 1480
239 Ga0587069_005236 3300059642 Bacteria 1501
240 Ga0587079_006957 3300059647 Bacteria 1673
241 Ga0587081_10687 3300060246 Unclassified 659
242 Ga0587071_057993 3300060344 Bacteria 817
243 Ga0587111_0010723 3300060346 Bacteria 1581
244 643602522 643348564 Bacteria 8839022
245 8056121417 8056120720 Bacteria 5758328
246 Ga0500583_0000015
247 rootL2_10238781
248 rootH1_10019681
249 rootH1_10029739
250 rootH1_10301498
251 Ga0065714_10065637
252 Ga0065704_10116920
253 Ga0065715_10347606
254 Ga0070658_10605929
255 Ga0070670_100052585
256 Ga0070680_100002403
257 Ga0070660_100099033
258 Ga0070660_100261956
259 Ga0070689_100051459
260 Ga0070668_100144811
261 Ga0070669_100566694
262 Ga0070675_100073992
263 Ga0070688_100264635
264 Ga0070714_100089349
265 Ga0070713_100474926
266 Ga0070700_100740533
267 Ga0070681_10154921
268 Ga0070685_10019779
269 Ga0068855_100000887
270 Ga0068855_100011794
271 Ga0068855_100627503
272 Ga0068854_100858729
273 Ga0068856_100084394
274 Ga0068856_100178897
275 Ga0068852_100091225
276 Ga0068859_100076478
277 Ga0068864_100054439
278 Ga0068870_10852334
279 Ga0068863_100094492
280 Ga0068858_100129756
281 Ga0070717_10019354
282 Ga0075363_100072223
283 Ga0075364_10037562
284 Ga0075362_10104367
285 Ga0075367_10005418
286 Ga0075367_10186866
287 Ga0075370_10071566
288 Ga0097620_100076475
289 Ga0105240_10456765
290 Ga0105249_10007444
291 Ga0157370_10001584
292 Ga0157370_10913195
293 Ga0157369_10001714
294 Ga0163162_10216013
295 Ga0157372_10072871
296 Ga0157372_10115786
297 Ga0157372_10586650
298 Ga0163163_10270277
299 Ga0182005_1033598
300 Ga0213872_10011865
301 Ga0209646_1000725
302 Ga0207707_10328637
303 Ga0207707_10479612
304 Ga0207660_10207993
305 Ga0207657_10106983
306 Ga0207681_10389053
307 Ga0207650_10096114
308 Ga0207664_10120015
309 Ga0207690_10867360
310 Ga0207670_10442894
311 Ga0207667_10000009
312 Ga0207667_10075856
313 Ga0207667_10451042
314 Ga0207712_10131958
315 Ga0207668_10317210
316 Ga0207668_10739429
317 Ga0207703_10220222
318 Ga0207702_10179384
319 Ga0207641_10178709
320 Ga0207676_10066725
321 Ga0207676_10119161
322 Ga0207675_100083716
323 Ga0207698_10194378
324 Ga0268265_11706941
325 Ga0265338_10260964
326 Ga0265331_10038061
327 Ga0307513_10021585
328 Ga0307408_100002644
329 Ga0307408_100280816
330 Ga0307508_10236349
331 Ga0307516_10108321
332 Ga0307410_10351935
333 Ga0307409_100613156
334 Ga0307411_10989864
335 Ga0373943_0114808
336 Ga0373955_0031560
337 Ga0373955_0510447
338 Ga0373924_0209144
339 Ga0373935_0298481
340 Ga0373927_0253755
341 Ga0373933_0015219
342 Ga0373947_0083237
343 Ga0373947_0098950
344 Ga0373937_0010746
345 Ga0373937_0535785
346 Ga0373925_0162604
347 Ga0373925_0341097
348 Ga0395900_0331501
349 Ga0395898_0331515
350 Ga0395905_0000018
351 Ga0436361_0783981
352 Ga0451841_0569857
353 Ga0451849_0344282
354 Ga0451853_3452920
355 Ga0451577_0048875
356 Ga0466972_0000028
357 Ga0453684_0851412
358 Ga0466957_0000587
359 Ga0466967_0195088
360 Ga0495627_014600
361 Ga0495592_0032690
362 Ga0495629_0270519
363 Ga0495638_0028393
364 Ga0495651_0003356
365 Ga0495651_0241865
366 Ga0495605_0031036
367 Ga0495605_0100788
368 Ga0495662_0141214
369 Ga0495664_0071517
370 Ga0495584_0005141
371 Ga0495584_0035842
372 Ga0495585_0004520
373 Ga0495594_0019820
374 Ga0495596_0110491
375 Ga0495606_0018238
376 Ga0495616_0065501
377 Ga0495618_0321320
378 Ga0495628_0133051
379 Ga0495630_0272756
380 Ga0495631_0024488
381 Ga0495632_0033128
382 Ga0495643_0441718
383 Ga0495644_0091788
384 Ga0495663_0032819
385 Ga0495642_0005421
386 Ga0495642_0009441
387 Ga0495652_0169667
388 Ga0495654_0223273
389 Ga0495665_0057779
390 Ga0495640_0224386
391 Ga0495640_0233760
392 Ga0495586_0056742
393 Ga0495609_0007198
394 Ga0495597_0007643
395 Ga0495645_0006048
396 Ga0495622_0198083
397 Ga0495633_0053000
398 Ga0495633_0059544
399 Ga0495668_0016685
400 Ga0495668_0052488
401 Ga0495611_0001002
402 Ga0495611_0001961
403 Ga0495611_0178114
404 Ga0495625_0221082
405 Ga0495635_0061065
406 Ga0495661_0036928
407 Ga0495661_0236734
408 Ga0495588_0035496
409 Ga0495599_0107715
410 Ga0495623_0365249
411 Ga0495646_0175102
412 Ga0495613_0420199
413 Ga0495670_0007264
414 Ga0495670_0040248
415 Ga0495589_0014557
416 Ga0495600_0204839
417 Ga0495581_0015881
418 Ga0495604_0211565
419 Ga0495604_0358933
420 Ga0495674_0206709
421 Ga0495674_0378948
422 Ga0495674_0963749
423 Ga0495680_0191122
424 Ga0495680_0501713
425 Ga0495683_0039687
426 Ga0495675_0252324
427 Ga0495677_0004872
428 Ga0495677_0011369
429 Ga0495681_0013381
430 Ga0495684_0080468
431 Ga0495593_0050402
432 Ga0495614_0060832
433 Ga0495614_0477520
434 Ga0495615_0061063
435 Ga0495615_0151666
436 Ga0495626_0004390
437 Ga0496102_1037521
438 Ga0496109_0588629
439 Ga0496113_0364392
440 Ga0496119_0388651
441 Ga0496124_0002606
442 Ga0496124_0196933
443 Ga0501308_035344
444 Ga0501309_023956
445 Ga0501304_007730
446 Ga0501305_009610
447 Ga0501312_001599
448 Ga0501034_0556485
449 Ga0501047_0045752
450 Ga0501067_0067258
451 Ga0501249_005971
452 Ga0501035_0000842
453 Ga0501035_0234036
454 Ga0501044_0014119
455 nmdc:mga03683_9560_c1
456 nmdc:mga06z11_33523_c1
457 nmdc:mga06z11_497317_c1
458 nmdc:mga05p37_20103_c1
459 Ga0495601_0293896
460 Ga0500644_0000070
461 Ga0500646_0244636
462 Ga0500562_045292
463 Ga0500569_161822
464 Ga0500594_0029107
465 Ga0500652_098873
466 Ga0500658_0104637
467 Ga0500559_0040508
468 Ga0500577_0003017
469 Ga0590071_075929
470 Ga0587084_005482
471 Ga0587066_019625
472 Ga0587070_006949
473 Ga0587083_0014847
474 Ga0587085_002763
475 Ga0587085_018303
476 Ga0587091_021354
477 Ga0587092_000582
478 Ga0587094_019349
479 Ga0587125_001463
480 Ga0587101_010589
481 Ga0587062_001956
482 Ga0587062_029387
483 Ga0587067_008930
484 Ga0587069_005236
485 Ga0587079_006957
486 Ga0587081_10687
487 Ga0587071_057993
488 Ga0587111_0010723
489 643602522
490 8056121417

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

36

92

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lye-assembly1.cif.gz_A-3 re-refined structure of the bacteriophage t4 short tail fibre pdb entry 1h6w containing 71 additionally identified residues 0.863 5 58
1pdi-assembly1.cif.gz_A fitting of the c-terminal part of the short tail fibers into the cryo-em reconstruction of t4 baseplate 0.4865 5 172
1pdi-assembly1.cif.gz_A fitting of the c-terminal part of the short tail fibers into the cryo-em reconstruction of t4 baseplate 0.4584 5 172
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.4527 5 172
6ov6-assembly1.cif.gz_B crystallographic structure of the c24 protein from the antarctic microorganism bizionia argentinensis 0.4456 1 171
ID Description Score Start End Superfamily
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8581 9 58 3.90.1340.10
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8201 5 58 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.7805 3 56 3.90.1340.10
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.6523 9 58 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.6449 3 56 3.90.1340.10
ID Description Score Start End GO Terms
AF-A0A7Y2FQZ0-F1-model_v4 Phage tail protein 0.8636 2 178
AF-A0A6M1ME63-F1-model_v4 Tail fiber protein 0.8587 1 176
AF-A0A6M1ME63-F1-model_v4 Tail fiber protein 0.8484 1 176
AF-A0A2D8FYV9-F1-model_v4 deleted 0.8362 2 178
AF-A0A1M6CTK4-F1-model_v4 Phage Tail Collar Domain 0.836 1 178

Map