F361136

General Info

Members Datasets Scaffolds Average Seq Length
249 176 498 151

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_39661_c1|nmdc:mga08x19_39661_c1_793_1320
Length 175
Sequence MRDHGLYLPEAVASDIRRHGEETYPHECCGALVGREGRVAAAVALPNTTEEGPRRRFLVRPSDYLLAERRARELGGELLGFYHSHPDHPARPSQYDLDHAWPTFAYVIVSVAGKALARQSADLSRQSAEGATAEGAAAADITVWWLKEDRSTFEEGTFEHGDENPDSNPAAAVHG

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
117 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
118 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
119 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
120 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 0
Rhizoplane 4.82
Rhizosphere 91.57
Stem 0
Stem Tuber 0
Unclassified 15.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_39661_c1 3300050514 Bacteria 2994
2 Ga0065715_10360992 3300005293 Bacteria 935
3 Ga0070676_10329880 3300005328 Bacteria 1043
4 Ga0070689_100499720 3300005340 Bacteria 1042
5 Ga0070692_10349869 3300005345 Bacteria 918
6 Ga0070668_100365833 3300005347 Bacteria 1224
7 Ga0070669_100524473 3300005353 Unclassified 985
8 Ga0070675_100001471 3300005354 Bacteria 17360
9 Ga0070675_101071228 3300005354 Bacteria 741
10 Ga0070675_101495727 3300005354 Unclassified 623
11 Ga0070675_102032949 3300005354 Unclassified 530
12 Ga0070671_100124946 3300005355 Bacteria 2166
13 Ga0070671_100175789 3300005355 Bacteria 1812
14 Ga0070673_100304814 3300005364 Bacteria 1403
15 Ga0070673_100825755 3300005364 Unclassified 857
16 Ga0070673_102138588 3300005364 Bacteria 532
17 Ga0070688_100247969 3300005365 Bacteria 1267
18 Ga0070688_100737460 3300005365 Unclassified 766
19 Ga0070688_100789631 3300005365 Unclassified 742
20 Ga0070713_100074400 3300005436 Bacteria 2878
21 Ga0070711_100542185 3300005439 Unclassified 964
22 Ga0070705_100187802 3300005440 Bacteria 1406
23 Ga0070705_101047418 3300005440 Bacteria 665
24 Ga0070705_101448581 3300005440 Bacteria 574
25 Ga0070700_100166515 3300005441 Bacteria 1522
26 Ga0070700_101404913 3300005441 Unclassified 590
27 Ga0070708_100655438 3300005445 Unclassified 989
28 Ga0070681_10386484 3300005458 Unclassified 1310
29 Ga0068867_100118249 3300005459 Bacteria 2044
30 Ga0068867_100511204 3300005459 Unclassified 1034
31 Ga0068867_100552981 3300005459 Bacteria 997
32 Ga0070698_100052927 3300005471 Bacteria 4127
33 Ga0070699_100776263 3300005518 Bacteria 877
34 Ga0068853_101021572 3300005539 Bacteria 796
35 Ga0070672_100506661 3300005543 Bacteria 1045
36 Ga0070672_100812385 3300005543 Bacteria 823
37 Ga0070686_100232219 3300005544 Bacteria 1339
38 Ga0070696_100125646 3300005546 Bacteria 1861
39 Ga0070665_100166775 3300005548 Bacteria 2204
40 Ga0070665_100647655 3300005548 Bacteria 1070
41 Ga0070664_100699749 3300005564 Bacteria 944
42 Ga0068854_100950964 3300005578 Bacteria 758
43 Ga0070702_100160190 3300005615 Bacteria 1454
44 Ga0068852_100560931 3300005616 Bacteria 1143
45 Ga0068852_101958831 3300005616 Bacteria 608
46 Ga0068861_102208313 3300005719 Unclassified 551
47 Ga0068851_10110289 3300005834 Bacteria 1468
48 Ga0068858_100003439 3300005842 Bacteria 15721
49 Ga0068858_100753398 3300005842 Unclassified 949
50 Ga0068860_100187851 3300005843 Bacteria 1999
51 Ga0068860_101270791 3300005843 Unclassified 757
52 Ga0068862_100066631 3300005844 Bacteria 3103
53 Ga0068862_100428557 3300005844 Bacteria 1243
54 Ga0068862_100700017 3300005844 Bacteria 981
55 Ga0068862_101290782 3300005844 Bacteria 731
56 Ga0081539_10000096 3300005985 Bacteria 204059
57 Ga0081539_10005458 3300005985 Bacteria 12969
58 Ga0075368_10031086 3300006042 Bacteria 2069
59 Ga0075364_10134625 3300006051 Bacteria 1660
60 Ga0075364_10350914 3300006051 Bacteria 1006
61 Ga0070716_101265789 3300006173 Bacteria 595
62 Ga0075367_10262844 3300006178 Bacteria 1084
63 Ga0097621_100036127 3300006237 Bacteria 3952
64 Ga0068871_100016047 3300006358 Bacteria 5628
65 Ga0068871_100275688 3300006358 Bacteria 1470
66 Ga0075430_100720778 3300006846 Bacteria 822
67 Ga0075431_102193869 3300006847 Unclassified 507
68 Ga0075433_10007699 3300006852 Bacteria 8557
69 Ga0075433_10068554 3300006852 Bacteria 3114
70 Ga0075433_10131218 3300006852 Bacteria 2226
71 Ga0075434_100024505 3300006871 Bacteria 5898
72 Ga0075434_101324880 3300006871 Unclassified 731
73 Ga0068865_100153510 3300006881 Bacteria 1749
74 Ga0068865_100537505 3300006881 Bacteria 980
75 Ga0075436_100008962 3300006914 Bacteria 6846
76 Ga0075436_100084373 3300006914 Bacteria 2204
77 Ga0075436_100436991 3300006914 Bacteria 951
78 Ga0075435_100003636 3300007076 Bacteria 10496
79 Ga0105240_10655554 3300009093 Bacteria 1150
80 Ga0111539_10003965 3300009094 Bacteria 19451
81 Ga0105247_10281373 3300009101 Bacteria 1148
82 Ga0114129_10000434 3300009147 Bacteria 49632
83 Ga0114129_10014154 3300009147 Bacteria 11366
84 Ga0114129_10203622 3300009147 Bacteria 2679
85 Ga0105243_10295394 3300009148 Bacteria 1466
86 Ga0105243_11105565 3300009148 Bacteria 801
87 Ga0105243_12106730 3300009148 Unclassified 600
88 Ga0105242_10055352 3300009176 Bacteria 3245
89 Ga0105242_10264627 3300009176 Bacteria 1555
90 Ga0105248_10088878 3300009177 Bacteria 3477
91 Ga0105237_10313487 3300009545 Unclassified 1572
92 Ga0105249_10108724 3300009553 Bacteria 2618
93 Ga0157323_1010202 3300012495 Unclassified 734
94 Ga0157378_10330685 3300013297 Bacteria 1483
95 Ga0157375_13105096 3300013308 Unclassified 554
96 Ga0163163_12286392 3300014325 Bacteria 599
97 Ga0157380_10184348 3300014326 Bacteria 1837
98 Ga0157380_10237371 3300014326 Bacteria 1641
99 Ga0157380_10768415 3300014326 Unclassified 977
100 Ga0157380_11119192 3300014326 Unclassified 827
101 Ga0157377_10066888 3300014745 Bacteria 2067
102 Ga0157379_10017728 3300014968 Bacteria 6273
103 Ga0157376_10079042 3300014969 Bacteria 2819
104 Ga0207645_10763221 3300025907 Unclassified 657
105 Ga0207684_10771690 3300025910 Bacteria 814
106 Ga0207707_10634333 3300025912 Bacteria 902
107 Ga0207657_10346741 3300025919 Bacteria 1171
108 Ga0207646_10623103 3300025922 Bacteria 968
109 Ga0207694_10866643 3300025924 Unclassified 763
110 Ga0207650_11215327 3300025925 Bacteria 642
111 Ga0207659_10002275 3300025926 Bacteria 11435
112 Ga0207659_10950043 3300025926 Bacteria 739
113 Ga0207687_10078881 3300025927 Bacteria 2372
114 Ga0207700_10020868 3300025928 Bacteria 4460
115 Ga0207664_10061529 3300025929 Bacteria 2995
116 Ga0207644_10137182 3300025931 Bacteria 1880
117 Ga0207644_10550230 3300025931 Unclassified 955
118 Ga0207706_10782345 3300025933 Bacteria 811
119 Ga0207709_10276388 3300025935 Bacteria 1239
120 Ga0207709_11020250 3300025935 Unclassified 677
121 Ga0207670_10423456 3300025936 Bacteria 1068
122 Ga0207669_10023793 3300025937 Bacteria 3279
123 Ga0207669_10051095 3300025937 Bacteria 2475
124 Ga0207704_10249947 3300025938 Bacteria 1330
125 Ga0207704_11345196 3300025938 Bacteria 611
126 Ga0207691_10391989 3300025940 Bacteria 1185
127 Ga0207691_10564659 3300025940 Bacteria 964
128 Ga0207711_10073274 3300025941 Bacteria 2976
129 Ga0207689_10199665 3300025942 Bacteria 1651
130 Ga0207651_10253866 3300025960 Bacteria 1440
131 Ga0207651_10363037 3300025960 Unclassified 1223
132 Ga0207651_11041277 3300025960 Bacteria 732
133 Ga0207712_11525835 3300025961 Unclassified 599
134 Ga0207668_10039233 3300025972 Bacteria 3186
135 Ga0207668_10272482 3300025972 Bacteria 1384
136 Ga0207677_10231277 3300026023 Bacteria 1489
137 Ga0207703_10010325 3300026035 Bacteria 7311
138 Ga0207703_10706756 3300026035 Unclassified 959
139 Ga0207703_11851580 3300026035 Bacteria 580
140 Ga0207648_10088228 3300026089 Bacteria 2708
141 Ga0207648_10332127 3300026089 Unclassified 1368
142 Ga0207675_100685385 3300026118 Bacteria 1033
143 Ga0207675_101435610 3300026118 Bacteria 711
144 Ga0207683_10222027 3300026121 Bacteria 1722
145 Ga0207683_10293916 3300026121 Bacteria 1486
146 Ga0207428_10279320 3300027907 Bacteria 1240
147 Ga0268266_10464127 3300028379 Bacteria 1205
148 Ga0268266_10537364 3300028379 Unclassified 1119
149 Ga0268265_10008553 3300028380 Bacteria 6918
150 Ga0268265_10979152 3300028380 Bacteria 834
151 Ga0268264_10135177 3300028381 Bacteria 2191
152 Ga0268264_10179106 3300028381 Bacteria 1923
153 Ga0268264_11283178 3300028381 Unclassified 742
154 Ga0265332_10347946 3300031238 Unclassified 612
155 Ga0307513_10169834 3300031456 Bacteria 2060
156 Ga0307408_100022535 3300031548 Bacteria 4281
157 Ga0307408_100056698 3300031548 Bacteria 2841
158 Ga0307408_100536906 3300031548 Bacteria 1030
159 Ga0307408_100706116 3300031548 Bacteria 907
160 Ga0307410_10015632 3300031852 Bacteria 4507
161 Ga0307410_10043723 3300031852 Bacteria 2971
162 Ga0307407_10018167 3300031903 Bacteria 3549
163 Ga0307407_10444140 3300031903 Bacteria 940
164 Ga0307412_10052749 3300031911 Bacteria 2694
165 Ga0307409_100285148 3300031995 Bacteria 1529
166 Ga0307416_100041649 3300032002 Bacteria 3579
167 Ga0307416_100536133 3300032002 Bacteria 1241
168 Ga0307414_10033131 3300032004 Bacteria 3411
169 Ga0307414_10342314 3300032004 Bacteria 1281
170 Ga0373944_0279904 3300035089 Bacteria 622
171 Ga0373923_0064688 3300035111 Bacteria 1560
172 Ga0373954_0146035 3300035118 Bacteria 1155
173 Ga0373943_0096570 3300035170 Bacteria 1539
174 Ga0373955_0099377 3300035172 Bacteria 1668
175 Ga0373933_0070048 3300035724 Bacteria 2133
176 Ga0373937_0170695 3300036401 Bacteria 2041
177 Ga0373925_0883440 3300037068 Bacteria 737
178 Ga0451807_1640223 3300041486 Bacteria 666
179 Ga0450892_033919 3300042130 Bacteria 544
180 Ga0439435_0029571 3300042436 Bacteria 1480
181 Ga0439444_0041426 3300042437 Bacteria 906
182 Ga0439460_0006218 3300042461 Bacteria 2955
183 Ga0439460_0007216 3300042461 Bacteria 2773
184 Ga0450916_024746 3300042530 Bacteria 844
185 Ga0451576_0954122 3300045051 Bacteria 899
186 Ga0466967_0351489 3300045976 Bacteria 1427
187 Ga0495638_0093569 3300046460 Bacteria 1807
188 Ga0495651_0144249 3300046462 Bacteria 1723
189 Ga0495580_0631020 3300046472 Bacteria 706
190 Ga0495616_0368184 3300046513 Bacteria 596
191 Ga0495628_0010696 3300046516 Bacteria 7770
192 Ga0495642_0440216 3300046528 Unclassified 576
193 Ga0495652_0064984 3300046529 Bacteria 3067
194 Ga0495587_0269826 3300046536 Bacteria 955
195 Ga0495621_0166662 3300046539 Bacteria 874
196 Ga0495645_0010248 3300046543 Bacteria 6568
197 Ga0495633_0097423 3300046558 Bacteria 1366
198 Ga0495659_0156818 3300046664 Bacteria 917
199 Ga0495623_0164364 3300046679 Bacteria 1302
200 Ga0495646_0156415 3300046680 Bacteria 1265
201 Ga0495647_0035155 3300046681 Bacteria 1880
202 Ga0495658_0184505 3300046683 Bacteria 1295
203 Ga0495613_0000720 3300046689 Bacteria 25918
204 Ga0495600_0045934 3300046809 Bacteria 2850
205 Ga0495684_0006668 3300047471 Bacteria 8958
206 Ga0496100_0003982 3300048903 Bacteria 7764
207 Ga0496101_0000451 3300048904 Bacteria 26069
208 Ga0496102_0023480 3300048905 Bacteria 5479
209 Ga0496104_0012288 3300048907 Bacteria 7697
210 Ga0496105_0010234 3300048908 Bacteria 7373
211 Ga0496106_0425136 3300048909 Bacteria 1068
212 Ga0496108_0883482 3300048911 Bacteria 768
213 Ga0496112_0068212 3300048915 Bacteria 3512
214 Ga0496113_0590495 3300048916 Bacteria 890
215 Ga0496114_0001764 3300048917 Bacteria 16428
216 Ga0496114_0250082 3300048917 Bacteria 1560
217 Ga0501299_009586 3300049522 Bacteria 1600
218 Ga0501047_0248567 3300049581 Bacteria 1627
219 Ga0501069_0171450 3300049585 Unclassified 1252
220 Ga0501073_0815824 3300049589 Unclassified 643
221 Ga0501076_0558228 3300049592 Bacteria 944
222 Ga0501044_0001109 3300049823 Bacteria 32036
223 Ga0501045_1107766 3300049824 Unclassified 579
224 nmdc:mga00v17_215708_c1 3300050491 Bacteria 1242
225 nmdc:mga06z11_292545_c1 3300050494 Bacteria 967
226 nmdc:mga05p37_25173_c1 3300050507 Bacteria 7237
227 nmdc:mga05p37_8651_c1 3300050507 Bacteria 12034
228 nmdc:mga06r32_768763_c1 3300050510 Bacteria 925
229 nmdc:mga06r32_88222_c1 3300050510 Bacteria 3027
230 nmdc:mga08y16_168211_c1 3300050511 Bacteria 2278
231 nmdc:mga0n895_36571_c1 3300050512 Bacteria 4742
232 nmdc:mga0n895_59233_c1 3300050512 Bacteria 3778
233 nmdc:mga0n895_931944_c1 3300050512 Unclassified 853
234 nmdc:mga0rr50_101211_c1 3300050513 Bacteria 2265
235 nmdc:mga08x19_106395_c1 3300050514 Bacteria 1867
236 nmdc:mga08x19_378133_c1 3300050514 Bacteria 992
237 nmdc:mga0a205_445109_c1 3300050515 Bacteria 1156
238 nmdc:mga0a205_50252_c1 3300050515 Bacteria 4025
239 nmdc:mga0a205_72985_c1 3300050515 Bacteria 3316
240 Ga0495601_0013493 3300053077 Bacteria 4914
241 Ga0495612_0112238 3300053078 Bacteria 1168
242 Ga0495595_0566228 3300053084 Bacteria 580
243 Ga0495619_0001542 3300053085 Bacteria 15176
244 Ga0500641_0022147 3300053096 Bacteria 2430
245 Ga0500568_0002892 3300053139 Bacteria 9866
246 Ga0590071_000382 3300059421 Bacteria 13013
247 Ga0590074_000767 3300059423 Bacteria 4903
248 Ga0590075_005166 3300059424 Bacteria 3084
249 Ga0590077_000003 3300059426 Bacteria 50145
250 nmdc:mga08x19_39661_c1
251 Ga0065715_10360992
252 Ga0070676_10329880
253 Ga0070689_100499720
254 Ga0070692_10349869
255 Ga0070668_100365833
256 Ga0070669_100524473
257 Ga0070675_100001471
258 Ga0070675_101071228
259 Ga0070675_101495727
260 Ga0070675_102032949
261 Ga0070671_100124946
262 Ga0070671_100175789
263 Ga0070673_100304814
264 Ga0070673_100825755
265 Ga0070673_102138588
266 Ga0070688_100247969
267 Ga0070688_100737460
268 Ga0070688_100789631
269 Ga0070713_100074400
270 Ga0070711_100542185
271 Ga0070705_100187802
272 Ga0070705_101047418
273 Ga0070705_101448581
274 Ga0070700_100166515
275 Ga0070700_101404913
276 Ga0070708_100655438
277 Ga0070681_10386484
278 Ga0068867_100118249
279 Ga0068867_100511204
280 Ga0068867_100552981
281 Ga0070698_100052927
282 Ga0070699_100776263
283 Ga0068853_101021572
284 Ga0070672_100506661
285 Ga0070672_100812385
286 Ga0070686_100232219
287 Ga0070696_100125646
288 Ga0070665_100166775
289 Ga0070665_100647655
290 Ga0070664_100699749
291 Ga0068854_100950964
292 Ga0070702_100160190
293 Ga0068852_100560931
294 Ga0068852_101958831
295 Ga0068861_102208313
296 Ga0068851_10110289
297 Ga0068858_100003439
298 Ga0068858_100753398
299 Ga0068860_100187851
300 Ga0068860_101270791
301 Ga0068862_100066631
302 Ga0068862_100428557
303 Ga0068862_100700017
304 Ga0068862_101290782
305 Ga0081539_10000096
306 Ga0081539_10005458
307 Ga0075368_10031086
308 Ga0075364_10134625
309 Ga0075364_10350914
310 Ga0070716_101265789
311 Ga0075367_10262844
312 Ga0097621_100036127
313 Ga0068871_100016047
314 Ga0068871_100275688
315 Ga0075430_100720778
316 Ga0075431_102193869
317 Ga0075433_10007699
318 Ga0075433_10068554
319 Ga0075433_10131218
320 Ga0075434_100024505
321 Ga0075434_101324880
322 Ga0068865_100153510
323 Ga0068865_100537505
324 Ga0075436_100008962
325 Ga0075436_100084373
326 Ga0075436_100436991
327 Ga0075435_100003636
328 Ga0105240_10655554
329 Ga0111539_10003965
330 Ga0105247_10281373
331 Ga0114129_10000434
332 Ga0114129_10014154
333 Ga0114129_10203622
334 Ga0105243_10295394
335 Ga0105243_11105565
336 Ga0105243_12106730
337 Ga0105242_10055352
338 Ga0105242_10264627
339 Ga0105248_10088878
340 Ga0105237_10313487
341 Ga0105249_10108724
342 Ga0157323_1010202
343 Ga0157378_10330685
344 Ga0157375_13105096
345 Ga0163163_12286392
346 Ga0157380_10184348
347 Ga0157380_10237371
348 Ga0157380_10768415
349 Ga0157380_11119192
350 Ga0157377_10066888
351 Ga0157379_10017728
352 Ga0157376_10079042
353 Ga0207645_10763221
354 Ga0207684_10771690
355 Ga0207707_10634333
356 Ga0207657_10346741
357 Ga0207646_10623103
358 Ga0207694_10866643
359 Ga0207650_11215327
360 Ga0207659_10002275
361 Ga0207659_10950043
362 Ga0207687_10078881
363 Ga0207700_10020868
364 Ga0207664_10061529
365 Ga0207644_10137182
366 Ga0207644_10550230
367 Ga0207706_10782345
368 Ga0207709_10276388
369 Ga0207709_11020250
370 Ga0207670_10423456
371 Ga0207669_10023793
372 Ga0207669_10051095
373 Ga0207704_10249947
374 Ga0207704_11345196
375 Ga0207691_10391989
376 Ga0207691_10564659
377 Ga0207711_10073274
378 Ga0207689_10199665
379 Ga0207651_10253866
380 Ga0207651_10363037
381 Ga0207651_11041277
382 Ga0207712_11525835
383 Ga0207668_10039233
384 Ga0207668_10272482
385 Ga0207677_10231277
386 Ga0207703_10010325
387 Ga0207703_10706756
388 Ga0207703_11851580
389 Ga0207648_10088228
390 Ga0207648_10332127
391 Ga0207675_100685385
392 Ga0207675_101435610
393 Ga0207683_10222027
394 Ga0207683_10293916
395 Ga0207428_10279320
396 Ga0268266_10464127
397 Ga0268266_10537364
398 Ga0268265_10008553
399 Ga0268265_10979152
400 Ga0268264_10135177
401 Ga0268264_10179106
402 Ga0268264_11283178
403 Ga0265332_10347946
404 Ga0307513_10169834
405 Ga0307408_100022535
406 Ga0307408_100056698
407 Ga0307408_100536906
408 Ga0307408_100706116
409 Ga0307410_10015632
410 Ga0307410_10043723
411 Ga0307407_10018167
412 Ga0307407_10444140
413 Ga0307412_10052749
414 Ga0307409_100285148
415 Ga0307416_100041649
416 Ga0307416_100536133
417 Ga0307414_10033131
418 Ga0307414_10342314
419 Ga0373944_0279904
420 Ga0373923_0064688
421 Ga0373954_0146035
422 Ga0373943_0096570
423 Ga0373955_0099377
424 Ga0373933_0070048
425 Ga0373937_0170695
426 Ga0373925_0883440
427 Ga0451807_1640223
428 Ga0450892_033919
429 Ga0439435_0029571
430 Ga0439444_0041426
431 Ga0439460_0006218
432 Ga0439460_0007216
433 Ga0450916_024746
434 Ga0451576_0954122
435 Ga0466967_0351489
436 Ga0495638_0093569
437 Ga0495651_0144249
438 Ga0495580_0631020
439 Ga0495616_0368184
440 Ga0495628_0010696
441 Ga0495642_0440216
442 Ga0495652_0064984
443 Ga0495587_0269826
444 Ga0495621_0166662
445 Ga0495645_0010248
446 Ga0495633_0097423
447 Ga0495659_0156818
448 Ga0495623_0164364
449 Ga0495646_0156415
450 Ga0495647_0035155
451 Ga0495658_0184505
452 Ga0495613_0000720
453 Ga0495600_0045934
454 Ga0495684_0006668
455 Ga0496100_0003982
456 Ga0496101_0000451
457 Ga0496102_0023480
458 Ga0496104_0012288
459 Ga0496105_0010234
460 Ga0496106_0425136
461 Ga0496108_0883482
462 Ga0496112_0068212
463 Ga0496113_0590495
464 Ga0496114_0001764
465 Ga0496114_0250082
466 Ga0501299_009586
467 Ga0501047_0248567
468 Ga0501069_0171450
469 Ga0501073_0815824
470 Ga0501076_0558228
471 Ga0501044_0001109
472 Ga0501045_1107766
473 nmdc:mga00v17_215708_c1
474 nmdc:mga06z11_292545_c1
475 nmdc:mga05p37_25173_c1
476 nmdc:mga05p37_8651_c1
477 nmdc:mga06r32_768763_c1
478 nmdc:mga06r32_88222_c1
479 nmdc:mga08y16_168211_c1
480 nmdc:mga0n895_36571_c1
481 nmdc:mga0n895_59233_c1
482 nmdc:mga0n895_931944_c1
483 nmdc:mga0rr50_101211_c1
484 nmdc:mga08x19_106395_c1
485 nmdc:mga08x19_378133_c1
486 nmdc:mga0a205_445109_c1
487 nmdc:mga0a205_50252_c1
488 nmdc:mga0a205_72985_c1
489 Ga0495601_0013493
490 Ga0495612_0112238
491 Ga0495595_0566228
492 Ga0495619_0001542
493 Ga0500641_0022147
494 Ga0500568_0002892
495 Ga0590071_000382
496 Ga0590074_000767
497 Ga0590075_005166
498 Ga0590077_000003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

9

126

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oi0-assembly3.cif.gz_C crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus 0.8507 6 136
6h3c-assembly1.cif.gz_G cryo-em structure of the brisc complex bound to shmt2 0.8489 5 136
5ld9-assembly1.cif.gz_A structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8462 5 139
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8432 5 136
1oi0-assembly1.cif.gz_A crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus 0.8402 5 136
ID Description Score Start End Superfamily
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8266 6 138 3.40.140.10
af_Q8I3K2_1_226_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8143 119 135 2.130.10.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7936 6 138 3.40.140.10
1r5xB00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7909 5 136 3.40.140.10
af_A0A0R4IER2_1_165_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7785 5 136 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7H4NKM8-F1-model_v4 deleted 0.9936 78 136
AF-A0A3D4JCX9-F1-model_v4 JAB domain-containing protein 0.9851 82 136 GO:0006508
GO:0008235
GO:0008270
AF-A0A381RI66-F1-model_v4 MPN domain-containing protein 0.969 5 138 GO:0006508
GO:0008235
GO:0008270
AF-A0A2E4FU21-F1-model_v4 MPN domain-containing protein 0.9681 5 136 GO:0006508
GO:0008235
GO:0008270
AF-A0A2E9NQ68-F1-model_v4 MPN domain-containing protein 0.961 6 136 GO:0006508
GO:0008235
GO:0008270

Map