F361119

General Info

Members Datasets Scaffolds Average Seq Length
249 180 498 175

Family's Representative Sequence

Representative Sequence 3300049851|Ga0501212_018664|Ga0501212_018664_239_826
Length 195
Sequence MNRTFSLDDALPVLRASPQVLHAWLSELPQFWTSANEGPETWSPYDIVGHLIHGERTDWIPRLELILVQGEAQPFTPFDRFAQFRNSRGKPLTELLNTFAELRRANVARLESLRLTPSDFERRGRHPELGPVTLGQLLATWVAHDLSHLGQIARVMGRQYTTAVGPWLEYLPLLTRGGTSHASVSRTTPSASAFR

Samples

Sample ID Description Type Environment
1 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
161 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
162 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
163 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
164 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
168 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.62
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 28.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501212_018664 3300049851 Unclassified 1058
2 rootH1_10082445 3300003316 Bacteria 2799
3 rootH1_10183189 3300003316 Bacteria 1326
4 rootL2_10096132 3300003322 Bacteria 4366
5 Ga0065715_10102379 3300005293 Bacteria 3114
6 Ga0070690_100053543 3300005330 Bacteria 2581
7 Ga0068869_100279988 3300005334 Bacteria 1341
8 Ga0070680_100228898 3300005336 Unclassified 1570
9 Ga0068868_100409879 3300005338 Unclassified 1171
10 Ga0070687_100165597 3300005343 Unclassified 1311
11 Ga0070661_100087524 3300005344 Bacteria 2304
12 Ga0070661_101100996 3300005344 Bacteria 662
13 Ga0070692_10480291 3300005345 Unclassified 801
14 Ga0070692_10544304 3300005345 Unclassified 759
15 Ga0070669_100000003 3300005353 Bacteria 338807
16 Ga0070669_100019085 3300005353 Bacteria 4901
17 Ga0070675_100073703 3300005354 Bacteria 2835
18 Ga0070675_100593157 3300005354 Bacteria 1004
19 Ga0070674_101139274 3300005356 Unclassified 690
20 Ga0070673_100147107 3300005364 Bacteria 1992
21 Ga0070667_100393872 3300005367 Bacteria 1260
22 Ga0070667_100443764 3300005367 Bacteria 1185
23 Ga0070667_101066497 3300005367 Bacteria 755
24 Ga0070703_10000617 3300005406 Bacteria 12627
25 Ga0070709_10394395 3300005434 Bacteria 1032
26 Ga0070713_100631210 3300005436 Bacteria 1019
27 Ga0070711_100010264 3300005439 Bacteria 5794
28 Ga0070711_100310742 3300005439 Bacteria 1256
29 Ga0070705_100008249 3300005440 Bacteria 5156
30 Ga0070705_100281098 3300005440 Unclassified 1183
31 Ga0070705_100455373 3300005440 Bacteria 961
32 Ga0070700_100025080 3300005441 Bacteria 3508
33 Ga0070708_100000847 3300005445 Bacteria 23031
34 Ga0070708_100672351 3300005445 Unclassified 975
35 Ga0070662_100050114 3300005457 Bacteria 3012
36 Ga0070662_100751004 3300005457 Unclassified 827
37 Ga0070681_10129653 3300005458 Bacteria 2454
38 Ga0068867_100170376 3300005459 Unclassified 1724
39 Ga0070685_10004524 3300005466 Bacteria 7039
40 Ga0070706_100000299 3300005467 Bacteria 60351
41 Ga0070706_100005276 3300005467 Bacteria 12328
42 Ga0070707_100005307 3300005468 Bacteria 12063
43 Ga0070698_100117557 3300005471 Unclassified 2621
44 Ga0070698_100468548 3300005471 Bacteria 1196
45 Ga0070699_100000098 3300005518 Bacteria 81947
46 Ga0070699_100004524 3300005518 Bacteria 12306
47 Ga0070699_100619543 3300005518 Bacteria 987
48 Ga0070679_100139139 3300005530 Bacteria 2408
49 Ga0070697_100276455 3300005536 Unclassified 1440
50 Ga0068853_101446855 3300005539 Bacteria 665
51 Ga0070672_100032552 3300005543 Bacteria 3936
52 Ga0070672_100422265 3300005543 Bacteria 1145
53 Ga0070672_100564383 3300005543 Bacteria 989
54 Ga0070686_100011596 3300005544 Bacteria 5003
55 Ga0070695_100507674 3300005545 Unclassified 933
56 Ga0070696_100000022 3300005546 Bacteria 70510
57 Ga0070696_100064037 3300005546 Bacteria 2576
58 Ga0070696_100192382 3300005546 Unclassified 1519
59 Ga0070693_100027817 3300005547 Unclassified 3069
60 Ga0070693_100159151 3300005547 Bacteria 1437
61 Ga0070665_100000081 3300005548 Bacteria 184646
62 Ga0070704_100193599 3300005549 Bacteria 1636
63 Ga0070704_100798630 3300005549 Bacteria 843
64 Ga0070664_100061175 3300005564 Bacteria 3209
65 Ga0070664_100289766 3300005564 Bacteria 1478
66 Ga0068857_100635595 3300005577 Unclassified 1011
67 Ga0068854_100622367 3300005578 Bacteria 924
68 Ga0070702_100389684 3300005615 Bacteria 993
69 Ga0068852_100302780 3300005616 Bacteria 1548
70 Ga0068859_101022202 3300005617 Unclassified 908
71 Ga0068866_10158990 3300005718 Unclassified 1316
72 Ga0068870_10047070 3300005840 Bacteria 2265
73 Ga0068870_10237327 3300005840 Bacteria 1124
74 Ga0068863_100330893 3300005841 Unclassified 1481
75 Ga0068863_100396071 3300005841 Archaea 1350
76 Ga0068858_100139223 3300005842 Unclassified 2278
77 Ga0081455_10054928 3300005937 Bacteria 3390
78 Ga0070717_10024213 3300006028 Bacteria 4818
79 Ga0070712_100403209 3300006175 Bacteria 1130
80 Ga0097621_100146688 3300006237 Bacteria 2021
81 Ga0068871_100177954 3300006358 Unclassified 1827
82 Ga0075428_100007916 3300006844 Bacteria 11782
83 Ga0075428_100245318 3300006844 Bacteria 1931
84 Ga0075428_100976907 3300006844 Bacteria 897
85 Ga0075430_100879116 3300006846 Bacteria 738
86 Ga0075431_100274294 3300006847 Unclassified 1708
87 Ga0075433_10008090 3300006852 Bacteria 8374
88 Ga0075433_10861880 3300006852 Unclassified 790
89 Ga0075429_100012819 3300006880 Bacteria 7273
90 Ga0075436_100240616 3300006914 Bacteria 1287
91 Ga0097620_101022270 3300006931 Unclassified 908
92 Ga0111539_10533220 3300009094 Bacteria 1368
93 Ga0111539_10966976 3300009094 Bacteria 990
94 Ga0114129_10026477 3300009147 Bacteria 8212
95 Ga0114129_10032433 3300009147 Bacteria 7383
96 Ga0114129_10548867 3300009147 Unclassified 1503
97 Ga0105243_10456502 3300009148 Bacteria 1200
98 Ga0105242_10106671 3300009176 Unclassified 2381
99 Ga0105237_10752213 3300009545 Unclassified 981
100 Ga0105249_10924360 3300009553 Unclassified 940
101 Ga0105239_10070416 3300010375 Bacteria 3842
102 Ga0105239_11574269 3300010375 Bacteria 760
103 Ga0105246_10376290 3300011119 Bacteria 1172
104 Ga0157370_10944877 3300013104 Bacteria 782
105 Ga0157374_11251744 3300013296 Bacteria 764
106 Ga0157374_11445713 3300013296 Archaea 710
107 Ga0157378_10006639 3300013297 Bacteria 10109
108 Ga0157378_10385274 3300013297 Unclassified 1378
109 Ga0157378_11053623 3300013297 Bacteria 849
110 Ga0163162_11036576 3300013306 Unclassified 928
111 Ga0157380_10423878 3300014326 Bacteria 1270
112 Ga0157377_10011451 3300014745 Bacteria 4427
113 Ga0157379_11440137 3300014968 Bacteria 669
114 Ga0157376_10952397 3300014969 Unclassified 879
115 Ga0207653_10001151 3300025885 Bacteria 8673
116 Ga0207653_10007430 3300025885 Bacteria 3416
117 Ga0207699_10188420 3300025906 Bacteria 1391
118 Ga0207645_10036848 3300025907 Bacteria 3141
119 Ga0207645_10828492 3300025907 Bacteria 629
120 Ga0207643_10260252 3300025908 Unclassified 1071
121 Ga0207684_10000586 3300025910 Bacteria 43887
122 Ga0207707_10332519 3300025912 Bacteria 1311
123 Ga0207693_10125572 3300025915 Bacteria 2017
124 Ga0207693_10361410 3300025915 Bacteria 1136
125 Ga0207663_10003537 3300025916 Bacteria 7664
126 Ga0207660_10099431 3300025917 Bacteria 2171
127 Ga0207662_10230633 3300025918 Unclassified 1209
128 Ga0207652_10554647 3300025921 Bacteria 1032
129 Ga0207646_10514896 3300025922 Bacteria 1077
130 Ga0207681_10000007 3300025923 Bacteria 483669
131 Ga0207681_10014678 3300025923 Bacteria 4877
132 Ga0207659_10648592 3300025926 Bacteria 902
133 Ga0207700_10586881 3300025928 Bacteria 991
134 Ga0207664_10018137 3300025929 Bacteria 5172
135 Ga0207644_10033948 3300025931 Bacteria 3569
136 Ga0207690_10407854 3300025932 Bacteria 1085
137 Ga0207706_10731611 3300025933 Unclassified 844
138 Ga0207691_10022795 3300025940 Bacteria 5903
139 Ga0207691_10148913 3300025940 Bacteria 2059
140 Ga0207691_10356658 3300025940 Bacteria 1251
141 Ga0207661_10295357 3300025944 Bacteria 1451
142 Ga0207679_10766350 3300025945 Bacteria 878
143 Ga0207651_10094328 3300025960 Bacteria 2200
144 Ga0207651_10532770 3300025960 Unclassified 1019
145 Ga0207712_10642303 3300025961 Unclassified 922
146 Ga0207640_10694642 3300025981 Bacteria 872
147 Ga0207658_10364338 3300025986 Bacteria 1262
148 Ga0207677_10218646 3300026023 Bacteria 1526
149 Ga0207703_10406832 3300026035 Bacteria 1264
150 Ga0207708_10040588 3300026075 Bacteria 3548
151 Ga0207708_10119970 3300026075 Bacteria 2049
152 Ga0207648_10149869 3300026089 Bacteria 2058
153 Ga0207674_10580738 3300026116 Unclassified 1083
154 Ga0207683_10168267 3300026121 Bacteria 1984
155 Ga0207698_10821164 3300026142 Bacteria 933
156 Ga0209966_1088451 3300027695 Bacteria 692
157 Ga0268266_10000464 3300028379 Bacteria 58961
158 Ga0268265_11110619 3300028380 Bacteria 785
159 Ga0265332_10265945 3300031238 Unclassified 709
160 Ga0307408_100162840 3300031548 Bacteria 1773
161 Ga0307413_10006748 3300031824 Bacteria 5271
162 Ga0307413_10616070 3300031824 Unclassified 890
163 Ga0307410_10032955 3300031852 Bacteria 3341
164 Ga0307410_10545240 3300031852 Unclassified 960
165 Ga0307406_10041355 3300031901 Bacteria 2872
166 Ga0307407_10004609 3300031903 Bacteria 5879
167 Ga0307407_10024618 3300031903 Bacteria 3160
168 Ga0307407_10320953 3300031903 Bacteria 1087
169 Ga0307412_10452537 3300031911 Unclassified 1058
170 Ga0307412_11257146 3300031911 Unclassified 665
171 Ga0307409_100016072 3300031995 Bacteria 4938
172 Ga0307409_100031849 3300031995 Bacteria 3813
173 Ga0307409_100075146 3300031995 Bacteria 2704
174 Ga0307409_100440912 3300031995 Unclassified 1254
175 Ga0307409_100663765 3300031995 Bacteria 1038
176 Ga0307416_100000703 3300032002 Bacteria 17364
177 Ga0307416_100032253 3300032002 Bacteria 3955
178 Ga0307416_100065472 3300032002 Unclassified 2987
179 Ga0307416_101460719 3300032002 Unclassified 789
180 Ga0307414_10017225 3300032004 Bacteria 4415
181 Ga0307414_10177568 3300032004 Bacteria 1709
182 Ga0307411_10014342 3300032005 Bacteria 4406
183 Ga0307411_10396606 3300032005 Unclassified 1139
184 Ga0307415_100011553 3300032126 Bacteria 5059
185 Ga0307415_100014531 3300032126 Bacteria 4632
186 Ga0307415_100075378 3300032126 Bacteria 2387
187 Ga0307415_100275120 3300032126 Unclassified 1381
188 Ga0373958_0088831 3300034819 Unclassified 710
189 Ga0373943_0167602 3300035170 Bacteria 1200
190 Ga0373935_0034756 3300035692 Bacteria 3144
191 Ga0373947_0183146 3300035725 Bacteria 1364
192 Ga0373925_0350800 3300037068 Bacteria 1198
193 Ga0242420_009094 3300038996 Unclassified 1625
194 Ga0453684_0373576 3300044712 Bacteria 1602
195 Ga0451576_1022135 3300045051 Bacteria 866
196 Ga0495608_0341843 3300046511 Unclassified 922
197 Ga0495628_0169694 3300046516 Bacteria 1655
198 Ga0495630_0253675 3300046517 Bacteria 1344
199 Ga0495640_0258124 3300046533 Unclassified 1090
200 Ga0495667_0781804 3300046559 Unclassified 589
201 Ga0495647_0013826 3300046681 Bacteria 2804
202 Ga0495674_0091758 3300047319 Bacteria 2594
203 Ga0496101_0228424 3300048904 Unclassified 1446
204 Ga0496101_0665669 3300048904 Bacteria 822
205 Ga0496102_0172713 3300048905 Unclassified 2035
206 Ga0496105_0265550 3300048908 Bacteria 1387
207 Ga0496106_0142036 3300048909 Bacteria 1889
208 Ga0496106_0658476 3300048909 Bacteria 836
209 Ga0496107_0716586 3300048910 Bacteria 735
210 Ga0496108_0087338 3300048911 Bacteria 2648
211 Ga0496109_0072040 3300048912 Bacteria 3173
212 Ga0496110_0078492 3300048913 Bacteria 2939
213 Ga0496110_0483501 3300048913 Bacteria 1128
214 Ga0496111_0613852 3300048914 Unclassified 795
215 Ga0496113_0447753 3300048916 Unclassified 1037
216 Ga0496115_0194050 3300048918 Bacteria 1678
217 Ga0501298_143506 3300049521 Unclassified 579
218 Ga0501031_0442517 3300049568 Unclassified 840
219 Ga0501034_0251384 3300049571 Unclassified 1712
220 Ga0501040_0618205 3300049576 Bacteria 783
221 Ga0501072_0236306 3300049588 Bacteria 1456
222 Ga0501075_0112351 3300049591 Bacteria 2072
223 Ga0501227_022645 3300049665 Unclassified 1456
224 Ga0501230_082406 3300049667 Unclassified 675
225 Ga0501242_026036 3300049674 Unclassified 772
226 Ga0501257_128252 3300049686 Unclassified 684
227 Ga0501245_036023 3300049708 Unclassified 835
228 Ga0501079_0336778 3300049741 Bacteria 1182
229 Ga0501081_0177256 3300049743 Bacteria 1541
230 Ga0501268_028651 3300049765 Bacteria 996
231 Ga0501279_072447 3300049775 Unclassified 582
232 nmdc:mga05p37_2422_c1 3300050507 Bacteria 21695
233 nmdc:mga05p37_777131_c1 3300050507 Unclassified 1051
234 nmdc:mga09592_168590_c1 3300050508 Bacteria 1893
235 nmdc:mga09592_838397_c1 3300050508 Bacteria 776
236 nmdc:mga0qj67_242881_c1 3300050509 Unclassified 1461
237 nmdc:mga06r32_543457_c1 3300050510 Unclassified 1136
238 nmdc:mga06r32_57032_c1 3300050510 Bacteria 3752
239 nmdc:mga08y16_256592_c1 3300050511 Bacteria 1806
240 nmdc:mga08y16_471694_c1 3300050511 Bacteria 1278
241 nmdc:mga0rr50_242120_c1 3300050513 Bacteria 1495
242 nmdc:mga0rr50_778705_c1 3300050513 Bacteria 816
243 nmdc:mga0a205_10859_c1 3300050515 Bacteria 8377
244 Ga0495601_0003749 3300053077 Bacteria 8749
245 Ga0495595_0022093 3300053084 Bacteria 2789
246 Ga0495619_0012147 3300053085 Bacteria 5423
247 Ga0501082_0710157 3300060353 Unclassified 880
248 Ga0530510_0072591 3300061734 Bacteria 2498
249 Ga0530510_0364713 3300061734 Unclassified 1086
250 Ga0501212_018664
251 rootH1_10082445
252 rootH1_10183189
253 rootL2_10096132
254 Ga0065715_10102379
255 Ga0070690_100053543
256 Ga0068869_100279988
257 Ga0070680_100228898
258 Ga0068868_100409879
259 Ga0070687_100165597
260 Ga0070661_100087524
261 Ga0070661_101100996
262 Ga0070692_10480291
263 Ga0070692_10544304
264 Ga0070669_100000003
265 Ga0070669_100019085
266 Ga0070675_100073703
267 Ga0070675_100593157
268 Ga0070674_101139274
269 Ga0070673_100147107
270 Ga0070667_100393872
271 Ga0070667_100443764
272 Ga0070667_101066497
273 Ga0070703_10000617
274 Ga0070709_10394395
275 Ga0070713_100631210
276 Ga0070711_100010264
277 Ga0070711_100310742
278 Ga0070705_100008249
279 Ga0070705_100281098
280 Ga0070705_100455373
281 Ga0070700_100025080
282 Ga0070708_100000847
283 Ga0070708_100672351
284 Ga0070662_100050114
285 Ga0070662_100751004
286 Ga0070681_10129653
287 Ga0068867_100170376
288 Ga0070685_10004524
289 Ga0070706_100000299
290 Ga0070706_100005276
291 Ga0070707_100005307
292 Ga0070698_100117557
293 Ga0070698_100468548
294 Ga0070699_100000098
295 Ga0070699_100004524
296 Ga0070699_100619543
297 Ga0070679_100139139
298 Ga0070697_100276455
299 Ga0068853_101446855
300 Ga0070672_100032552
301 Ga0070672_100422265
302 Ga0070672_100564383
303 Ga0070686_100011596
304 Ga0070695_100507674
305 Ga0070696_100000022
306 Ga0070696_100064037
307 Ga0070696_100192382
308 Ga0070693_100027817
309 Ga0070693_100159151
310 Ga0070665_100000081
311 Ga0070704_100193599
312 Ga0070704_100798630
313 Ga0070664_100061175
314 Ga0070664_100289766
315 Ga0068857_100635595
316 Ga0068854_100622367
317 Ga0070702_100389684
318 Ga0068852_100302780
319 Ga0068859_101022202
320 Ga0068866_10158990
321 Ga0068870_10047070
322 Ga0068870_10237327
323 Ga0068863_100330893
324 Ga0068863_100396071
325 Ga0068858_100139223
326 Ga0081455_10054928
327 Ga0070717_10024213
328 Ga0070712_100403209
329 Ga0097621_100146688
330 Ga0068871_100177954
331 Ga0075428_100007916
332 Ga0075428_100245318
333 Ga0075428_100976907
334 Ga0075430_100879116
335 Ga0075431_100274294
336 Ga0075433_10008090
337 Ga0075433_10861880
338 Ga0075429_100012819
339 Ga0075436_100240616
340 Ga0097620_101022270
341 Ga0111539_10533220
342 Ga0111539_10966976
343 Ga0114129_10026477
344 Ga0114129_10032433
345 Ga0114129_10548867
346 Ga0105243_10456502
347 Ga0105242_10106671
348 Ga0105237_10752213
349 Ga0105249_10924360
350 Ga0105239_10070416
351 Ga0105239_11574269
352 Ga0105246_10376290
353 Ga0157370_10944877
354 Ga0157374_11251744
355 Ga0157374_11445713
356 Ga0157378_10006639
357 Ga0157378_10385274
358 Ga0157378_11053623
359 Ga0163162_11036576
360 Ga0157380_10423878
361 Ga0157377_10011451
362 Ga0157379_11440137
363 Ga0157376_10952397
364 Ga0207653_10001151
365 Ga0207653_10007430
366 Ga0207699_10188420
367 Ga0207645_10036848
368 Ga0207645_10828492
369 Ga0207643_10260252
370 Ga0207684_10000586
371 Ga0207707_10332519
372 Ga0207693_10125572
373 Ga0207693_10361410
374 Ga0207663_10003537
375 Ga0207660_10099431
376 Ga0207662_10230633
377 Ga0207652_10554647
378 Ga0207646_10514896
379 Ga0207681_10000007
380 Ga0207681_10014678
381 Ga0207659_10648592
382 Ga0207700_10586881
383 Ga0207664_10018137
384 Ga0207644_10033948
385 Ga0207690_10407854
386 Ga0207706_10731611
387 Ga0207691_10022795
388 Ga0207691_10148913
389 Ga0207691_10356658
390 Ga0207661_10295357
391 Ga0207679_10766350
392 Ga0207651_10094328
393 Ga0207651_10532770
394 Ga0207712_10642303
395 Ga0207640_10694642
396 Ga0207658_10364338
397 Ga0207677_10218646
398 Ga0207703_10406832
399 Ga0207708_10040588
400 Ga0207708_10119970
401 Ga0207648_10149869
402 Ga0207674_10580738
403 Ga0207683_10168267
404 Ga0207698_10821164
405 Ga0209966_1088451
406 Ga0268266_10000464
407 Ga0268265_11110619
408 Ga0265332_10265945
409 Ga0307408_100162840
410 Ga0307413_10006748
411 Ga0307413_10616070
412 Ga0307410_10032955
413 Ga0307410_10545240
414 Ga0307406_10041355
415 Ga0307407_10004609
416 Ga0307407_10024618
417 Ga0307407_10320953
418 Ga0307412_10452537
419 Ga0307412_11257146
420 Ga0307409_100016072
421 Ga0307409_100031849
422 Ga0307409_100075146
423 Ga0307409_100440912
424 Ga0307409_100663765
425 Ga0307416_100000703
426 Ga0307416_100032253
427 Ga0307416_100065472
428 Ga0307416_101460719
429 Ga0307414_10017225
430 Ga0307414_10177568
431 Ga0307411_10014342
432 Ga0307411_10396606
433 Ga0307415_100011553
434 Ga0307415_100014531
435 Ga0307415_100075378
436 Ga0307415_100275120
437 Ga0373958_0088831
438 Ga0373943_0167602
439 Ga0373935_0034756
440 Ga0373947_0183146
441 Ga0373925_0350800
442 Ga0242420_009094
443 Ga0453684_0373576
444 Ga0451576_1022135
445 Ga0495608_0341843
446 Ga0495628_0169694
447 Ga0495630_0253675
448 Ga0495640_0258124
449 Ga0495667_0781804
450 Ga0495647_0013826
451 Ga0495674_0091758
452 Ga0496101_0228424
453 Ga0496101_0665669
454 Ga0496102_0172713
455 Ga0496105_0265550
456 Ga0496106_0142036
457 Ga0496106_0658476
458 Ga0496107_0716586
459 Ga0496108_0087338
460 Ga0496109_0072040
461 Ga0496110_0078492
462 Ga0496110_0483501
463 Ga0496111_0613852
464 Ga0496113_0447753
465 Ga0496115_0194050
466 Ga0501298_143506
467 Ga0501031_0442517
468 Ga0501034_0251384
469 Ga0501040_0618205
470 Ga0501072_0236306
471 Ga0501075_0112351
472 Ga0501227_022645
473 Ga0501230_082406
474 Ga0501242_026036
475 Ga0501257_128252
476 Ga0501245_036023
477 Ga0501079_0336778
478 Ga0501081_0177256
479 Ga0501268_028651
480 Ga0501279_072447
481 nmdc:mga05p37_2422_c1
482 nmdc:mga05p37_777131_c1
483 nmdc:mga09592_168590_c1
484 nmdc:mga09592_838397_c1
485 nmdc:mga0qj67_242881_c1
486 nmdc:mga06r32_543457_c1
487 nmdc:mga06r32_57032_c1
488 nmdc:mga08y16_256592_c1
489 nmdc:mga08y16_471694_c1
490 nmdc:mga0rr50_242120_c1
491 nmdc:mga0rr50_778705_c1
492 nmdc:mga0a205_10859_c1
493 Ga0495601_0003749
494 Ga0495595_0022093
495 Ga0495619_0012147
496 Ga0501082_0710157
497 Ga0530510_0072591
498 Ga0530510_0364713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

14

152

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.9306 1 177
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.911 1 177
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8913 1 177
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8797 1 177
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8426 6 157
ID Description Score Start End Superfamily
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9482 1 170 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8897 1 170 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8288 3 156 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7703 3 156 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7387 4 151 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V9UE62-F1-model_v4 DinB-like domain-containing protein 0.9938 1 142
AF-A0A2V5SA27-F1-model_v4 DinB-like domain-containing protein 0.993 45 172
AF-A0A0S8A273-F1-model_v4 DinB-like domain-containing protein 0.9919 1 154
AF-A0A7V9GQ46-F1-model_v4 DinB family protein 0.9902 1 172
AF-A0A7L9C1K8-F1-model_v4 DinB family protein 0.99 1 172

Map