F361086

General Info

Members Datasets Scaffolds Average Seq Length
249 101 498 326

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0365351|Ga0501039_0365351_10_1065
Length 351
Sequence MLAGLRGQPPVGIVTRIAMGSRAHRCLRRAPAVLLVLVGGCAWDGPRSTLVADSDFARAILDVYAIITWASLGIAAVVSVVLVWVLLRFRARPDRPTPRQVRGHTALEIAWTIAPAVVLLVVAIPTIQVIFQTSRPAPSGALEVTVRGRQWWWEFHYPSLKVVTANELHLPAGRAAVLLLEGPDVIHSFWVPRLGGKRDVVPGRRLHITLTPETPGEYPGQCAEFCGASHALMGLRVIVQEPAAFDRWVAAQQAPPAEPAGEAAEGKAIYARSACVGCHTIQGVSVGVLGPDLTHFGSRTTLGAGLLPNTPDNLVAWLRDPAALKPAVKMPDLGLGEPEARALAAYLLSLK

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
56 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
57 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
76 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
77 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
78 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
81 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
82 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
83 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
84 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
97 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
98 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
99 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
101 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.8
Rhizosphere 99.2
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0365351 3300049575 Bacteria 1134
2 Ga0065707_10127211 3300005295 Bacteria 1988
3 Ga0070680_100129171 3300005336 Bacteria 2113
4 Ga0070689_100087365 3300005340 Bacteria 2453
5 Ga0070709_10024004 3300005434 Bacteria 3587
6 Ga0070711_100054237 3300005439 Bacteria 2766
7 Ga0070705_100050427 3300005440 Bacteria 2421
8 Ga0070694_100071214 3300005444 Bacteria 2396
9 Ga0070708_100015073 3300005445 Bacteria 6376
10 Ga0070708_100024996 3300005445 Bacteria 5104
11 Ga0070708_100062794 3300005445 Bacteria 3324
12 Ga0070706_100007471 3300005467 Bacteria 10245
13 Ga0070706_100031319 3300005467 Bacteria 4905
14 Ga0070706_100043403 3300005467 Bacteria 4155
15 Ga0070706_100063511 3300005467 Bacteria 3413
16 Ga0070707_100001664 3300005468 Bacteria 21519
17 Ga0070707_100002412 3300005468 Bacteria 17832
18 Ga0070699_100002943 3300005518 Bacteria 15140
19 Ga0070699_100014402 3300005518 Bacteria 6798
20 Ga0070699_100104817 3300005518 Bacteria 2480
21 Ga0070697_100003950 3300005536 Bacteria 11393
22 Ga0070697_100054433 3300005536 Bacteria 3252
23 Ga0070697_100112281 3300005536 Bacteria 2272
24 Ga0070695_100075470 3300005545 Bacteria 2218
25 Ga0070696_100037376 3300005546 Bacteria 3350
26 Ga0070696_100127515 3300005546 Bacteria 1848
27 Ga0070704_100025110 3300005549 Bacteria 3919
28 Ga0070704_100116019 3300005549 Bacteria 2047
29 Ga0068859_100163803 3300005617 Bacteria 2303
30 Ga0081455_10055068 3300005937 Bacteria 3385
31 Ga0081539_10000210 3300005985 Bacteria 136405
32 Ga0075432_10034128 3300006058 Bacteria 1766
33 Ga0075432_10082386 3300006058 Bacteria 1168
34 Ga0075428_100000684 3300006844 Bacteria 34864
35 Ga0075428_100005179 3300006844 Bacteria 14478
36 Ga0075428_100010479 3300006844 Bacteria 10299
37 Ga0075428_100010653 3300006844 Bacteria 10217
38 Ga0075428_100137644 3300006844 Bacteria 2655
39 Ga0075430_100000064 3300006846 Bacteria 57146
40 Ga0075430_100001059 3300006846 Bacteria 21773
41 Ga0075430_100033186 3300006846 Bacteria 4382
42 Ga0075430_100083932 3300006846 Bacteria 2668
43 Ga0075431_100000125 3300006847 Bacteria 50843
44 Ga0075431_100000159 3300006847 Bacteria 46966
45 Ga0075431_100000418 3300006847 Bacteria 34609
46 Ga0075431_100008589 3300006847 Bacteria 10224
47 Ga0075431_100009922 3300006847 Bacteria 9566
48 Ga0075431_100018762 3300006847 Bacteria 7047
49 Ga0075431_100030476 3300006847 Bacteria 5556
50 Ga0075431_100043698 3300006847 Bacteria 4622
51 Ga0075431_100082790 3300006847 Bacteria 3313
52 Ga0075431_100390662 3300006847 Bacteria 1394
53 Ga0075431_100408198 3300006847 Bacteria 1359
54 Ga0075433_10002977 3300006852 Bacteria 13011
55 Ga0075433_10105513 3300006852 Bacteria 2497
56 Ga0075433_10347386 3300006852 Bacteria 1311
57 Ga0075433_10372231 3300006852 Bacteria 1261
58 Ga0075434_100014501 3300006871 Bacteria 7534
59 Ga0075434_100054612 3300006871 Bacteria 3968
60 Ga0075434_100122647 3300006871 Bacteria 2615
61 Ga0075434_100178356 3300006871 Bacteria 2144
62 Ga0075434_100208609 3300006871 Bacteria 1974
63 Ga0075434_100506605 3300006871 Bacteria 1228
64 Ga0075429_100000503 3300006880 Bacteria 29455
65 Ga0075429_100005759 3300006880 Bacteria 10698
66 Ga0075429_100006930 3300006880 Bacteria 9844
67 Ga0075429_100017052 3300006880 Bacteria 6280
68 Ga0075429_100047710 3300006880 Bacteria 3726
69 Ga0075429_100306769 3300006880 Bacteria 1390
70 Ga0075436_100000150 3300006914 Bacteria 43045
71 Ga0075436_100073137 3300006914 Bacteria 2372
72 Ga0097620_100163790 3300006931 Bacteria 2303
73 Ga0099794_10001591 3300007265 Bacteria 7998
74 Ga0111539_10001957 3300009094 Bacteria 27483
75 Ga0111539_10117345 3300009094 Bacteria 3120
76 Ga0111539_10141183 3300009094 Bacteria 2820
77 Ga0114129_10000003 3300009147 Bacteria 183186
78 Ga0114129_10000044 3300009147 Bacteria 106171
79 Ga0114129_10002039 3300009147 Bacteria 27710
80 Ga0114129_10006266 3300009147 Bacteria 16866
81 Ga0114129_10023792 3300009147 Bacteria 8683
82 Ga0114129_10025604 3300009147 Bacteria 8358
83 Ga0114129_10037540 3300009147 Bacteria 6839
84 Ga0114129_10050766 3300009147 Bacteria 5825
85 Ga0114129_10074791 3300009147 Bacteria 4718
86 Ga0114129_10209798 3300009147 Bacteria 2634
87 Ga0114129_10326691 3300009147 Bacteria 2038
88 Ga0114129_10348491 3300009147 Bacteria 1962
89 Ga0105248_10268926 3300009177 Bacteria 1919
90 Ga0105248_10515035 3300009177 Bacteria 1349
91 Ga0105249_10074596 3300009553 Bacteria 3140
92 Ga0163162_10038945 3300013306 Bacteria 4746
93 Ga0163161_10146901 3300017792 Bacteria 1789
94 Ga0207684_10008159 3300025910 Bacteria 9329
95 Ga0207684_10009211 3300025910 Bacteria 8726
96 Ga0207684_10027388 3300025910 Bacteria 4857
97 Ga0207663_10057453 3300025916 Bacteria 2452
98 Ga0207646_10003439 3300025922 Bacteria 17884
99 Ga0207646_10007191 3300025922 Bacteria 11365
100 Ga0207646_10010798 3300025922 Bacteria 8879
101 Ga0207646_10016134 3300025922 Bacteria 7020
102 Ga0207646_10036779 3300025922 Bacteria 4419
103 Ga0207681_10198171 3300025923 Bacteria 1540
104 Ga0207706_10104210 3300025933 Bacteria 2496
105 Ga0207670_10067002 3300025936 Bacteria 2469
106 Ga0207689_10209017 3300025942 Bacteria 1612
107 Ga0207648_10129493 3300026089 Bacteria 2221
108 Ga0207674_10071908 3300026116 Bacteria 3475
109 Ga0207675_100212868 3300026118 Bacteria 1860
110 Ga0207428_10000177 3300027907 Bacteria 89397
111 Ga0307408_100016753 3300031548 Bacteria 4899
112 Ga0307408_100033471 3300031548 Bacteria 3591
113 Ga0307408_100279181 3300031548 Bacteria 1390
114 Ga0307405_10133791 3300031731 Bacteria 1718
115 Ga0307406_10091734 3300031901 Bacteria 2047
116 Ga0307407_10216520 3300031903 Bacteria 1292
117 Ga0307409_100243778 3300031995 Bacteria 1638
118 Ga0307416_100056339 3300032002 Bacteria 3172
119 Ga0307416_100165547 3300032002 Bacteria 2050
120 Ga0307411_10057052 3300032005 Bacteria 2577
121 Ga0307415_100213001 3300032126 Bacteria 1543
122 Ga0373938_0036018 3300034957 Bacteria 1081
123 Ga0373940_0020076 3300035088 Bacteria 1694
124 Ga0373931_0004396 3300035691 Bacteria 6437
125 Ga0373931_0089224 3300035691 Bacteria 1715
126 Ga0395899_0018677 3300037312 Bacteria 5269
127 Ga0395900_0007860 3300037418 Bacteria 10990
128 Ga0395900_0367586 3300037418 Bacteria 1409
129 Ga0395901_0005778 3300038443 Bacteria 12529
130 Ga0395901_0583711 3300038443 Unclassified 1129
131 Ga0436362_1046208 3300039453 Bacteria 1309
132 Ga0451577_0096190 3300042876 Bacteria 2644
133 Ga0453683_0046431 3300044673 Bacteria 2723
134 Ga0495586_0007523 3300046535 Bacteria 5812
135 Ga0495669_0002251 3300046684 Bacteria 7911
136 Ga0495669_0057931 3300046684 Bacteria 1748
137 Ga0496102_0005410 3300048905 Bacteria 10843
138 Ga0496106_0149617 3300048909 Bacteria 1841
139 Ga0501036_0123737 3300049572 Bacteria 2184
140 Ga0501038_0254064 3300049574 Bacteria 1391
141 Ga0501039_0070564 3300049575 Bacteria 2714
142 Ga0501039_0199612 3300049575 Bacteria 1573
143 Ga0501040_0024097 3300049576 Bacteria 4083
144 Ga0501040_0072720 3300049576 Bacteria 2375
145 Ga0501040_0111934 3300049576 Bacteria 1909
146 Ga0501042_0085721 3300049578 Bacteria 2259
147 Ga0501043_0191538 3300049579 Bacteria 1590
148 Ga0501046_0209667 3300049580 Bacteria 1447
149 Ga0501048_0076385 3300049582 Bacteria 2364
150 Ga0501048_0111490 3300049582 Bacteria 1931
151 Ga0501048_0124079 3300049582 Bacteria 1826
152 Ga0501048_0260580 3300049582 Bacteria 1232
153 Ga0501067_0030577 3300049583 Bacteria 2986
154 Ga0501068_0031945 3300049584 Bacteria 3129
155 Ga0501069_0040880 3300049585 Bacteria 2562
156 Ga0501071_0051689 3300049587 Bacteria 2962
157 Ga0501071_0094981 3300049587 Bacteria 2194
158 Ga0501071_0128695 3300049587 Bacteria 1880
159 Ga0501072_0003921 3300049588 Bacteria 11261
160 Ga0501072_0019790 3300049588 Bacteria 5208
161 Ga0501072_0030985 3300049588 Bacteria 4184
162 Ga0501072_0076879 3300049588 Bacteria 2642
163 Ga0501072_0128399 3300049588 Bacteria 2020
164 Ga0501074_0024332 3300049590 Bacteria 4401
165 Ga0501074_0093619 3300049590 Bacteria 2152
166 Ga0501075_0009535 3300049591 Bacteria 6795
167 Ga0501075_0120424 3300049591 Bacteria 1997
168 Ga0501075_0142557 3300049591 Bacteria 1826
169 Ga0501075_0228445 3300049591 Bacteria 1419
170 Ga0501076_0005115 3300049592 Bacteria 9389
171 Ga0501076_0039702 3300049592 Bacteria 3696
172 Ga0501076_0175826 3300049592 Bacteria 1745
173 Ga0501077_0014408 3300049593 Bacteria 4968
174 Ga0501079_0024957 3300049741 Bacteria 4586
175 Ga0501079_0052641 3300049741 Bacteria 3142
176 Ga0501079_0125539 3300049741 Bacteria 1996
177 Ga0501080_0181756 3300049742 Bacteria 1935
178 Ga0501081_0015444 3300049743 Bacteria 5038
179 Ga0501081_0062235 3300049743 Bacteria 2588
180 Ga0501081_0300780 3300049743 Bacteria 1177
181 Ga0501081_0307110 3300049743 Bacteria 1164
182 Ga0501083_0078961 3300049744 Bacteria 2183
183 Ga0501035_0192184 3300049822 Bacteria 1755
184 Ga0501045_0229257 3300049824 Bacteria 1383
185 nmdc:mga05p37_130996_c1 3300050507 Bacteria 3077
186 nmdc:mga05p37_14867_c3 3300050507 Bacteria 4920
187 nmdc:mga05p37_148881_c1 3300050507 Bacteria 2865
188 nmdc:mga05p37_17263_c1 3300050507 Bacteria 7438
189 nmdc:mga05p37_188_c1 3300050507 Bacteria 61157
190 nmdc:mga05p37_198_c1 3300050507 Bacteria 59977
191 nmdc:mga05p37_21428_c1 3300050507 Bacteria 7827
192 nmdc:mga05p37_254_c1 3300050507 Bacteria 55030
193 nmdc:mga05p37_382895_c1 3300050507 Bacteria 1648
194 nmdc:mga05p37_41681_c1 3300050507 Bacteria 5638
195 nmdc:mga05p37_417_c1 3300050507 Bacteria 46047
196 nmdc:mga05p37_45998_c1 3300050507 Bacteria 5367
197 nmdc:mga05p37_596879_c1 3300050507 Bacteria 1247
198 nmdc:mga05p37_732822_c1 3300050507 Bacteria 1093
199 nmdc:mga09592_120815_c1 3300050508 Bacteria 2250
200 nmdc:mga09592_4329_c1 3300050508 Bacteria 11472
201 nmdc:mga09592_46732_c1 3300050508 Bacteria 3647
202 nmdc:mga09592_4730_c1 3300050508 Bacteria 11027
203 nmdc:mga09592_60761_c1 3300050508 Bacteria 3195
204 nmdc:mga09592_616_c1 3300050508 Bacteria 27144
205 nmdc:mga09592_9492_c1 3300050508 Bacteria 7908
206 nmdc:mga09592_98249_c1 3300050508 Bacteria 2506
207 nmdc:mga0qj67_11340_c1 3300050509 Bacteria 6676
208 nmdc:mga0qj67_15072_c1 3300050509 Bacteria 5849
209 nmdc:mga0qj67_496_c1 3300050509 Bacteria 26809
210 nmdc:mga06r32_100823_c1 3300050510 Bacteria 2833
211 nmdc:mga06r32_107793_c1 3300050510 Bacteria 2738
212 nmdc:mga06r32_1740_c1 3300050510 Bacteria 19577
213 nmdc:mga06r32_2880_c1 3300050510 Bacteria 15430
214 nmdc:mga06r32_32384_c1 3300050510 Bacteria 4918
215 nmdc:mga06r32_3252_c1 3300050510 Bacteria 14536
216 nmdc:mga06r32_333966_c1 3300050510 Bacteria 1501
217 nmdc:mga06r32_3387_c1 3300050510 Bacteria 14255
218 nmdc:mga06r32_362809_c1 3300050510 Bacteria 1432
219 nmdc:mga06r32_49873_c1 3300050510 Bacteria 4004
220 nmdc:mga06r32_53844_c1 3300050510 Bacteria 3857
221 nmdc:mga06r32_54527_c1 3300050510 Bacteria 3833
222 nmdc:mga08y16_110391_c1 3300050511 Bacteria 2864
223 nmdc:mga08y16_1343_c1 3300050511 Bacteria 24548
224 nmdc:mga08y16_75747_c1 3300050511 Bacteria 3507
225 nmdc:mga0n895_1342_c1 3300050512 Bacteria 18240
226 nmdc:mga0n895_134981_c1 3300050512 Bacteria 2494
227 nmdc:mga0n895_22619_c1 3300050512 Bacteria 5896
228 nmdc:mga0n895_98490_c1 3300050512 Bacteria 2931
229 nmdc:mga0rr50_477_c1 3300050513 Bacteria 21201
230 nmdc:mga0rr50_58489_c1 3300050513 Bacteria 2889
231 nmdc:mga0rr50_84546_c1 3300050513 Bacteria 2457
232 nmdc:mga08x19_108869_c1 3300050514 Bacteria 1846
233 nmdc:mga08x19_274_c1 3300050514 Bacteria 38873
234 nmdc:mga0a205_117_c1 3300050515 Bacteria 47476
235 nmdc:mga0a205_152685_c1 3300050515 Bacteria 2208
236 nmdc:mga0a205_214697_c1 3300050515 Bacteria 1811
237 nmdc:mga0a205_226353_c1 3300050515 Bacteria 1755
238 nmdc:mga0a205_6393_c2 3300050515 Bacteria 10267
239 Ga0501084_0044841 3300054114 Bacteria 3702
240 Ga0501084_0062601 3300054114 Bacteria 3115
241 Ga0501084_0065931 3300054114 Bacteria 3029
242 Ga0501084_0165719 3300054114 Bacteria 1865
243 Ga0501084_0287683 3300054114 Bacteria 1388
244 Ga0501084_0289494 3300054114 Bacteria 1383
245 Ga0501082_0019299 3300060353 Bacteria 5877
246 Ga0530510_0002661 3300061734 Bacteria 12276
247 Ga0530510_0009424 3300061734 Bacteria 6847
248 Ga0530510_0123583 3300061734 Bacteria 1901
249 Ga0530510_0212846 3300061734 Bacteria 1436
250 Ga0501039_0365351
251 Ga0065707_10127211
252 Ga0070680_100129171
253 Ga0070689_100087365
254 Ga0070709_10024004
255 Ga0070711_100054237
256 Ga0070705_100050427
257 Ga0070694_100071214
258 Ga0070708_100015073
259 Ga0070708_100024996
260 Ga0070708_100062794
261 Ga0070706_100007471
262 Ga0070706_100031319
263 Ga0070706_100043403
264 Ga0070706_100063511
265 Ga0070707_100001664
266 Ga0070707_100002412
267 Ga0070699_100002943
268 Ga0070699_100014402
269 Ga0070699_100104817
270 Ga0070697_100003950
271 Ga0070697_100054433
272 Ga0070697_100112281
273 Ga0070695_100075470
274 Ga0070696_100037376
275 Ga0070696_100127515
276 Ga0070704_100025110
277 Ga0070704_100116019
278 Ga0068859_100163803
279 Ga0081455_10055068
280 Ga0081539_10000210
281 Ga0075432_10034128
282 Ga0075432_10082386
283 Ga0075428_100000684
284 Ga0075428_100005179
285 Ga0075428_100010479
286 Ga0075428_100010653
287 Ga0075428_100137644
288 Ga0075430_100000064
289 Ga0075430_100001059
290 Ga0075430_100033186
291 Ga0075430_100083932
292 Ga0075431_100000125
293 Ga0075431_100000159
294 Ga0075431_100000418
295 Ga0075431_100008589
296 Ga0075431_100009922
297 Ga0075431_100018762
298 Ga0075431_100030476
299 Ga0075431_100043698
300 Ga0075431_100082790
301 Ga0075431_100390662
302 Ga0075431_100408198
303 Ga0075433_10002977
304 Ga0075433_10105513
305 Ga0075433_10347386
306 Ga0075433_10372231
307 Ga0075434_100014501
308 Ga0075434_100054612
309 Ga0075434_100122647
310 Ga0075434_100178356
311 Ga0075434_100208609
312 Ga0075434_100506605
313 Ga0075429_100000503
314 Ga0075429_100005759
315 Ga0075429_100006930
316 Ga0075429_100017052
317 Ga0075429_100047710
318 Ga0075429_100306769
319 Ga0075436_100000150
320 Ga0075436_100073137
321 Ga0097620_100163790
322 Ga0099794_10001591
323 Ga0111539_10001957
324 Ga0111539_10117345
325 Ga0111539_10141183
326 Ga0114129_10000003
327 Ga0114129_10000044
328 Ga0114129_10002039
329 Ga0114129_10006266
330 Ga0114129_10023792
331 Ga0114129_10025604
332 Ga0114129_10037540
333 Ga0114129_10050766
334 Ga0114129_10074791
335 Ga0114129_10209798
336 Ga0114129_10326691
337 Ga0114129_10348491
338 Ga0105248_10268926
339 Ga0105248_10515035
340 Ga0105249_10074596
341 Ga0163162_10038945
342 Ga0163161_10146901
343 Ga0207684_10008159
344 Ga0207684_10009211
345 Ga0207684_10027388
346 Ga0207663_10057453
347 Ga0207646_10003439
348 Ga0207646_10007191
349 Ga0207646_10010798
350 Ga0207646_10016134
351 Ga0207646_10036779
352 Ga0207681_10198171
353 Ga0207706_10104210
354 Ga0207670_10067002
355 Ga0207689_10209017
356 Ga0207648_10129493
357 Ga0207674_10071908
358 Ga0207675_100212868
359 Ga0207428_10000177
360 Ga0307408_100016753
361 Ga0307408_100033471
362 Ga0307408_100279181
363 Ga0307405_10133791
364 Ga0307406_10091734
365 Ga0307407_10216520
366 Ga0307409_100243778
367 Ga0307416_100056339
368 Ga0307416_100165547
369 Ga0307411_10057052
370 Ga0307415_100213001
371 Ga0373938_0036018
372 Ga0373940_0020076
373 Ga0373931_0004396
374 Ga0373931_0089224
375 Ga0395899_0018677
376 Ga0395900_0007860
377 Ga0395900_0367586
378 Ga0395901_0005778
379 Ga0395901_0583711
380 Ga0436362_1046208
381 Ga0451577_0096190
382 Ga0453683_0046431
383 Ga0495586_0007523
384 Ga0495669_0002251
385 Ga0495669_0057931
386 Ga0496102_0005410
387 Ga0496106_0149617
388 Ga0501036_0123737
389 Ga0501038_0254064
390 Ga0501039_0070564
391 Ga0501039_0199612
392 Ga0501040_0024097
393 Ga0501040_0072720
394 Ga0501040_0111934
395 Ga0501042_0085721
396 Ga0501043_0191538
397 Ga0501046_0209667
398 Ga0501048_0076385
399 Ga0501048_0111490
400 Ga0501048_0124079
401 Ga0501048_0260580
402 Ga0501067_0030577
403 Ga0501068_0031945
404 Ga0501069_0040880
405 Ga0501071_0051689
406 Ga0501071_0094981
407 Ga0501071_0128695
408 Ga0501072_0003921
409 Ga0501072_0019790
410 Ga0501072_0030985
411 Ga0501072_0076879
412 Ga0501072_0128399
413 Ga0501074_0024332
414 Ga0501074_0093619
415 Ga0501075_0009535
416 Ga0501075_0120424
417 Ga0501075_0142557
418 Ga0501075_0228445
419 Ga0501076_0005115
420 Ga0501076_0039702
421 Ga0501076_0175826
422 Ga0501077_0014408
423 Ga0501079_0024957
424 Ga0501079_0052641
425 Ga0501079_0125539
426 Ga0501080_0181756
427 Ga0501081_0015444
428 Ga0501081_0062235
429 Ga0501081_0300780
430 Ga0501081_0307110
431 Ga0501083_0078961
432 Ga0501035_0192184
433 Ga0501045_0229257
434 nmdc:mga05p37_130996_c1
435 nmdc:mga05p37_14867_c3
436 nmdc:mga05p37_148881_c1
437 nmdc:mga05p37_17263_c1
438 nmdc:mga05p37_188_c1
439 nmdc:mga05p37_198_c1
440 nmdc:mga05p37_21428_c1
441 nmdc:mga05p37_254_c1
442 nmdc:mga05p37_382895_c1
443 nmdc:mga05p37_41681_c1
444 nmdc:mga05p37_417_c1
445 nmdc:mga05p37_45998_c1
446 nmdc:mga05p37_596879_c1
447 nmdc:mga05p37_732822_c1
448 nmdc:mga09592_120815_c1
449 nmdc:mga09592_4329_c1
450 nmdc:mga09592_46732_c1
451 nmdc:mga09592_4730_c1
452 nmdc:mga09592_60761_c1
453 nmdc:mga09592_616_c1
454 nmdc:mga09592_9492_c1
455 nmdc:mga09592_98249_c1
456 nmdc:mga0qj67_11340_c1
457 nmdc:mga0qj67_15072_c1
458 nmdc:mga0qj67_496_c1
459 nmdc:mga06r32_100823_c1
460 nmdc:mga06r32_107793_c1
461 nmdc:mga06r32_1740_c1
462 nmdc:mga06r32_2880_c1
463 nmdc:mga06r32_32384_c1
464 nmdc:mga06r32_3252_c1
465 nmdc:mga06r32_333966_c1
466 nmdc:mga06r32_3387_c1
467 nmdc:mga06r32_362809_c1
468 nmdc:mga06r32_49873_c1
469 nmdc:mga06r32_53844_c1
470 nmdc:mga06r32_54527_c1
471 nmdc:mga08y16_110391_c1
472 nmdc:mga08y16_1343_c1
473 nmdc:mga08y16_75747_c1
474 nmdc:mga0n895_1342_c1
475 nmdc:mga0n895_134981_c1
476 nmdc:mga0n895_22619_c1
477 nmdc:mga0n895_98490_c1
478 nmdc:mga0rr50_477_c1
479 nmdc:mga0rr50_58489_c1
480 nmdc:mga0rr50_84546_c1
481 nmdc:mga08x19_108869_c1
482 nmdc:mga08x19_274_c1
483 nmdc:mga0a205_117_c1
484 nmdc:mga0a205_152685_c1
485 nmdc:mga0a205_214697_c1
486 nmdc:mga0a205_226353_c1
487 nmdc:mga0a205_6393_c2
488 Ga0501084_0044841
489 Ga0501084_0062601
490 Ga0501084_0065931
491 Ga0501084_0165719
492 Ga0501084_0287683
493 Ga0501084_0289494
494 Ga0501082_0019299
495 Ga0530510_0002661
496 Ga0530510_0009424
497 Ga0530510_0123583
498 Ga0530510_0212846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

160

241

0.92

PF00034

Cytochrom_C

Cytochrome c

263

351

0.88

PF02790

COX2_TM

Cytochrome C oxidase subunit II, transmembrane domain

51

129

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w5z-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.9172 156 239
8gym-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.9146 156 237
4w9z-assembly1.cif.gz_A crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum 0.9064 124 242
6ci0-assembly1.cif.gz_B catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with e101a (ii) mutation 0.8955 41 244
7au3-assembly1.cif.gz_B cytochrome c oxidase structure in f-state 0.8921 41 242
ID Description Score Start End Superfamily
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9387 129 239 2.60.40.420
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9368 156 236 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9307 156 237 2.60.40.420
3hb3B01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9116 122 242 2.60.40.420
af_P9WP69_149_325_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9003 130 240 2.60.40.420
ID Description Score Start End GO Terms
AF-U6N4X7-F1-model_v4 Cytochrome c oxidase polypeptide II 0.942 156 241 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A3D4PXL4-F1-model_v4 Cytochrome c oxidase subunit II 0.9403 155 243 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A0F3NAB0-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) 0.9382 147 242 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A535ZSB2-F1-model_v4 Cytochrome c oxidase subunit II 0.9354 140 242 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A2V8PE98-F1-model_v4 Cytochrome-c oxidase 0.9353 156 229 GO:0004129
GO:0005507
GO:0016020
GO:0030313

Map