F360960

General Info

Members Datasets Scaffolds Average Seq Length
249 94 498 162

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0065195|Ga0453684_0065195_4012_4575
Length 187
Sequence MDPNGLVFIDAHPRSFFTHPRSSPVMTDKAFQDFYPEYFAHCYGCGSLNEHGHQIKSYWIGEETICHFQPKTHHTAIPGYVYGGLLASLIDCHGTGTAAAAGYRAESRGMDSEPPLRYLTASLHVDYLKPTPLGPILEVHGRIKEVKGRKVVVEEWITANGITTVKGEVVAVQVPEQLVQELLESAK

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
61 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
62 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
63 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
69 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
78 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
85 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
86 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
87 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
93 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
94 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.8
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.4
Rhizosphere 98.8
Stem 0
Stem Tuber 0
Unclassified 28.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0065195 3300044712 Bacteria 4646
2 SwRhRL3b_contig_3418702 2162886006 Unclassified 1009
3 SwRhRL3b_contig_3743321 2162886006 Unclassified 1047
4 SwRhRL2b_contig_1256101 2162886007 Unclassified 1340
5 Ga0065704_10004932 3300005289 Unclassified 3711
6 Ga0065704_10070618 3300005289 Bacteria 19040
7 Ga0065704_10238512 3300005289 Bacteria 1022
8 Ga0065712_10158117 3300005290 Bacteria 1283
9 Ga0065715_10388526 3300005293 Unclassified 897
10 Ga0065707_10000648 3300005295 Bacteria 16747
11 Ga0065707_10096457 3300005295 Unclassified 3266
12 Ga0065707_10097517 3300005295 Bacteria 3168
13 Ga0068869_100651535 3300005334 Bacteria 894
14 Ga0070680_100090761 3300005336 Unclassified 2529
15 Ga0070689_100485855 3300005340 Bacteria 1056
16 Ga0070692_11087851 3300005345 Unclassified 564
17 Ga0070700_100254182 3300005441 Unclassified 1262
18 Ga0070694_100057503 3300005444 Unclassified 2644
19 Ga0070694_100272685 3300005444 Bacteria 1287
20 Ga0070707_100147466 3300005468 Bacteria 2290
21 Ga0070707_100774619 3300005468 Bacteria 923
22 Ga0070698_100014801 3300005471 Bacteria 8245
23 Ga0070698_100043711 3300005471 Bacteria 4592
24 Ga0070698_100074880 3300005471 Unclassified 3390
25 Ga0070698_100130125 3300005471 Unclassified 2472
26 Ga0070698_100209484 3300005471 Bacteria 1884
27 Ga0070698_100305204 3300005471 Bacteria 1522
28 Ga0070698_100445453 3300005471 Bacteria 1230
29 Ga0070698_100530418 3300005471 Bacteria 1116
30 Ga0070698_100679179 3300005471 Bacteria 971
31 Ga0070698_101300801 3300005471 Unclassified 677
32 Ga0070699_100023549 3300005518 Bacteria 5304
33 Ga0070699_100095323 3300005518 Unclassified 2605
34 Ga0070699_100402576 3300005518 Bacteria 1237
35 Ga0070699_101385792 3300005518 Unclassified 645
36 Ga0070695_100191294 3300005545 Unclassified 1456
37 Ga0070696_100342587 3300005546 Bacteria 1155
38 Ga0070704_100718069 3300005549 Bacteria 888
39 Ga0070702_100887421 3300005615 Bacteria 697
40 Ga0070702_101395730 3300005615 Unclassified 572
41 Ga0068859_100693183 3300005617 Bacteria 1109
42 Ga0068859_101081562 3300005617 Bacteria 882
43 Ga0068864_100501638 3300005618 Bacteria 1168
44 Ga0068864_100844149 3300005618 Bacteria 902
45 Ga0068861_100132616 3300005719 Bacteria 2024
46 Ga0068861_101612916 3300005719 Viruses 639
47 Ga0068862_100010791 3300005844 Bacteria 7544
48 Ga0068862_100050090 3300005844 Bacteria 3568
49 Ga0068862_100475946 3300005844 Bacteria 1181
50 Ga0081539_10042058 3300005985 Bacteria 2665
51 Ga0075428_100111265 3300006844 Unclassified 2984
52 Ga0075428_100307348 3300006844 Bacteria 1704
53 Ga0075428_101056597 3300006844 Bacteria 858
54 Ga0075428_101918154 3300006844 Bacteria 615
55 Ga0075430_100129427 3300006846 Bacteria 2104
56 Ga0075430_100610083 3300006846 Bacteria 900
57 Ga0075430_100777808 3300006846 Unclassified 789
58 Ga0075431_100027856 3300006847 Bacteria 5798
59 Ga0075429_100008787 3300006880 Bacteria 8782
60 Ga0075429_100188882 3300006880 Bacteria 1805
61 Ga0075429_100233773 3300006880 Bacteria 1610
62 Ga0075429_100768997 3300006880 Bacteria 844
63 Ga0075429_100830640 3300006880 Unclassified 809
64 Ga0075429_100842977 3300006880 Bacteria 802
65 Ga0097620_100693152 3300006931 Bacteria 1109
66 Ga0097620_101081486 3300006931 Bacteria 882
67 Ga0105240_10300175 3300009093 Unclassified 1837
68 Ga0111539_10402711 3300009094 Unclassified 1594
69 Ga0114129_10078882 3300009147 Unclassified 4579
70 Ga0114129_10096216 3300009147 Bacteria 4099
71 Ga0114129_10096599 3300009147 Unclassified 4090
72 Ga0114129_10105354 3300009147 Unclassified 3898
73 Ga0114129_10206732 3300009147 Bacteria 2656
74 Ga0114129_10709447 3300009147 Bacteria 1292
75 Ga0114129_10960118 3300009147 Unclassified 1079
76 Ga0114129_11925287 3300009147 Bacteria 716
77 Ga0105243_10083290 3300009148 Unclassified 2616
78 Ga0105243_10931407 3300009148 Unclassified 866
79 Ga0105241_10415466 3300009174 Bacteria 1183
80 Ga0105242_10032045 3300009176 Unclassified 4201
81 Ga0105249_10015598 3300009553 Bacteria 6726
82 Ga0105249_10017161 3300009553 Bacteria 6426
83 Ga0105246_10064593 3300011119 Bacteria 2557
84 Ga0157380_11292265 3300014326 Unclassified 776
85 Ga0207684_11107416 3300025910 Bacteria 659
86 Ga0207646_10435907 3300025922 Bacteria 1182
87 Ga0207709_10882495 3300025935 Unclassified 726
88 Ga0207676_10134160 3300026095 Bacteria 2110
89 Ga0207676_11190270 3300026095 Bacteria 755
90 Ga0207674_10447607 3300026116 Bacteria 1248
91 Ga0207675_100053825 3300026118 Unclassified 3754
92 Ga0207675_101003418 3300026118 Viruses 853
93 Ga0268265_10487687 3300028380 Bacteria 1159
94 Ga0307408_100139619 3300031548 Bacteria 1901
95 Ga0316575_10004038 3300031665 Bacteria 5139
96 Ga0316575_10007577 3300031665 Bacteria 3930
97 Ga0316575_10052986 3300031665 Unclassified 1616
98 Ga0316575_10296303 3300031665 Bacteria 683
99 Ga0316579_10003595 3300031691 Bacteria 6084
100 Ga0316579_10006733 3300031691 Bacteria 4705
101 Ga0316579_10021048 3300031691 Bacteria 2901
102 Ga0316579_10027237 3300031691 Bacteria 2594
103 Ga0316579_10110121 3300031691 Bacteria 1322
104 Ga0316576_10002721 3300031727 Bacteria 10120
105 Ga0316576_10004739 3300031727 Bacteria 8212
106 Ga0316576_10008237 3300031727 Bacteria 6630
107 Ga0316576_10012198 3300031727 Bacteria 5668
108 Ga0316576_10151503 3300031727 Bacteria 1747
109 Ga0316576_10153949 3300031727 Bacteria 1733
110 Ga0316576_10291187 3300031727 Bacteria 1221
111 Ga0316578_10001029 3300031728 Bacteria 10720
112 Ga0316578_10019238 3300031728 Bacteria 3754
113 Ga0316578_10160301 3300031728 Unclassified 1356
114 Ga0316578_10207576 3300031728 Bacteria 1178
115 Ga0316578_10263409 3300031728 Bacteria 1033
116 Ga0316577_10003230 3300031733 Bacteria 8194
117 Ga0316577_10005769 3300031733 Bacteria 6507
118 Ga0316577_10051689 3300031733 Bacteria 2293
119 Ga0316577_10119587 3300031733 Bacteria 1480
120 Ga0316577_10150547 3300031733 Bacteria 1311
121 Ga0316577_10161470 3300031733 Unclassified 1264
122 Ga0316577_10212785 3300031733 Unclassified 1093
123 Ga0316577_10436285 3300031733 Bacteria 744
124 Ga0307413_10378991 3300031824 Bacteria 1101
125 Ga0307410_10063303 3300031852 Bacteria 2537
126 Ga0307407_10131930 3300031903 Unclassified 1600
127 Ga0307407_10344988 3300031903 Bacteria 1053
128 Ga0307412_10599170 3300031911 Bacteria 933
129 Ga0307409_100292566 3300031995 Bacteria 1511
130 Ga0307416_100542422 3300032002 Bacteria 1235
131 Ga0307415_100251046 3300032126 Bacteria 1437
132 Ga0316583_10001323 3300032133 Bacteria 8190
133 Ga0316583_10006421 3300032133 Bacteria 4222
134 Ga0316583_10182407 3300032133 Bacteria 730
135 Ga0316585_10007813 3300032137 Bacteria 3092
136 Ga0316585_10008901 3300032137 Bacteria 2916
137 Ga0316585_10024968 3300032137 Bacteria 1851
138 Ga0316580_10000531 3300032139 Bacteria 8843
139 Ga0316580_10001455 3300032139 Bacteria 6191
140 Ga0316580_10011280 3300032139 Bacteria 2711
141 Ga0316592_1050212 3300033524 Bacteria 931
142 Ga0316588_1001694 3300033528 Bacteria 3695
143 Ga0316574_0002614 3300035398 Bacteria 9077
144 Ga0316574_0010609 3300035398 Bacteria 5210
145 Ga0316574_0014628 3300035398 Bacteria 4537
146 Ga0316574_0024708 3300035398 Unclassified 3599
147 Ga0316574_0480144 3300035398 Unclassified 777
148 Ga0316582_0006570 3300036647 Bacteria 6121
149 Ga0316582_0007632 3300036647 Bacteria 5768
150 Ga0316582_0215246 3300036647 Bacteria 1313
151 Ga0316582_0221834 3300036647 Unclassified 1293
152 Ga0316582_0243847 3300036647 Bacteria 1231
153 Ga0316582_0369630 3300036647 Bacteria 987
154 Ga0316582_0439287 3300036647 Bacteria 899
155 Ga0316582_1119602 3300036647 Bacteria 536
156 Ga0316584_0005544 3300036712 Bacteria 8485
157 Ga0316584_0009185 3300036712 Bacteria 6848
158 Ga0316584_0017089 3300036712 Bacteria 5209
159 Ga0316584_0027910 3300036712 Bacteria 4157
160 Ga0316584_0040640 3300036712 Bacteria 3465
161 Ga0316584_0136509 3300036712 Unclassified 1831
162 Ga0316584_0209974 3300036712 Bacteria 1433
163 Ga0316584_0339033 3300036712 Bacteria 1081
164 Ga0316584_0935478 3300036712 Bacteria 582
165 Ga0400485_05054 3300038735 Unclassified 3807
166 Ga0400485_18816 3300038735 Bacteria 1272
167 Ga0451800_1636186 3300041459 Bacteria 939
168 Ga0451577_0019430 3300042876 Bacteria 6248
169 Ga0451577_0047014 3300042876 Bacteria 3859
170 Ga0451577_0059854 3300042876 Bacteria 3395
171 Ga0451577_0066419 3300042876 Bacteria 3217
172 Ga0451577_0752096 3300042876 Unclassified 882
173 Ga0451577_1129727 3300042876 Unclassified 700
174 Ga0451577_1429708 3300042876 Unclassified 613
175 Ga0451577_1490249 3300042876 Unclassified 598
176 Ga0451577_1527699 3300042876 Bacteria 590
177 Ga0451577_1608309 3300042876 Unclassified 573
178 Ga0453683_0000425 3300044673 Bacteria 48453
179 Ga0453683_0049533 3300044673 Bacteria 2633
180 Ga0453683_0069822 3300044673 Unclassified 2197
181 Ga0453684_0000386 3300044712 Bacteria 180948
182 Ga0453684_0000548 3300044712 Bacteria 142109
183 Ga0453684_0001310 3300044712 Bacteria 73548
184 Ga0453684_0014686 3300044712 Bacteria 12486
185 Ga0453684_0019165 3300044712 Bacteria 10436
186 Ga0453684_0020550 3300044712 Bacteria 9947
187 Ga0453684_0029934 3300044712 Bacteria 7709
188 Ga0453684_0030758 3300044712 Bacteria 7573
189 Ga0453684_0035809 3300044712 Bacteria 6852
190 Ga0453684_0099100 3300044712 Bacteria 3571
191 Ga0453684_0141476 3300044712 Bacteria 2872
192 Ga0453684_0185780 3300044712 Unclassified 2436
193 Ga0453684_0192686 3300044712 Bacteria 2383
194 Ga0453684_0205337 3300044712 Unclassified 2294
195 Ga0453684_0251962 3300044712 Bacteria 2027
196 Ga0453684_0286360 3300044712 Bacteria 1877
197 Ga0453684_0290480 3300044712 Bacteria 1862
198 Ga0453684_0290520 3300044712 Bacteria 1862
199 Ga0453684_0686902 3300044712 Unclassified 1113
200 Ga0453684_0747880 3300044712 Unclassified 1059
201 Ga0453684_1525043 3300044712 Bacteria 689
202 Ga0453684_1978366 3300044712 Bacteria 588
203 Ga0453684_2144433 3300044712 Unclassified 559
204 Ga0451576_0002123 3300045051 Bacteria 30811
205 Ga0451576_0049825 3300045051 Bacteria 4395
206 Ga0451576_0152125 3300045051 Bacteria 2413
207 Ga0451576_0173737 3300045051 Unclassified 2249
208 Ga0451576_0362902 3300045051 Bacteria 1517
209 Ga0451576_0362990 3300045051 Bacteria 1517
210 Ga0451576_0435113 3300045051 Bacteria 1377
211 Ga0501298_141886 3300049521 Bacteria 582
212 Ga0501039_0448025 3300049575 Unclassified 1014
213 Ga0501042_0414686 3300049578 Bacteria 976
214 Ga0501046_0889367 3300049580 Bacteria 622
215 Ga0501067_0329707 3300049583 Bacteria 850
216 Ga0501068_0512782 3300049584 Unclassified 778
217 Ga0501068_0587841 3300049584 Bacteria 725
218 Ga0501072_0080988 3300049588 Unclassified 2573
219 Ga0501072_0198417 3300049588 Bacteria 1600
220 Ga0501075_0075232 3300049591 Unclassified 2553
221 Ga0501076_0167519 3300049592 Bacteria 1791
222 Ga0501076_0299456 3300049592 Unclassified 1318
223 Ga0501076_1457350 3300049592 Bacteria 562
224 Ga0501079_0125036 3300049741 Bacteria 2001
225 Ga0501079_0777394 3300049741 Unclassified 754
226 Ga0501080_0123345 3300049742 Unclassified 2400
227 Ga0501080_0941922 3300049742 Unclassified 751
228 Ga0501283_102439 3300049779 Bacteria 559
229 nmdc:mga05p37_1489359_c1 3300050507 Bacteria 675
230 nmdc:mga05p37_157179_c1 3300050507 Unclassified 2778
231 nmdc:mga05p37_450_c1 3300050507 Bacteria 44688
232 nmdc:mga05p37_50552_c1 3300050507 Bacteria 5112
233 nmdc:mga05p37_602888_c1 3300050507 Bacteria 1239
234 nmdc:mga05p37_72183_c1 3300050507 Unclassified 4247
235 nmdc:mga05p37_79498_c1 3300050507 Bacteria 4038
236 nmdc:mga09592_245656_c1 3300050508 Bacteria 1551
237 nmdc:mga09592_712298_c1 3300050508 Unclassified 854
238 nmdc:mga09592_77416_c1 3300050508 Unclassified 2829
239 nmdc:mga09592_832_c1 3300050508 Bacteria 23935
240 nmdc:mga09592_97529_c1 3300050508 Bacteria 2515
241 nmdc:mga0qj67_552754_c1 3300050509 Unclassified 923
242 nmdc:mga06r32_397181_c1 3300050510 Bacteria 1361
243 nmdc:mga0n895_746367_c1 3300050512 Unclassified 972
244 nmdc:mga0a205_889309_c1 3300050515 Unclassified 737
245 Ga0501084_0085742 3300054114 Unclassified 2644
246 Ga0501082_0076259 3300060353 Unclassified 2890
247 Ga0530510_0150953 3300061734 Bacteria 1716
248 Ga0530510_0187860 3300061734 Unclassified 1533
249 2916181824 2916178963 Bacteria 5265078
250 Ga0453684_0065195
251 SwRhRL3b_contig_3418702
252 SwRhRL3b_contig_3743321
253 SwRhRL2b_contig_1256101
254 Ga0065704_10004932
255 Ga0065704_10070618
256 Ga0065704_10238512
257 Ga0065712_10158117
258 Ga0065715_10388526
259 Ga0065707_10000648
260 Ga0065707_10096457
261 Ga0065707_10097517
262 Ga0068869_100651535
263 Ga0070680_100090761
264 Ga0070689_100485855
265 Ga0070692_11087851
266 Ga0070700_100254182
267 Ga0070694_100057503
268 Ga0070694_100272685
269 Ga0070707_100147466
270 Ga0070707_100774619
271 Ga0070698_100014801
272 Ga0070698_100043711
273 Ga0070698_100074880
274 Ga0070698_100130125
275 Ga0070698_100209484
276 Ga0070698_100305204
277 Ga0070698_100445453
278 Ga0070698_100530418
279 Ga0070698_100679179
280 Ga0070698_101300801
281 Ga0070699_100023549
282 Ga0070699_100095323
283 Ga0070699_100402576
284 Ga0070699_101385792
285 Ga0070695_100191294
286 Ga0070696_100342587
287 Ga0070704_100718069
288 Ga0070702_100887421
289 Ga0070702_101395730
290 Ga0068859_100693183
291 Ga0068859_101081562
292 Ga0068864_100501638
293 Ga0068864_100844149
294 Ga0068861_100132616
295 Ga0068861_101612916
296 Ga0068862_100010791
297 Ga0068862_100050090
298 Ga0068862_100475946
299 Ga0081539_10042058
300 Ga0075428_100111265
301 Ga0075428_100307348
302 Ga0075428_101056597
303 Ga0075428_101918154
304 Ga0075430_100129427
305 Ga0075430_100610083
306 Ga0075430_100777808
307 Ga0075431_100027856
308 Ga0075429_100008787
309 Ga0075429_100188882
310 Ga0075429_100233773
311 Ga0075429_100768997
312 Ga0075429_100830640
313 Ga0075429_100842977
314 Ga0097620_100693152
315 Ga0097620_101081486
316 Ga0105240_10300175
317 Ga0111539_10402711
318 Ga0114129_10078882
319 Ga0114129_10096216
320 Ga0114129_10096599
321 Ga0114129_10105354
322 Ga0114129_10206732
323 Ga0114129_10709447
324 Ga0114129_10960118
325 Ga0114129_11925287
326 Ga0105243_10083290
327 Ga0105243_10931407
328 Ga0105241_10415466
329 Ga0105242_10032045
330 Ga0105249_10015598
331 Ga0105249_10017161
332 Ga0105246_10064593
333 Ga0157380_11292265
334 Ga0207684_11107416
335 Ga0207646_10435907
336 Ga0207709_10882495
337 Ga0207676_10134160
338 Ga0207676_11190270
339 Ga0207674_10447607
340 Ga0207675_100053825
341 Ga0207675_101003418
342 Ga0268265_10487687
343 Ga0307408_100139619
344 Ga0316575_10004038
345 Ga0316575_10007577
346 Ga0316575_10052986
347 Ga0316575_10296303
348 Ga0316579_10003595
349 Ga0316579_10006733
350 Ga0316579_10021048
351 Ga0316579_10027237
352 Ga0316579_10110121
353 Ga0316576_10002721
354 Ga0316576_10004739
355 Ga0316576_10008237
356 Ga0316576_10012198
357 Ga0316576_10151503
358 Ga0316576_10153949
359 Ga0316576_10291187
360 Ga0316578_10001029
361 Ga0316578_10019238
362 Ga0316578_10160301
363 Ga0316578_10207576
364 Ga0316578_10263409
365 Ga0316577_10003230
366 Ga0316577_10005769
367 Ga0316577_10051689
368 Ga0316577_10119587
369 Ga0316577_10150547
370 Ga0316577_10161470
371 Ga0316577_10212785
372 Ga0316577_10436285
373 Ga0307413_10378991
374 Ga0307410_10063303
375 Ga0307407_10131930
376 Ga0307407_10344988
377 Ga0307412_10599170
378 Ga0307409_100292566
379 Ga0307416_100542422
380 Ga0307415_100251046
381 Ga0316583_10001323
382 Ga0316583_10006421
383 Ga0316583_10182407
384 Ga0316585_10007813
385 Ga0316585_10008901
386 Ga0316585_10024968
387 Ga0316580_10000531
388 Ga0316580_10001455
389 Ga0316580_10011280
390 Ga0316592_1050212
391 Ga0316588_1001694
392 Ga0316574_0002614
393 Ga0316574_0010609
394 Ga0316574_0014628
395 Ga0316574_0024708
396 Ga0316574_0480144
397 Ga0316582_0006570
398 Ga0316582_0007632
399 Ga0316582_0215246
400 Ga0316582_0221834
401 Ga0316582_0243847
402 Ga0316582_0369630
403 Ga0316582_0439287
404 Ga0316582_1119602
405 Ga0316584_0005544
406 Ga0316584_0009185
407 Ga0316584_0017089
408 Ga0316584_0027910
409 Ga0316584_0040640
410 Ga0316584_0136509
411 Ga0316584_0209974
412 Ga0316584_0339033
413 Ga0316584_0935478
414 Ga0400485_05054
415 Ga0400485_18816
416 Ga0451800_1636186
417 Ga0451577_0019430
418 Ga0451577_0047014
419 Ga0451577_0059854
420 Ga0451577_0066419
421 Ga0451577_0752096
422 Ga0451577_1129727
423 Ga0451577_1429708
424 Ga0451577_1490249
425 Ga0451577_1527699
426 Ga0451577_1608309
427 Ga0453683_0000425
428 Ga0453683_0049533
429 Ga0453683_0069822
430 Ga0453684_0000386
431 Ga0453684_0000548
432 Ga0453684_0001310
433 Ga0453684_0014686
434 Ga0453684_0019165
435 Ga0453684_0020550
436 Ga0453684_0029934
437 Ga0453684_0030758
438 Ga0453684_0035809
439 Ga0453684_0099100
440 Ga0453684_0141476
441 Ga0453684_0185780
442 Ga0453684_0192686
443 Ga0453684_0205337
444 Ga0453684_0251962
445 Ga0453684_0286360
446 Ga0453684_0290480
447 Ga0453684_0290520
448 Ga0453684_0686902
449 Ga0453684_0747880
450 Ga0453684_1525043
451 Ga0453684_1978366
452 Ga0453684_2144433
453 Ga0451576_0002123
454 Ga0451576_0049825
455 Ga0451576_0152125
456 Ga0451576_0173737
457 Ga0451576_0362902
458 Ga0451576_0362990
459 Ga0451576_0435113
460 Ga0501298_141886
461 Ga0501039_0448025
462 Ga0501042_0414686
463 Ga0501046_0889367
464 Ga0501067_0329707
465 Ga0501068_0512782
466 Ga0501068_0587841
467 Ga0501072_0080988
468 Ga0501072_0198417
469 Ga0501075_0075232
470 Ga0501076_0167519
471 Ga0501076_0299456
472 Ga0501076_1457350
473 Ga0501079_0125036
474 Ga0501079_0777394
475 Ga0501080_0123345
476 Ga0501080_0941922
477 Ga0501283_102439
478 nmdc:mga05p37_1489359_c1
479 nmdc:mga05p37_157179_c1
480 nmdc:mga05p37_450_c1
481 nmdc:mga05p37_50552_c1
482 nmdc:mga05p37_602888_c1
483 nmdc:mga05p37_72183_c1
484 nmdc:mga05p37_79498_c1
485 nmdc:mga09592_245656_c1
486 nmdc:mga09592_712298_c1
487 nmdc:mga09592_77416_c1
488 nmdc:mga09592_832_c1
489 nmdc:mga09592_97529_c1
490 nmdc:mga0qj67_552754_c1
491 nmdc:mga06r32_397181_c1
492 nmdc:mga0n895_746367_c1
493 nmdc:mga0a205_889309_c1
494 Ga0501084_0085742
495 Ga0501082_0076259
496 Ga0530510_0150953
497 Ga0530510_0187860
498 2916181824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

78

166

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2prx-assembly1.cif.gz_B crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.9534 12 151
2prx-assembly1.cif.gz_B crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.9292 12 151
2prx-assembly1.cif.gz_A crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.9149 10 151
2prx-assembly1.cif.gz_A crystal structure of thioesterase superfamily protein (zp_00837258.1) from shewanella loihica pv-4 at 1.65 a resolution 0.9071 10 151
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.8791 55 150
ID Description Score Start End Superfamily
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8791 55 150 3.10.129.10
2f3xB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8715 37 149 3.10.129.10
af_F4JHC9_142_429_2.40.160.210 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8714 40 152 2.40.160.210
af_A0A1D6KJS7_406_533_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8569 30 151 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8566 30 150 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3D2UNQ6-F1-model_v4 Acyl-coenzyme A thioesterase THEM4 (EC 3.1.2.2) (Thioesterase superfamily member 4) 0.9895 1 160 GO:0005737
GO:0005886
GO:0006631
GO:0016787
GO:0042995
AF-A0A3D2UNQ6-F1-model_v4 Acyl-coenzyme A thioesterase THEM4 (EC 3.1.2.2) (Thioesterase superfamily member 4) 0.9714 1 160 GO:0005737
GO:0005886
GO:0006631
GO:0016787
GO:0042995
AF-A0A7X6TIM0-F1-model_v4 Acyl-coenzyme A thioesterase THEM4 (EC 3.1.2.2) (Thioesterase superfamily member 4) 0.971 1 152 GO:0005737
GO:0005886
GO:0006631
GO:0016787
GO:0042995
AF-A0A2N2MHZ3-F1-model_v4 Acyl-coenzyme A thioesterase THEM4 (EC 3.1.2.2) (Thioesterase superfamily member 4) 0.9639 2 153 GO:0005737
GO:0005886
GO:0006631
GO:0016787
GO:0042995
AF-A0A2D9P4B5-F1-model_v4 Thioesterase 0.9565 20 153

Map