F360877

General Info

Members Datasets Scaffolds Average Seq Length
249 185 244 325

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100026125|Ga0307415_1000261252
Length 360
Sequence VSFPVTMFMSSPGTVFLSVGLATVFAMTDAIVAEALVKTYGSVRALDGIDLRVPEGTVLGLLGPNGAGKTTCVRILTTLLRPDSGRVRVRDIDVLAQPQQVREIIGLSGQNAAIDEYLTGYENLEMIGRLYHIGAKQARQRAHELLERFDLTDAANRPAKTYSGGMRRRLDLAGALVTSPPVIFLDEPTTGLDPRSRLGMWEIIAERVHSGATLLLTTQYLEEADRLCDNVMVIDHGRSIAEGTPDELKRQVGGERVEVVVAEKADLDTASGVLKEVTGEPPTVDEDTLTLSAPAAGGAKTLIDAVRRLDAAGIEMSDIGIHRATLDDVFLALTGQAVTEEPEKDEEAGSVGGRRGGTKR

Samples

Sample ID Description Type Environment
1 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
2 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
3 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
96 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
97 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
98 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
185 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0.8
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 3.61
Rhizosphere 91.97
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10023065 3300003203 Bacteria 2466
2 Ga0070658_10000387 3300005327 Bacteria 38330
3 Ga0070683_100011351 3300005329 Bacteria 7696
4 Ga0070683_100069989 3300005329 Bacteria 3272
5 Ga0070670_100025812 3300005331 Bacteria 5056
6 Ga0070680_100008398 3300005336 Bacteria 7907
7 Ga0068868_100211637 3300005338 Bacteria 1620
8 Ga0070668_100020569 3300005347 Bacteria 4982
9 Ga0070668_100047126 3300005347 Bacteria 3313
10 Ga0070675_100011843 3300005354 Bacteria 6832
11 Ga0070659_100132562 3300005366 Bacteria 2025
12 Ga0070709_10138383 3300005434 Bacteria 1670
13 Ga0070714_100000012 3300005435 Bacteria 226258
14 Ga0070714_100003434 3300005435 Bacteria 11803
15 Ga0070710_10032992 3300005437 Bacteria 2809
16 Ga0070663_100005664 3300005455 Bacteria 7443
17 Ga0070662_100004579 3300005457 Bacteria 8755
18 Ga0070681_10008190 3300005458 Bacteria 10231
19 Ga0070707_100002639 3300005468 Bacteria 17058
20 Ga0070679_100002689 3300005530 Bacteria 16194
21 Ga0070684_100007006 3300005535 Bacteria 8758
22 Ga0070684_100194254 3300005535 Bacteria 1848
23 Ga0070672_100082828 3300005543 Bacteria 2574
24 Ga0070665_100006041 3300005548 Bacteria 12373
25 Ga0070665_100079495 3300005548 Bacteria 3285
26 Ga0070664_100010653 3300005564 Bacteria 7450
27 Ga0068859_100243453 3300005617 Bacteria 1888
28 Ga0068862_100025969 3300005844 Bacteria 4921
29 Ga0081538_10006344 3300005981 Bacteria 10436
30 Ga0081538_10010788 3300005981 Bacteria 7466
31 Ga0081540_1011595 3300005983 Bacteria 5883
32 Ga0081540_1027339 3300005983 Bacteria 3235
33 Ga0081539_10000381 3300005985 Bacteria 96399
34 Ga0081539_10000989 3300005985 Bacteria 52873
35 Ga0081539_10001469 3300005985 Bacteria 39964
36 Ga0081539_10003015 3300005985 Bacteria 21894
37 Ga0081539_10029467 3300005985 Bacteria 3427
38 Ga0070717_10047529 3300006028 Bacteria 3517
39 Ga0070717_10097282 3300006028 Bacteria 2494
40 Ga0070712_100024169 3300006175 Bacteria 4023
41 Ga0075431_100487621 3300006847 Bacteria 1225
42 Ga0075434_100018042 3300006871 Bacteria 6809
43 Ga0097620_100243448 3300006931 Bacteria 1888
44 Ga0111539_10007578 3300009094 Bacteria 13872
45 Ga0105245_10005393 3300009098 Bacteria 11239
46 Ga0114129_10000903 3300009147 Bacteria 38604
47 Ga0105248_10035545 3300009177 Bacteria 5574
48 Ga0105249_10009571 3300009553 Bacteria 8492
49 Ga0157378_10457229 3300013297 Bacteria 1268
50 Ga0163162_10028524 3300013306 Bacteria 5524
51 Ga0157372_10436461 3300013307 Bacteria 1526
52 Ga0157375_10073996 3300013308 Bacteria 3427
53 Ga0157377_10058195 3300014745 Bacteria 2200
54 Ga0157379_10082082 3300014968 Bacteria 2888
55 Ga0157379_10305569 3300014968 Bacteria 1450
56 Ga0157376_10063665 3300014969 Bacteria 3108
57 Ga0206354_10055929 3300020081 Bacteria 5758
58 Ga0206353_10617730 3300020082 Bacteria 25573
59 Ga0207692_10015242 3300025898 Bacteria 3378
60 Ga0207699_10151543 3300025906 Bacteria 1535
61 Ga0207705_10003007 3300025909 Bacteria 12865
62 Ga0207707_10003033 3300025912 Bacteria 14929
63 Ga0207707_10127686 3300025912 Bacteria 2224
64 Ga0207693_10032854 3300025915 Bacteria 4095
65 Ga0207663_10000440 3300025916 Bacteria 18042
66 Ga0207663_10196204 3300025916 Bacteria 1453
67 Ga0207660_10005146 3300025917 Bacteria 8505
68 Ga0207652_10001367 3300025921 Bacteria 21685
69 Ga0207646_10012870 3300025922 Bacteria 8019
70 Ga0207687_10068975 3300025927 Bacteria 2520
71 Ga0207664_10000003 3300025929 Bacteria 510966
72 Ga0207664_10011317 3300025929 Bacteria 6331
73 Ga0207664_10125764 3300025929 Bacteria 2152
74 Ga0207706_10004676 3300025933 Bacteria 12831
75 Ga0207691_10098503 3300025940 Bacteria 2611
76 Ga0207679_10034393 3300025945 Bacteria 3575
77 Ga0207668_10042942 3300025972 Bacteria 3065
78 Ga0207678_10012913 3300026067 Bacteria 7331
79 Ga0207676_10047835 3300026095 Bacteria 3317
80 Ga0207428_10026804 3300027907 Bacteria 4803
81 Ga0307515_10196277 3300028794 Bacteria 1909
82 Ga0265338_10002541 3300028800 Bacteria 27050
83 Ga0316182_1087561 3300030745 Bacteria 10056
84 Ga0307513_10002200 3300031456 Bacteria 27236
85 Ga0316576_10019838 3300031727 Bacteria 4612
86 Ga0316576_10031311 3300031727 Bacteria 3773
87 Ga0316576_10199910 3300031727 Bacteria 1506
88 Ga0316578_10001556 3300031728 Bacteria 9438
89 Ga0316577_10021171 3300031733 Bacteria 3607
90 Ga0307406_10070764 3300031901 Bacteria 2285
91 Ga0307416_100019173 3300032002 Bacteria 4843
92 Ga0307416_100048640 3300032002 Bacteria 3366
93 Ga0307416_100140834 3300032002 Bacteria 2192
94 Ga0307415_100020938 3300032126 Bacteria 4006
95 Ga0307415_100026125 3300032126 Bacteria 3678
96 Ga0307415_100047726 3300032126 Bacteria 2884
97 Ga0307415_100077764 3300032126 Bacteria 2357
98 Ga0307415_100475944 3300032126 Bacteria 1086
99 Ga0373934_0017950 3300035086 Bacteria 2704
100 Ga0373923_0023015 3300035111 Bacteria 2447
101 Ga0373936_0023629 3300035113 Bacteria 2396
102 Ga0373953_0010111 3300035117 Bacteria 3271
103 Ga0373954_0050346 3300035118 Bacteria 1954
104 Ga0373956_0006737 3300035119 Bacteria 4606
105 Ga0373957_0003921 3300035120 Bacteria 4469
106 Ga0373943_0164472 3300035170 Bacteria 1210
107 Ga0373924_0011997 3300035410 Bacteria 3228
108 Ga0373935_0009705 3300035692 Bacteria 5762
109 Ga0373933_0088533 3300035724 Bacteria 1907
110 Ga0373937_0000310 3300036401 Bacteria 46040
111 Ga0373937_0017529 3300036401 Bacteria 6383
112 Ga0316582_0011722 3300036647 Bacteria 4860
113 Ga0316584_0016400 3300036712 Bacteria 5310
114 Ga0373925_0035601 3300037068 Bacteria 3674
115 Ga0395900_0078628 3300037418 Bacteria 3389
116 Ga0395898_0141964 3300037466 Bacteria 2299
117 Ga0395898_0247035 3300037466 Bacteria 1702
118 Ga0395901_0050332 3300038443 Bacteria 4329
119 Ga0400485_04221 3300038735 Bacteria 54088
120 Ga0400486_29215 3300038742 Bacteria 140932
121 Ga0400489_42093 3300039093 Bacteria 1526
122 Ga0439455_0024240 3300042012 Bacteria 1467
123 Ga0466966_0081595 3300044684 Bacteria 2013
124 Ga0466961_0017630 3300044693 Bacteria 4587
125 Ga0466961_0147523 3300044693 Bacteria 1470
126 Ga0466958_0077440 3300045836 Bacteria 2042
127 Ga0495592_0000065 3300046454 Bacteria 95955
128 Ga0495592_0168083 3300046454 Bacteria 1503
129 Ga0495629_0284750 3300046459 Bacteria 1133
130 Ga0495641_0037270 3300046461 Bacteria 2280
131 Ga0495641_0053007 3300046461 Bacteria 1847
132 Ga0495651_0000001 3300046462 Bacteria 210544
133 Ga0495651_0033414 3300046462 Bacteria 4012
134 Ga0495653_0001056 3300046463 Bacteria 21204
135 Ga0495653_0108007 3300046463 Bacteria 2004
136 Ga0495582_0040788 3300046473 Bacteria 2557
137 Ga0495639_0022025 3300046475 Bacteria 2793
138 Ga0495662_0009836 3300046476 Bacteria 4698
139 Ga0495664_0034650 3300046477 Bacteria 2970
140 Ga0495608_0016574 3300046511 Bacteria 5100
141 Ga0495618_0009239 3300046514 Bacteria 5951
142 Ga0495618_0081641 3300046514 Bacteria 2064
143 Ga0495628_0000172 3300046516 Bacteria 56702
144 Ga0495628_0066019 3300046516 Bacteria 2828
145 Ga0495630_0089484 3300046517 Bacteria 2325
146 Ga0495652_0000015 3300046529 Bacteria 222624
147 Ga0495652_0092011 3300046529 Bacteria 2478
148 Ga0495665_0039224 3300046531 Bacteria 2523
149 Ga0495665_0091738 3300046531 Bacteria 1596
150 Ga0495586_0059383 3300046535 Bacteria 2078
151 Ga0495587_0000036 3300046536 Bacteria 117570
152 Ga0495587_0068839 3300046536 Bacteria 2061
153 Ga0495645_0000036 3300046543 Bacteria 100735
154 Ga0495667_0076487 3300046559 Bacteria 2177
155 Ga0495634_0013053 3300046642 Bacteria 6008
156 Ga0495657_0008473 3300046675 Bacteria 7864
157 Ga0495657_0029502 3300046675 Bacteria 3846
158 Ga0495599_0025794 3300046678 Bacteria 3681
159 Ga0495623_0000011 3300046679 Bacteria 120974
160 Ga0495646_0010892 3300046680 Bacteria 5776
161 Ga0495646_0016274 3300046680 Bacteria 4720
162 Ga0495613_0095734 3300046689 Bacteria 2147
163 Ga0495624_0030399 3300046690 Bacteria 3519
164 Ga0495600_0161440 3300046809 Bacteria 1448
165 Ga0495581_0028542 3300047315 Bacteria 3234
166 Ga0495604_0000004 3300047317 Bacteria 456385
167 Ga0495676_0223543 3300047321 Bacteria 1296
168 Ga0495680_0079266 3300047322 Bacteria 2483
169 Ga0495675_0000018 3300047444 Bacteria 115435
170 Ga0495675_0029099 3300047444 Bacteria 3521
171 Ga0495593_0022232 3300047673 Bacteria 3537
172 Ga0495602_0000207 3300048088 Bacteria 54864
173 Ga0495602_0105372 3300048088 Bacteria 2304
174 Ga0496101_0217436 3300048904 Bacteria 1482
175 Ga0496102_0000324 3300048905 Bacteria 59699
176 Ga0496103_0144585 3300048906 Bacteria 1522
177 Ga0496104_0118600 3300048907 Bacteria 2541
178 Ga0496109_0150252 3300048912 Bacteria 2181
179 Ga0496109_0319256 3300048912 Bacteria 1466
180 Ga0496109_0325965 3300048912 Bacteria 1450
181 Ga0496110_0036590 3300048913 Bacteria 4263
182 Ga0496115_0130853 3300048918 Bacteria 2068
183 Ga0496126_0070501 3300048929 Bacteria 3114
184 Ga0501031_0001089 3300049568 Bacteria 16526
185 Ga0501032_0024432 3300049569 Bacteria 4173
186 Ga0501033_0039305 3300049570 Bacteria 3534
187 Ga0501036_0000766 3300049572 Bacteria 23850
188 Ga0501037_0044888 3300049573 Bacteria 3245
189 Ga0501038_0002249 3300049574 Bacteria 17937
190 Ga0501038_0201806 3300049574 Bacteria 1596
191 Ga0501039_0001541 3300049575 Bacteria 16941
192 Ga0501040_0001686 3300049576 Bacteria 14148
193 Ga0501041_0031390 3300049577 Bacteria 3209
194 Ga0501042_0000385 3300049578 Bacteria 22431
195 Ga0501042_0110604 3300049578 Bacteria 1978
196 Ga0501043_0023869 3300049579 Bacteria 4797
197 Ga0501046_0005806 3300049580 Bacteria 11012
198 Ga0501047_0087033 3300049581 Bacteria 3002
199 Ga0501047_0147315 3300049581 Bacteria 2230
200 Ga0501048_0002708 3300049582 Bacteria 13518
201 Ga0501068_0115936 3300049584 Bacteria 1668
202 Ga0501069_0000122 3300049585 Bacteria 34479
203 Ga0501069_0023425 3300049585 Bacteria 3367
204 Ga0501070_0012785 3300049586 Bacteria 7075
205 Ga0501070_0107660 3300049586 Bacteria 2304
206 Ga0501070_0302099 3300049586 Bacteria 1304
207 Ga0501072_0001055 3300049588 Bacteria 20413
208 Ga0501072_0046867 3300049588 Bacteria 3403
209 Ga0501072_0216534 3300049588 Bacteria 1526
210 Ga0501073_0188680 3300049589 Bacteria 1426
211 Ga0501074_0000284 3300049590 Bacteria 29197
212 Ga0501075_0021309 3300049591 Bacteria 4723
213 Ga0501075_0072174 3300049591 Bacteria 2609
214 Ga0501076_0285351 3300049592 Bacteria 1352
215 Ga0501077_0001511 3300049593 Bacteria 14034
216 Ga0501077_0031372 3300049593 Bacteria 3381
217 Ga0501079_0017723 3300049741 Bacteria 5441
218 Ga0501079_0075324 3300049741 Bacteria 2609
219 Ga0501080_0002626 3300049742 Bacteria 15735
220 Ga0501080_0002858 3300049742 Bacteria 15181
221 Ga0501080_0305620 3300049742 Bacteria 1442
222 Ga0501083_0034856 3300049744 Bacteria 3440
223 Ga0501035_0020703 3300049822 Bacteria 6045
224 Ga0501035_0136394 3300049822 Bacteria 2136
225 Ga0501045_0017832 3300049824 Bacteria 5042
226 Ga0501045_0063543 3300049824 Bacteria 2709
227 nmdc:mga00v17_253897_c1 3300050491 Bacteria 1140
228 nmdc:mga06z11_76342_c1 3300050494 Bacteria 1786
229 nmdc:mga05p37_3694_c1 3300050507 Bacteria 17901
230 nmdc:mga08y16_23550_c1 3300050511 Bacteria 6505
231 Ga0495601_0000130 3300053077 Bacteria 42801
232 Ga0495601_0005807 3300053077 Bacteria 7195
233 Ga0495601_0056651 3300053077 Bacteria 2482
234 Ga0495612_0033506 3300053078 Bacteria 2078
235 Ga0495595_0004392 3300053084 Bacteria 5674
236 Ga0495619_0001651 3300053085 Bacteria 14725
237 Ga0495619_0087838 3300053085 Bacteria 2102
238 Ga0500616_0002005 3300053153 Bacteria 18030
239 Ga0501084_0014236 3300054114 Bacteria 6587
240 Ga0501084_0017658 3300054114 Bacteria 5935
241 Ga0501084_0066907 3300054114 Bacteria 3007
242 Ga0501082_0003935 3300060353 Bacteria 12960
243 Ga0501082_0038354 3300060353 Bacteria 4133
244 Ga0530510_0001527 3300061734 Bacteria 15590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100020938 Ga0307415_1000209384 256
2 3300005434 Ga0070709_10138383 Ga0070709_101383832 291
3 3300005435 Ga0070714_100003434 Ga0070714_1000034346 291
4 3300005437 Ga0070710_10032992 Ga0070710_100329922 291
5 3300006028 Ga0070717_10047529 Ga0070717_100475294 291
6 3300006175 Ga0070712_100024169 Ga0070712_1000241694 291
7 3300025898 Ga0207692_10015242 Ga0207692_100152424 291
8 3300025906 Ga0207699_10151543 Ga0207699_101515432 291
9 3300025915 Ga0207693_10032854 Ga0207693_100328544 291
10 3300025916 Ga0207663_10000440 Ga0207663_1000044018 291
11 3300025929 Ga0207664_10011317 Ga0207664_100113176 291
12 3300048906 Ga0496103_0144585 Ga0496103_0144585_296_1267 291
13 3300046531 Ga0495665_0091738 Ga0495665_0091738_19_921 295
14 3300049589 Ga0501073_0188680 Ga0501073_0188680_81_1034 299
15 3300036401 Ga0373937_0017529 Ga0373937_0017529_3953_5092 301
16 3300049581 Ga0501047_0147315 Ga0501047_0147315_384_1349 302
17 3300005985 Ga0081539_10000381 Ga0081539_1000038186 309
18 3300025916 Ga0207663_10196204 Ga0207663_101962042 309
19 3300046475 Ga0495639_0022025 Ga0495639_0022025_1835_2773 310
20 3300025929 Ga0207664_10125764 Ga0207664_101257642 311
21 3300046461 Ga0495641_0053007 Ga0495641_0053007_666_1625 311
22 3300046529 Ga0495652_0092011 Ga0495652_0092011_1452_2411 311
23 3300053077 Ga0495601_0005807 Ga0495601_0005807_4094_5053 311
24 3300006847 Ga0075431_100487621 Ga0075431_1004876212 312
25 3300037466 Ga0395898_0247035 Ga0395898_0247035_171_1142 313
26 3300049588 Ga0501072_0216534 Ga0501072_0216534_153_1103 313
27 3300049742 Ga0501080_0305620 Ga0501080_0305620_462_1412 313
28 3300054114 Ga0501084_0066907 Ga0501084_0066907_1633_2583 313
29 3300049574 Ga0501038_0201806 Ga0501038_0201806_179_1132 314
30 3300005468 Ga0070707_100002639 Ga0070707_1000026395 315
31 3300025922 Ga0207646_10012870 Ga0207646_100128705 315
32 3300036401 Ga0373937_0000310 Ga0373937_0000310_17729_18700 315
33 3300046454 Ga0495592_0000065 Ga0495592_0000065_38824_39795 315
34 3300046462 Ga0495651_0000001 Ga0495651_0000001_58311_59282 315
35 3300046463 Ga0495653_0001056 Ga0495653_0001056_5627_6598 315
36 3300046511 Ga0495608_0016574 Ga0495608_0016574_1048_2019 315
37 3300046514 Ga0495618_0009239 Ga0495618_0009239_259_1230 315
38 3300046516 Ga0495628_0000172 Ga0495628_0000172_38061_39032 315
39 3300046529 Ga0495652_0000015 Ga0495652_0000015_78046_79017 315
40 3300046536 Ga0495587_0000036 Ga0495587_0000036_4163_5134 315
41 3300046543 Ga0495645_0000036 Ga0495645_0000036_52162_53133 315
42 3300046675 Ga0495657_0008473 Ga0495657_0008473_5016_5987 315
43 3300046679 Ga0495623_0000011 Ga0495623_0000011_79683_80654 315
44 3300046680 Ga0495646_0010892 Ga0495646_0010892_3209_4180 315
45 3300047317 Ga0495604_0000004 Ga0495604_0000004_397040_398011 315
46 3300047444 Ga0495675_0000018 Ga0495675_0000018_42405_43376 315
47 3300048088 Ga0495602_0000207 Ga0495602_0000207_15059_16030 315
48 3300053077 Ga0495601_0000130 Ga0495601_0000130_11869_12840 315
49 3300053085 Ga0495619_0001651 Ga0495619_0001651_1714_2685 315
50 3300005331 Ga0070670_100025812 Ga0070670_1000258123 316
51 3300031727 Ga0316576_10019838 Ga0316576_100198383 316
52 3300031728 Ga0316578_10001556 Ga0316578_100015569 316
53 3300031733 Ga0316577_10021171 Ga0316577_100211712 316
54 3300036647 Ga0316582_0011722 Ga0316582_0011722_2903_3865 316
55 3300036712 Ga0316584_0016400 Ga0316584_0016400_3015_3977 316
56 3300049586 Ga0501070_0302099 Ga0501070_0302099_44_1000 316
57 iso_pu_bacteria 8048127548 8048133553 316
58 3300005347 Ga0070668_100020569 Ga0070668_1000205692 317
59 3300006871 Ga0075434_100018042 Ga0075434_1000180423 317
60 3300009553 Ga0105249_10009571 Ga0105249_100095718 317
61 3300013306 Ga0163162_10028524 Ga0163162_100285243 317
62 3300013307 Ga0157372_10436461 Ga0157372_104364612 317
63 3300013308 Ga0157375_10073996 Ga0157375_100739964 317
64 3300014968 Ga0157379_10305569 Ga0157379_103055692 317
65 3300048904 Ga0496101_0217436 Ga0496101_0217436_224_1198 317
66 3300048907 Ga0496104_0118600 Ga0496104_0118600_1126_2100 317
67 3300048912 Ga0496109_0150252 Ga0496109_0150252_760_1719 317
68 3300048912 Ga0496109_0319256 Ga0496109_0319256_138_1112 317
69 3300048913 Ga0496110_0036590 Ga0496110_0036590_1085_2059 317
70 3300048918 Ga0496115_0130853 Ga0496115_0130853_984_1958 317
71 3300031901 Ga0307406_10070764 Ga0307406_100707642 318
72 3300032002 Ga0307416_100048640 Ga0307416_1000486402 318
73 3300032126 Ga0307415_100077764 Ga0307415_1000777642 318
74 3300035086 Ga0373934_0017950 Ga0373934_0017950_1299_2261 318
75 3300035111 Ga0373923_0023015 Ga0373923_0023015_74_1036 318
76 3300035113 Ga0373936_0023629 Ga0373936_0023629_81_1043 318
77 3300035117 Ga0373953_0010111 Ga0373953_0010111_881_1843 318
78 3300035118 Ga0373954_0050346 Ga0373954_0050346_502_1464 318
79 3300035119 Ga0373956_0006737 Ga0373956_0006737_2922_3884 318
80 3300035120 Ga0373957_0003921 Ga0373957_0003921_1404_2366 318
81 3300035170 Ga0373943_0164472 Ga0373943_0164472_194_1156 318
82 3300035410 Ga0373924_0011997 Ga0373924_0011997_1119_2081 318
83 3300035692 Ga0373935_0009705 Ga0373935_0009705_45_1007 318
84 3300035724 Ga0373933_0088533 Ga0373933_0088533_572_1534 318
85 3300037068 Ga0373925_0035601 Ga0373925_0035601_2162_3124 318
86 3300046454 Ga0495592_0168083 Ga0495592_0168083_40_1002 318
87 3300046459 Ga0495629_0284750 Ga0495629_0284750_102_1064 318
88 3300046461 Ga0495641_0037270 Ga0495641_0037270_68_1030 318
89 3300046462 Ga0495651_0033414 Ga0495651_0033414_1651_2613 318
90 3300046463 Ga0495653_0108007 Ga0495653_0108007_181_1143 318
91 3300046473 Ga0495582_0040788 Ga0495582_0040788_245_1207 318
92 3300046476 Ga0495662_0009836 Ga0495662_0009836_180_1142 318
93 3300046477 Ga0495664_0034650 Ga0495664_0034650_1635_2597 318
94 3300046514 Ga0495618_0081641 Ga0495618_0081641_1070_2032 318
95 3300046516 Ga0495628_0066019 Ga0495628_0066019_1201_2163 318
96 3300046517 Ga0495630_0089484 Ga0495630_0089484_1331_2293 318
97 3300046531 Ga0495665_0039224 Ga0495665_0039224_1388_2350 318
98 3300046535 Ga0495586_0059383 Ga0495586_0059383_68_1030 318
99 3300046536 Ga0495587_0068839 Ga0495587_0068839_899_1861 318
100 3300046559 Ga0495667_0076487 Ga0495667_0076487_1020_1982 318
101 3300046642 Ga0495634_0013053 Ga0495634_0013053_1020_1982 318
102 3300046675 Ga0495657_0029502 Ga0495657_0029502_2441_3403 318
103 3300046678 Ga0495599_0025794 Ga0495599_0025794_666_1628 318
104 3300046680 Ga0495646_0016274 Ga0495646_0016274_2452_3414 318
105 3300046689 Ga0495613_0095734 Ga0495613_0095734_1168_2130 318
106 3300046690 Ga0495624_0030399 Ga0495624_0030399_1873_2835 318
107 3300046809 Ga0495600_0161440 Ga0495600_0161440_43_1005 318
108 3300047315 Ga0495581_0028542 Ga0495581_0028542_2220_3182 318
109 3300047322 Ga0495680_0079266 Ga0495680_0079266_856_1818 318
110 3300047444 Ga0495675_0029099 Ga0495675_0029099_2527_3489 318
111 3300047673 Ga0495593_0022232 Ga0495593_0022232_1408_2370 318
112 3300048088 Ga0495602_0105372 Ga0495602_0105372_442_1404 318
113 3300050491 nmdc:mga00v17_253897_c1 nmdc:mga00v17_253897_c1_110_1069 318
114 3300050494 nmdc:mga06z11_76342_c1 nmdc:mga06z11_76342_c1_120_1079 318
115 3300053077 Ga0495601_0056651 Ga0495601_0056651_121_1083 318
116 3300053078 Ga0495612_0033506 Ga0495612_0033506_1047_2009 318
117 3300053084 Ga0495595_0004392 Ga0495595_0004392_3578_4540 318
118 3300053085 Ga0495619_0087838 Ga0495619_0087838_77_1039 318
119 iso_pu_bacteria 2891395885 2891396598 318
120 iso_pu_bacteria 2891554331 2891555766 318
121 iso_pu_bacteria 8053945823 8053953295 318
122 3300005981 Ga0081538_10010788 Ga0081538_1001078810 319
123 3300028794 Ga0307515_10196277 Ga0307515_101962772 319
124 3300031727 Ga0316576_10199910 Ga0316576_101999101 319
125 3300048929 Ga0496126_0070501 Ga0496126_0070501_1167_2135 319
126 3300005617 Ga0068859_100243453 Ga0068859_1002434533 320
127 3300005981 Ga0081538_10006344 Ga0081538_1000634411 320
128 3300006931 Ga0097620_100243448 Ga0097620_1002434483 320
129 3300009177 Ga0105248_10035545 Ga0105248_100355452 320
130 3300013297 Ga0157378_10457229 Ga0157378_104572292 320
131 3300014968 Ga0157379_10082082 Ga0157379_100820822 320
132 3300032002 Ga0307416_100019173 Ga0307416_1000191735 320
133 3300042012 Ga0439455_0024240 Ga0439455_0024240_403_1398 320
134 3300049578 Ga0501042_0110604 Ga0501042_0110604_617_1630 320
135 3300049586 Ga0501070_0107660 Ga0501070_0107660_769_1782 320
136 3300049588 Ga0501072_0046867 Ga0501072_0046867_2276_3289 320
137 3300049591 Ga0501075_0021309 Ga0501075_0021309_1513_2526 320
138 3300049592 Ga0501076_0285351 Ga0501076_0285351_176_1189 320
139 3300049593 Ga0501077_0031372 Ga0501077_0031372_1553_2566 320
140 3300049741 Ga0501079_0017723 Ga0501079_0017723_2954_3967 320
141 3300049824 Ga0501045_0017832 Ga0501045_0017832_1728_2741 320
142 3300054114 Ga0501084_0014236 Ga0501084_0014236_2408_3421 320
143 3300060353 Ga0501082_0038354 Ga0501082_0038354_1634_2647 320
144 3300005535 Ga0070684_100194254 Ga0070684_1001942542 321
145 3300005548 Ga0070665_100079495 Ga0070665_1000794952 321
146 3300014969 Ga0157376_10063665 Ga0157376_100636653 321
147 3300032126 Ga0307415_100475944 Ga0307415_1004759441 321
148 3300049822 Ga0501035_0136394 Ga0501035_0136394_316_1323 321
149 3300005985 Ga0081539_10003015 Ga0081539_100030152 322
150 3300030745 Ga0316182_1087561 Ga0316182_10875613 322
151 3300044693 Ga0466961_0147523 Ga0466961_0147523_486_1460 322
152 3300049581 Ga0501047_0087033 Ga0501047_0087033_1089_2063 322
153 3300049568 Ga0501031_0001089 Ga0501031_0001089_673_1656 323
154 3300049569 Ga0501032_0024432 Ga0501032_0024432_2693_3676 323
155 3300049570 Ga0501033_0039305 Ga0501033_0039305_1367_2350 323
156 3300049572 Ga0501036_0000766 Ga0501036_0000766_3145_4128 323
157 3300049573 Ga0501037_0044888 Ga0501037_0044888_1578_2561 323
158 3300049574 Ga0501038_0002249 Ga0501038_0002249_11141_12124 323
159 3300049575 Ga0501039_0001541 Ga0501039_0001541_4198_5181 323
160 3300049576 Ga0501040_0001686 Ga0501040_0001686_906_1889 323
161 3300049577 Ga0501041_0031390 Ga0501041_0031390_1768_2751 323
162 3300049578 Ga0501042_0000385 Ga0501042_0000385_12237_13220 323
163 3300049579 Ga0501043_0023869 Ga0501043_0023869_3774_4757 323
164 3300049580 Ga0501046_0005806 Ga0501046_0005806_6374_7357 323
165 3300049582 Ga0501048_0002708 Ga0501048_0002708_664_1647 323
166 3300049584 Ga0501068_0115936 Ga0501068_0115936_173_1156 323
167 3300049585 Ga0501069_0023425 Ga0501069_0023425_686_1669 323
168 3300049588 Ga0501072_0001055 Ga0501072_0001055_17697_18680 323
169 3300049590 Ga0501074_0000284 Ga0501074_0000284_13124_14107 323
170 3300049591 Ga0501075_0072174 Ga0501075_0072174_280_1263 323
171 3300049593 Ga0501077_0001511 Ga0501077_0001511_788_1771 323
172 3300049741 Ga0501079_0075324 Ga0501079_0075324_152_1135 323
173 3300049742 Ga0501080_0002626 Ga0501080_0002626_11254_12237 323
174 3300049744 Ga0501083_0034856 Ga0501083_0034856_2413_3396 323
175 3300049822 Ga0501035_0020703 Ga0501035_0020703_3295_4278 323
176 3300049824 Ga0501045_0063543 Ga0501045_0063543_1095_2078 323
177 3300054114 Ga0501084_0017658 Ga0501084_0017658_4930_5913 323
178 3300060353 Ga0501082_0003935 Ga0501082_0003935_11698_12681 323
179 3300061734 Ga0530510_0001527 Ga0530510_0001527_5363_6346 323
180 3300005327 Ga0070658_10000387 Ga0070658_1000038720 324
181 3300005336 Ga0070680_100008398 Ga0070680_1000083985 324
182 3300005458 Ga0070681_10008190 Ga0070681_100081909 324
183 3300005530 Ga0070679_100002689 Ga0070679_1000026895 324
184 3300020081 Ga0206354_10055929 Ga0206354_100559297 324
185 3300020082 Ga0206353_10617730 Ga0206353_1061773013 324
186 3300025909 Ga0207705_10003007 Ga0207705_100030072 324
187 3300025912 Ga0207707_10003033 Ga0207707_1000303316 324
188 3300025917 Ga0207660_10005146 Ga0207660_100051469 324
189 3300025921 Ga0207652_10001367 Ga0207652_100013675 324
190 3300045836 Ga0466958_0077440 Ga0466958_0077440_258_1250 324
191 3300009147 Ga0114129_10000903 Ga0114129_1000090340 325
192 3300031456 Ga0307513_10002200 Ga0307513_1000220017 325
193 3300044684 Ga0466966_0081595 Ga0466966_0081595_226_1212 325
194 3300050507 nmdc:mga05p37_3694_c1 nmdc:mga05p37_3694_c1_2944_3924 325
195 iso_pu_bacteria 2827628540 2827632758 325
196 3300005983 Ga0081540_1011595 Ga0081540_10115957 326
197 3300028800 Ga0265338_10002541 Ga0265338_1000254117 327
198 3300038735 Ga0400485_04221 Ga0400485_04221_19784_20779 327
199 3300038742 Ga0400486_29215 Ga0400486_29215_55329_56324 327
200 3300005329 Ga0070683_100069989 Ga0070683_1000699891 328
201 3300032126 Ga0307415_100047726 Ga0307415_1000477262 328
202 3300048905 Ga0496102_0000324 Ga0496102_0000324_16844_17830 328
203 3300005548 Ga0070665_100006041 Ga0070665_1000060417 329
204 3300005985 Ga0081539_10029467 Ga0081539_100294672 329
205 3300006028 Ga0070717_10097282 Ga0070717_100972822 329
206 3300032002 Ga0307416_100140834 Ga0307416_1001408343 329
207 3300044693 Ga0466961_0017630 Ga0466961_0017630_1549_2547 329
208 3300048912 Ga0496109_0325965 Ga0496109_0325965_399_1406 329
209 3300025912 Ga0207707_10127686 Ga0207707_101276862 330
210 3300005435 Ga0070714_100000012 Ga0070714_10000001229 331
211 3300005983 Ga0081540_1027339 Ga0081540_10273393 331
212 3300025929 Ga0207664_10000003 Ga0207664_10000003178 331
213 3300031727 Ga0316576_10031311 Ga0316576_100313114 331
214 3300039093 Ga0400489_42093 Ga0400489_42093_60_1070 332
215 3300047321 Ga0495676_0223543 Ga0495676_0223543_266_1279 332
216 3300053153 Ga0500616_0002005 Ga0500616_0002005_6748_7767 332
217 3300005338 Ga0068868_100211637 Ga0068868_1002116372 333
218 3300049585 Ga0501069_0000122 Ga0501069_0000122_10054_11070 334
219 3300049586 Ga0501070_0012785 Ga0501070_0012785_4540_5556 334
220 3300049742 Ga0501080_0002858 Ga0501080_0002858_12056_13072 334
221 3300005543 Ga0070672_100082828 Ga0070672_1000828282 336
222 3300005564 Ga0070664_100010653 Ga0070664_1000106535 336
223 3300005844 Ga0068862_100025969 Ga0068862_1000259694 336
224 3300009094 Ga0111539_10007578 Ga0111539_100075785 336
225 3300009098 Ga0105245_10005393 Ga0105245_1000539313 336
226 3300014745 Ga0157377_10058195 Ga0157377_100581952 336
227 3300025927 Ga0207687_10068975 Ga0207687_100689752 336
228 3300025933 Ga0207706_10004676 Ga0207706_100046766 336
229 3300025940 Ga0207691_10098503 Ga0207691_100985032 336
230 3300025945 Ga0207679_10034393 Ga0207679_100343932 336
231 3300025972 Ga0207668_10042942 Ga0207668_100429422 336
232 3300026067 Ga0207678_10012913 Ga0207678_100129138 336
233 3300026095 Ga0207676_10047835 Ga0207676_100478353 336
234 3300027907 Ga0207428_10026804 Ga0207428_100268045 336
235 3300050511 nmdc:mga08y16_23550_c1 nmdc:mga08y16_23550_c1_2402_3418 336
236 3300005329 Ga0070683_100011351 Ga0070683_1000113512 338
237 3300005347 Ga0070668_100047126 Ga0070668_1000471262 338
238 3300005354 Ga0070675_100011843 Ga0070675_1000118432 338
239 3300005366 Ga0070659_100132562 Ga0070659_1001325621 338
240 3300005455 Ga0070663_100005664 Ga0070663_1000056642 338
241 3300005457 Ga0070662_100004579 Ga0070662_1000045799 338
242 3300005535 Ga0070684_100007006 Ga0070684_1000070065 338
243 3300005985 Ga0081539_10000989 Ga0081539_1000098924 339
244 3300032126 Ga0307415_100026125 Ga0307415_1000261252 345
245 3300037418 Ga0395900_0078628 Ga0395900_0078628_1087_2130 345
246 3300037466 Ga0395898_0141964 Ga0395898_0141964_1051_2094 345
247 3300038443 Ga0395901_0050332 Ga0395901_0050332_2981_4024 345
248 3300003203 JGI25406J46586_10023065 JGI25406J46586_100230653 346
249 3300005985 Ga0081539_10001469 Ga0081539_1000146932 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

190

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

80

223

0.86

PF13732

DUF4162

Domain of unknown function (DUF4162)

243

334

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9452 17 239
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9406 19 238
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9342 17 237
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.934 18 236
7z16-assembly1.cif.gz_J e. coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation 0.933 16 237
ID Description Score Start End Superfamily
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9726 17 239 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9709 16 240 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 14 241 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9665 15 239 3.40.50.300
af_A0A0R0KIK5_1390_1640_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9655 17 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D5HYS6-F1-model_v4 Lysozyme 0.9737 15 103 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9635 16 239 GO:0005524
GO:0016887
AF-A0A4Q3AX05-F1-model_v4 ATP-binding cassette domain-containing protein 0.963 15 226 GO:0005524
GO:0016887
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.962 16 232 GO:0005524
GO:0016887
AF-A0A1Q7QZQ6-F1-model_v4 ABC transporter domain-containing protein 0.9608 16 242 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.2 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map