F360835

General Info

Members Datasets Scaffolds Average Seq Length
249 175 225 263

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10000612|Ga0265324_1000061220
Length 290
Sequence MRIITLNLNGIRSAYNKGLLEWFAKQDADILCVQELKAQAADMTPDMLAPLGYHGYFHYAEKKGYSGVGIYSKRKPDNVTVGLGIPEFDAEGRYIEAQFGNLSVVSLYLPSGSSGEERQAVKFKFLEAFMPHLRQMMENSKGAVVGESRLLPQTAGSASNVSQPHMSPPFSSGRDIIVCGDWNIAHTEKDLKNWRGNKKNSGFLPEERAWLTELFNEVGFVDVFRKLHPELEAYTWWSNRGQAWAKDVGWRLDYHAVTPDMAARAVSAGIYKDQRFSDHAPMMVDYKDQE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
6 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
7 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
8 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
9 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
10 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
11 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
12 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
13 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
14 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
15 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
16 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
17 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
18 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
19 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
20 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
21 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
22 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
23 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
24 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
25 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
144 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
170 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
171 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
174 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.36
Metatranscriptomes 0
Isolates 9.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.83
Nodule 0.8
Rhizoplane 2.41
Rhizosphere 83.53
Stem 0
Stem Tuber 0
Unclassified 6.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3140295 2162886007 Bacteria 1886
2 JGI25155J39150_1000167 3300002704 Bacteria 29016
3 rootL2_10009071 3300003322 Bacteria 14793
4 Ga0055538_1000024 3300003751 Bacteria 241526
5 Ga0055531_10036338 3300003794 Bacteria 1522
6 Ga0065704_10089564 3300005289 Bacteria 2848
7 Ga0070676_10004263 3300005328 Bacteria 7511
8 Ga0070683_100082454 3300005329 Bacteria 3012
9 Ga0070670_100051008 3300005331 Bacteria 3554
10 Ga0070670_100221405 3300005331 Bacteria 1646
11 Ga0070670_100279937 3300005331 Bacteria 1456
12 Ga0070666_10003268 3300005335 Bacteria 9843
13 Ga0070680_100352614 3300005336 Bacteria 1251
14 Ga0068868_100118931 3300005338 Bacteria 2154
15 Ga0070689_100003968 3300005340 Bacteria 9936
16 Ga0070661_100489176 3300005344 Bacteria 983
17 Ga0070675_100000422 3300005354 Bacteria 28826
18 Ga0070675_100027540 3300005354 Bacteria 4567
19 Ga0070675_100054342 3300005354 Bacteria 3295
20 Ga0070671_100006469 3300005355 Bacteria 9365
21 Ga0070671_100053838 3300005355 Bacteria 3345
22 Ga0070671_100356103 3300005355 Bacteria 1249
23 Ga0070674_100206652 3300005356 Bacteria 1519
24 Ga0070673_100016331 3300005364 Bacteria 5246
25 Ga0070673_100089986 3300005364 Bacteria 2506
26 Ga0070673_100279644 3300005364 Bacteria 1463
27 Ga0070667_100036584 3300005367 Bacteria 4116
28 Ga0070667_100043300 3300005367 Bacteria 3778
29 Ga0070678_100013691 3300005456 Bacteria 5096
30 Ga0070678_100031062 3300005456 Bacteria 3679
31 Ga0070678_100167816 3300005456 Bacteria 1784
32 Ga0070678_100256191 3300005456 Bacteria 1469
33 Ga0070662_100516369 3300005457 Bacteria 998
34 Ga0070681_10022044 3300005458 Bacteria 6392
35 Ga0068867_100019675 3300005459 Bacteria 4810
36 Ga0068867_100024700 3300005459 Bacteria 4307
37 Ga0068867_100174351 3300005459 Bacteria 1705
38 Ga0070685_10033434 3300005466 Bacteria 2889
39 Ga0070706_100077728 3300005467 Bacteria 3072
40 Ga0070707_100022060 3300005468 Bacteria 6020
41 Ga0070707_100096850 3300005468 Bacteria 2858
42 Ga0070699_100397888 3300005518 Bacteria 1245
43 Ga0070672_100024892 3300005543 Bacteria 4431
44 Ga0070672_100074369 3300005543 Bacteria 2710
45 Ga0070664_100020901 3300005564 Bacteria 5393
46 Ga0070664_100110682 3300005564 Bacteria 2397
47 Ga0068854_100308622 3300005578 Bacteria 1282
48 Ga0068856_100242195 3300005614 Bacteria 1819
49 Ga0068852_100013568 3300005616 Bacteria 6237
50 Ga0068852_100214833 3300005616 Bacteria 1826
51 Ga0068852_100515487 3300005616 Bacteria 1192
52 Ga0068859_100018531 3300005617 Bacteria 6995
53 Ga0068864_100001444 3300005618 Bacteria 19588
54 Ga0068864_100012333 3300005618 Bacteria 7062
55 Ga0068851_10059415 3300005834 Bacteria 1955
56 Ga0068863_100021924 3300005841 Bacteria 6095
57 Ga0068858_100006313 3300005842 Bacteria 11543
58 Ga0075368_10035047 3300006042 Bacteria 1958
59 Ga0075363_100032524 3300006048 Bacteria 2710
60 Ga0075364_10060494 3300006051 Bacteria 2484
61 Ga0097621_100017505 3300006237 Bacteria 5443
62 Ga0097621_100340165 3300006237 Bacteria 1332
63 Ga0075370_10002734 3300006353 Bacteria 8263
64 Ga0068871_100191155 3300006358 Bacteria 1763
65 Ga0075434_100054369 3300006871 Bacteria 3978
66 Ga0097620_100018531 3300006931 Bacteria 6995
67 Ga0105248_10248931 3300009177 Bacteria 2000
68 Ga0105248_10489341 3300009177 Bacteria 1387
69 Ga0105237_10134756 3300009545 Bacteria 2464
70 Ga0105238_10104924 3300009551 Bacteria 2807
71 Ga0157371_10179442 3300013102 Bacteria 1514
72 Ga0157370_10162734 3300013104 Bacteria 2076
73 Ga0157369_10368656 3300013105 Bacteria 1491
74 Ga0157374_10190984 3300013296 Bacteria 2003
75 Ga0157374_10400986 3300013296 Bacteria 1368
76 Ga0157378_10152300 3300013297 Bacteria 2155
77 Ga0157372_10789114 3300013307 Bacteria 1104
78 Ga0157375_10295430 3300013308 Bacteria 1783
79 Ga0157379_10019975 3300014968 Bacteria 5919
80 Ga0157376_10097654 3300014969 Bacteria 2559
81 Ga0163161_10133106 3300017792 Bacteria 1877
82 Ga0213872_10000033 3300021361 Bacteria 135667
83 Ga0213872_10000412 3300021361 Bacteria 35039
84 Ga0213872_10010067 3300021361 Bacteria 4510
85 Ga0207697_10008205 3300025315 Bacteria 4590
86 Ga0207682_10007140 3300025893 Bacteria 4468
87 Ga0207682_10012324 3300025893 Bacteria 3338
88 Ga0207682_10056428 3300025893 Bacteria 1635
89 Ga0207682_10114465 3300025893 Bacteria 1190
90 Ga0207645_10030400 3300025907 Bacteria 3480
91 Ga0207643_10036661 3300025908 Bacteria 2750
92 Ga0207684_10073622 3300025910 Bacteria 2901
93 Ga0207684_10075344 3300025910 Bacteria 2868
94 Ga0207652_10427974 3300025921 Bacteria 1194
95 Ga0207650_10056771 3300025925 Bacteria 2910
96 Ga0207650_10129751 3300025925 Bacteria 1971
97 Ga0207650_10131191 3300025925 Bacteria 1961
98 Ga0207650_10371204 3300025925 Bacteria 1180
99 Ga0207659_10106008 3300025926 Bacteria 2128
100 Ga0207659_10377733 3300025926 Bacteria 1181
101 Ga0207644_10015847 3300025931 Bacteria 5068
102 Ga0207644_10089286 3300025931 Bacteria 2294
103 Ga0207706_10161664 3300025933 Bacteria 1968
104 Ga0207709_10438507 3300025935 Bacteria 1007
105 Ga0207669_10097224 3300025937 Bacteria 1935
106 Ga0207691_10014528 3300025940 Bacteria 7510
107 Ga0207691_10014735 3300025940 Bacteria 7451
108 Ga0207691_10143358 3300025940 Bacteria 2104
109 Ga0207711_10016074 3300025941 Bacteria 6210
110 Ga0207711_10394824 3300025941 Bacteria 1285
111 Ga0207689_10172453 3300025942 Bacteria 1783
112 Ga0207661_10345230 3300025944 Bacteria 1342
113 Ga0207679_10139001 3300025945 Bacteria 1960
114 Ga0207679_10154980 3300025945 Bacteria 1869
115 Ga0207651_10410374 3300025960 Bacteria 1154
116 Ga0207651_10698591 3300025960 Bacteria 893
117 Ga0207712_10057519 3300025961 Bacteria 2744
118 Ga0207658_10167086 3300025986 Bacteria 1808
119 Ga0207703_10006662 3300026035 Bacteria 9215
120 Ga0207708_10128937 3300026075 Bacteria 1976
121 Ga0207641_10013958 3300026088 Bacteria 6586
122 Ga0207648_10032204 3300026089 Bacteria 4630
123 Ga0207648_10045124 3300026089 Bacteria 3866
124 Ga0207648_10057097 3300026089 Bacteria 3406
125 Ga0207676_10010733 3300026095 Bacteria 6530
126 Ga0207676_10409967 3300026095 Bacteria 1268
127 Ga0207675_100020570 3300026118 Bacteria 6152
128 Ga0207683_10012675 3300026121 Bacteria 7190
129 Ga0207683_10201265 3300026121 Bacteria 1810
130 Ga0207683_10339507 3300026121 Bacteria 1378
131 Ga0207698_10161906 3300026142 Bacteria 1958
132 Ga0209813_10022316 3300027866 Bacteria 1789
133 Ga0265324_10000612 3300029957 Bacteria 24383
134 Ga0265324_10027027 3300029957 Bacteria 2029
135 Ga0265328_10000235 3300031239 Bacteria 25524
136 Ga0265328_10059190 3300031239 Bacteria 1406
137 Ga0265325_10001853 3300031241 Bacteria 14598
138 Ga0265331_10000144 3300031250 Bacteria 92791
139 Ga0265331_10001358 3300031250 Bacteria 17982
140 Ga0265331_10017178 3300031250 Bacteria 3780
141 Ga0265327_10000213 3300031251 Bacteria 121151
142 Ga0265327_10000314 3300031251 Bacteria 92783
143 Ga0265327_10006092 3300031251 Bacteria 9776
144 Ga0265327_10006303 3300031251 Bacteria 9544
145 Ga0265327_10083032 3300031251 Bacteria 1577
146 Ga0265316_10036771 3300031344 Bacteria 3958
147 Ga0307509_10070824 3300031507 Bacteria 3639
148 Ga0307408_100067005 3300031548 Bacteria 2639
149 Ga0265314_10001810 3300031711 Bacteria 23057
150 Ga0265314_10013391 3300031711 Bacteria 6627
151 Ga0307516_10085740 3300031730 Bacteria 2987
152 Ga0307405_10036952 3300031731 Bacteria 2931
153 Ga0307406_10055033 3300031901 Bacteria 2542
154 Ga0307412_10007703 3300031911 Bacteria 6121
155 Ga0307409_100000327 3300031995 Bacteria 19575
156 Ga0307416_100001029 3300032002 Bacteria 14796
157 Ga0307414_10030831 3300032004 Bacteria 3508
158 Ga0307411_10016044 3300032005 Bacteria 4230
159 Ga0373948_0002626 3300034817 Bacteria 2679
160 Ga0373940_0001559 3300035088 Bacteria 4195
161 Ga0373949_0066929 3300035090 Bacteria 934
162 Ga0373939_0000003 3300035114 Bacteria 111914
163 Ga0373945_0049383 3300035116 Bacteria 1544
164 Ga0373960_0000565 3300035121 Bacteria 7508
165 Ga0373955_0033724 3300035172 Bacteria 2698
166 Ga0373931_0001362 3300035691 Bacteria 10454
167 Ga0373931_0104017 3300035691 Bacteria 1601
168 Ga0373937_0078399 3300036401 Bacteria 3053
169 Ga0373925_0366118 3300037068 Bacteria 1172
170 Ga0395905_0026155 3300037471 Bacteria 5504
171 Ga0395905_0348592 3300037471 Bacteria 1372
172 Ga0436361_0074660 3300039447 Bacteria 44726
173 Ga0436361_0147565 3300039447 Bacteria 50932
174 Ga0436361_0202129 3300039447 Bacteria 39168
175 Ga0436361_0620560 3300039447 Bacteria 5994
176 Ga0451851_0246194 3300041507 Bacteria 815
177 Ga0439449_0045130 3300042007 Bacteria 1634
178 Ga0450894_009769 3300042131 Bacteria 1243
179 Ga0450899_001396 3300042135 Bacteria 2698
180 Ga0451577_0000122 3300042876 Bacteria 171004
181 Ga0451577_0000191 3300042876 Bacteria 128991
182 Ga0451577_0007738 3300042876 Bacteria 10532
183 Ga0451577_0013997 3300042876 Bacteria 7487
184 Ga0453684_0000434 3300044712 Bacteria 170295
185 Ga0453684_0000590 3300044712 Bacteria 134718
186 Ga0453684_0016594 3300044712 Bacteria 11494
187 Ga0453684_0017460 3300044712 Bacteria 11114
188 Ga0453684_0419456 3300044712 Unclassified 1495
189 Ga0451576_0004219 3300045051 Bacteria 18885
190 Ga0451576_0012206 3300045051 Bacteria 9679
191 Ga0451576_0081769 3300045051 Bacteria 3359
192 Ga0451576_0108603 3300045051 Bacteria 2887
193 Ga0495629_0050213 3300046459 Bacteria 2922
194 Ga0495580_0110921 3300046472 Bacteria 1905
195 Ga0495580_0344733 3300046472 Bacteria 1010
196 Ga0495664_0241877 3300046477 Bacteria 1092
197 Ga0495608_0205748 3300046511 Bacteria 1239
198 Ga0495598_0013563 3300046537 Bacteria 2023
199 Ga0495645_0146407 3300046543 Bacteria 1645
200 Ga0495635_0065172 3300046663 Bacteria 2500
201 Ga0495647_0024215 3300046681 Bacteria 2208
202 Ga0495647_0105651 3300046681 Bacteria 1170
203 Ga0495658_0025881 3300046683 Bacteria 3140
204 Ga0495613_0127979 3300046689 Bacteria 1820
205 Ga0496104_0122557 3300048907 Bacteria 2496
206 Ga0496105_0102959 3300048908 Bacteria 2358
207 Ga0496105_0581543 3300048908 Bacteria 871
208 Ga0496108_0038538 3300048911 Bacteria 3982
209 Ga0496108_0142554 3300048911 Bacteria 2065
210 Ga0496113_0046620 3300048916 Bacteria 3218
211 Ga0495678_002953 3300049459 Bacteria 10862
212 Ga0501081_0287807 3300049743 Bacteria 1204
213 nmdc:mga0k408_15424_c1 3300050493 Bacteria 4227
214 nmdc:mga06z11_142138_c1 3300050494 Bacteria 1358
215 nmdc:mga07m45_252697_c1 3300050496 Bacteria 1026
216 nmdc:mga07m45_9928_c1 3300050496 Bacteria 4953
217 nmdc:mga0n895_157447_c1 3300050512 Bacteria 2302
218 Ga0495619_0141307 3300053085 Bacteria 1658
219 Ga0500618_012451 3300053125 Bacteria 2227
220 Ga0500618_012948 3300053125 Bacteria 2171
221 Ga0500590_005812 3300053148 Bacteria 5965
222 Ga0500600_0003966 3300053149 Bacteria 8627
223 Ga0500622_0000011 3300053156 Bacteria 386096
224 Ga0500661_008400 3300055283 Bacteria 1900
225 Ga0590074_009042 3300059423 Bacteria 1660

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10009071 rootL2_1000907110 209
2 3300041507 Ga0451851_0246194 Ga0451851_0246194_97_765 218
3 3300005518 Ga0070699_100397888 Ga0070699_1003978882 223
4 3300048908 Ga0496105_0102959 Ga0496105_0102959_14_712 227
5 3300053156 Ga0500622_0000011 Ga0500622_0000011_17614_18318 233
6 3300005564 Ga0070664_100020901 Ga0070664_1000209012 247
7 3300025945 Ga0207679_10139001 Ga0207679_101390012 247
8 3300005289 Ga0065704_10089564 Ga0065704_100895641 249
9 iso_pu_bacteria 2511231026 2511385425 251
10 iso_pu_bacteria 2521172590 2521560598 252
11 iso_pu_bacteria 2551306416 2553005717 252
12 iso_pu_bacteria 2765235838 2765571850 252
13 iso_pu_bacteria 2808606386 2808982147 252
14 iso_pu_bacteria 2808606415 2809130053 252
15 iso_pu_bacteria 2808606419 2809148892 252
16 iso_pu_bacteria 2839094727 2839098429 252
17 iso_pu_bacteria 2852618963 2852619027 252
18 iso_pu_bacteria 2894510363 2894514776 252
19 iso_pu_bacteria 2904439833 2904442929 252
20 iso_pu_bacteria 2904530477 2904534871 252
21 iso_pu_bacteria 2904584206 2904588786 252
22 iso_pu_bacteria 2904589729 2904594140 252
23 iso_pu_bacteria 2919046199 2919048572 252
24 iso_pu_bacteria 2919079590 2919083256 252
25 iso_pu_bacteria 2923510766 2923514400 252
26 iso_pu_bacteria 2928130867 2928133116 252
27 iso_pu_bacteria 2998344455 2998345494 252
28 3300029957 Ga0265324_10027027 Ga0265324_100270272 253
29 3300031251 Ga0265327_10006092 Ga0265327_1000609210 253
30 3300031711 Ga0265314_10013391 Ga0265314_100133917 253
31 3300044712 Ga0453684_0419456 Ga0453684_0419456_550_1320 253
32 3300045051 Ga0451576_0012206 Ga0451576_0012206_6490_7281 253
33 iso_pu_bacteria 2818991449 2819617290 253
34 iso_pu_bacteria 2904601388 2904605022 253
35 3300013307 Ga0157372_10789114 Ga0157372_107891142 254
36 3300042876 Ga0451577_0007738 Ga0451577_0007738_4891_5757 254
37 3300044712 Ga0453684_0016594 Ga0453684_0016594_4451_5317 254
38 3300049459 Ga0495678_002953 Ga0495678_002953_5375_6145 254
39 iso_pu_bacteria 8055225921 8055227575 254
40 3300029957 Ga0265324_10000612 Ga0265324_1000061220 255
41 3300031241 Ga0265325_10001853 Ga0265325_1000185313 255
42 3300031711 Ga0265314_10001810 Ga0265314_100018103 255
43 3300035691 Ga0373931_0104017 Ga0373931_0104017_165_932 255
44 3300048908 Ga0496105_0581543 Ga0496105_0581543_17_784 255
45 3300050493 nmdc:mga0k408_15424_c1 nmdc:mga0k408_15424_c1_1663_2442 255
46 3300050494 nmdc:mga06z11_142138_c1 nmdc:mga06z11_142138_c1_519_1298 255
47 3300050496 nmdc:mga07m45_252697_c1 nmdc:mga07m45_252697_c1_187_966 255
48 3300053125 Ga0500618_012451 Ga0500618_012451_978_1751 255
49 3300053125 Ga0500618_012948 Ga0500618_012948_439_1212 255
50 3300003751 Ga0055538_1000024 Ga0055538_100002482 256
51 3300009545 Ga0105237_10134756 Ga0105237_101347562 256
52 3300031239 Ga0265328_10059190 Ga0265328_100591902 256
53 3300031250 Ga0265331_10001358 Ga0265331_1000135812 256
54 3300031251 Ga0265327_10083032 Ga0265327_100830321 256
55 3300031344 Ga0265316_10036771 Ga0265316_100367713 256
56 3300031730 Ga0307516_10085740 Ga0307516_100857402 256
57 3300045051 Ga0451576_0081769 Ga0451576_0081769_1697_2602 256
58 3300055283 Ga0500661_008400 Ga0500661_008400_316_1104 256
59 iso_pu_bacteria 2643221603 2644029765 256
60 3300005336 Ga0070680_100352614 Ga0070680_1003526142 257
61 3300005458 Ga0070681_10022044 Ga0070681_100220442 257
62 3300005468 Ga0070707_100096850 Ga0070707_1000968503 257
63 3300005614 Ga0068856_100242195 Ga0068856_1002421951 257
64 3300006871 Ga0075434_100054369 Ga0075434_1000543694 257
65 3300025910 Ga0207684_10075344 Ga0207684_100753443 257
66 3300025921 Ga0207652_10427974 Ga0207652_104279742 257
67 3300031251 Ga0265327_10000213 Ga0265327_10000213110 257
68 3300032004 Ga0307414_10030831 Ga0307414_100308312 257
69 3300042876 Ga0451577_0000122 Ga0451577_0000122_69836_70612 257
70 3300044712 Ga0453684_0000434 Ga0453684_0000434_99518_100294 257
71 3300050512 nmdc:mga0n895_157447_c1 nmdc:mga0n895_157447_c1_153_929 257
72 3300031239 Ga0265328_10000235 Ga0265328_1000023526 258
73 3300031250 Ga0265331_10000144 Ga0265331_1000014462 258
74 3300031251 Ga0265327_10000314 Ga0265327_1000031462 258
75 3300031251 Ga0265327_10006303 Ga0265327_100063039 258
76 3300042007 Ga0439449_0045130 Ga0439449_0045130_264_1040 258
77 3300042131 Ga0450894_009769 Ga0450894_009769_57_833 258
78 3300048916 Ga0496113_0046620 Ga0496113_0046620_2299_3078 258
79 3300002704 JGI25155J39150_1000167 JGI25155J39150_100016726 260
80 3300003794 Ga0055531_10036338 Ga0055531_100363382 260
81 3300005616 Ga0068852_100013568 Ga0068852_1000135686 260
82 3300017792 Ga0163161_10133106 Ga0163161_101331062 260
83 3300021361 Ga0213872_10000033 Ga0213872_10000033134 260
84 3300021361 Ga0213872_10000412 Ga0213872_1000041219 260
85 3300039447 Ga0436361_0074660 Ga0436361_0074660_25205_25987 260
86 3300039447 Ga0436361_0147565 Ga0436361_0147565_28677_29459 260
87 3300044712 Ga0453684_0017460 Ga0453684_0017460_2386_3168 260
88 3300045051 Ga0451576_0108603 Ga0451576_0108603_306_1091 260
89 3300046537 Ga0495598_0013563 Ga0495598_0013563_36_833 260
90 3300048907 Ga0496104_0122557 Ga0496104_0122557_1260_2057 260
91 3300053149 Ga0500600_0003966 Ga0500600_0003966_5146_5937 260
92 3300059423 Ga0590074_009042 Ga0590074_009042_449_1231 260
93 3300005328 Ga0070676_10004263 Ga0070676_100042636 261
94 3300005329 Ga0070683_100082454 Ga0070683_1000824543 261
95 3300005331 Ga0070670_100221405 Ga0070670_1002214052 261
96 3300005331 Ga0070670_100279937 Ga0070670_1002799371 261
97 3300005335 Ga0070666_10003268 Ga0070666_100032685 261
98 3300005338 Ga0068868_100118931 Ga0068868_1001189312 261
99 3300005340 Ga0070689_100003968 Ga0070689_1000039688 261
100 3300005344 Ga0070661_100489176 Ga0070661_1004891761 261
101 3300005354 Ga0070675_100000422 Ga0070675_10000042223 261
102 3300005354 Ga0070675_100027540 Ga0070675_1000275402 261
103 3300005355 Ga0070671_100006469 Ga0070671_1000064694 261
104 3300005355 Ga0070671_100053838 Ga0070671_1000538384 261
105 3300005355 Ga0070671_100356103 Ga0070671_1003561032 261
106 3300005356 Ga0070674_100206652 Ga0070674_1002066522 261
107 3300005364 Ga0070673_100089986 Ga0070673_1000899862 261
108 3300005364 Ga0070673_100279644 Ga0070673_1002796442 261
109 3300005367 Ga0070667_100036584 Ga0070667_1000365846 261
110 3300005367 Ga0070667_100043300 Ga0070667_1000433004 261
111 3300005456 Ga0070678_100031062 Ga0070678_1000310623 261
112 3300005456 Ga0070678_100167816 Ga0070678_1001678162 261
113 3300005456 Ga0070678_100256191 Ga0070678_1002561912 261
114 3300005457 Ga0070662_100516369 Ga0070662_1005163691 261
115 3300005459 Ga0068867_100019675 Ga0068867_1000196754 261
116 3300005459 Ga0068867_100024700 Ga0068867_1000247005 261
117 3300005459 Ga0068867_100174351 Ga0068867_1001743512 261
118 3300005466 Ga0070685_10033434 Ga0070685_100334342 261
119 3300005467 Ga0070706_100077728 Ga0070706_1000777283 261
120 3300005468 Ga0070707_100022060 Ga0070707_1000220606 261
121 3300005543 Ga0070672_100074369 Ga0070672_1000743693 261
122 3300005564 Ga0070664_100110682 Ga0070664_1001106821 261
123 3300005578 Ga0068854_100308622 Ga0068854_1003086221 261
124 3300005616 Ga0068852_100214833 Ga0068852_1002148332 261
125 3300005616 Ga0068852_100515487 Ga0068852_1005154872 261
126 3300005617 Ga0068859_100018531 Ga0068859_1000185312 261
127 3300005618 Ga0068864_100001444 Ga0068864_10000144415 261
128 3300005834 Ga0068851_10059415 Ga0068851_100594153 261
129 3300005841 Ga0068863_100021924 Ga0068863_1000219241 261
130 3300005842 Ga0068858_100006313 Ga0068858_1000063138 261
131 3300006042 Ga0075368_10035047 Ga0075368_100350473 261
132 3300006048 Ga0075363_100032524 Ga0075363_1000325243 261
133 3300006237 Ga0097621_100340165 Ga0097621_1003401652 261
134 3300006358 Ga0068871_100191155 Ga0068871_1001911552 261
135 3300006931 Ga0097620_100018531 Ga0097620_1000185312 261
136 3300009177 Ga0105248_10248931 Ga0105248_102489313 261
137 3300009177 Ga0105248_10489341 Ga0105248_104893412 261
138 3300009551 Ga0105238_10104924 Ga0105238_101049243 261
139 3300013102 Ga0157371_10179442 Ga0157371_101794422 261
140 3300013104 Ga0157370_10162734 Ga0157370_101627342 261
141 3300013105 Ga0157369_10368656 Ga0157369_103686562 261
142 3300013296 Ga0157374_10190984 Ga0157374_101909842 261
143 3300013296 Ga0157374_10400986 Ga0157374_104009862 261
144 3300013297 Ga0157378_10152300 Ga0157378_101523003 261
145 3300014968 Ga0157379_10019975 Ga0157379_100199752 261
146 3300025315 Ga0207697_10008205 Ga0207697_100082053 261
147 3300025893 Ga0207682_10007140 Ga0207682_100071401 261
148 3300025893 Ga0207682_10012324 Ga0207682_100123244 261
149 3300025893 Ga0207682_10056428 Ga0207682_100564282 261
150 3300025893 Ga0207682_10114465 Ga0207682_101144652 261
151 3300025907 Ga0207645_10030400 Ga0207645_100304002 261
152 3300025908 Ga0207643_10036661 Ga0207643_100366612 261
153 3300025910 Ga0207684_10073622 Ga0207684_100736222 261
154 3300025925 Ga0207650_10129751 Ga0207650_101297512 261
155 3300025925 Ga0207650_10131191 Ga0207650_101311913 261
156 3300025925 Ga0207650_10371204 Ga0207650_103712042 261
157 3300025926 Ga0207659_10377733 Ga0207659_103777332 261
158 3300025931 Ga0207644_10015847 Ga0207644_100158475 261
159 3300025933 Ga0207706_10161664 Ga0207706_101616642 261
160 3300025937 Ga0207669_10097224 Ga0207669_100972243 261
161 3300025940 Ga0207691_10014735 Ga0207691_100147356 261
162 3300025940 Ga0207691_10143358 Ga0207691_101433582 261
163 3300025941 Ga0207711_10016074 Ga0207711_100160747 261
164 3300025941 Ga0207711_10394824 Ga0207711_103948241 261
165 3300025942 Ga0207689_10172453 Ga0207689_101724532 261
166 3300025944 Ga0207661_10345230 Ga0207661_103452302 261
167 3300025960 Ga0207651_10410374 Ga0207651_104103742 261
168 3300025960 Ga0207651_10698591 Ga0207651_106985911 261
169 3300025961 Ga0207712_10057519 Ga0207712_100575192 261
170 3300025986 Ga0207658_10167086 Ga0207658_101670862 261
171 3300026035 Ga0207703_10006662 Ga0207703_100066629 261
172 3300026075 Ga0207708_10128937 Ga0207708_101289373 261
173 3300026088 Ga0207641_10013958 Ga0207641_100139587 261
174 3300026089 Ga0207648_10032204 Ga0207648_100322042 261
175 3300026089 Ga0207648_10045124 Ga0207648_100451243 261
176 3300026089 Ga0207648_10057097 Ga0207648_100570974 261
177 3300026095 Ga0207676_10010733 Ga0207676_100107332 261
178 3300026118 Ga0207675_100020570 Ga0207675_1000205707 261
179 3300026121 Ga0207683_10201265 Ga0207683_102012652 261
180 3300026121 Ga0207683_10339507 Ga0207683_103395072 261
181 3300026142 Ga0207698_10161906 Ga0207698_101619061 261
182 3300027866 Ga0209813_10022316 Ga0209813_100223162 261
183 3300031507 Ga0307509_10070824 Ga0307509_100708242 261
184 3300031548 Ga0307408_100067005 Ga0307408_1000670052 261
185 3300031731 Ga0307405_10036952 Ga0307405_100369525 261
186 3300031901 Ga0307406_10055033 Ga0307406_100550332 261
187 3300031911 Ga0307412_10007703 Ga0307412_100077034 261
188 3300031995 Ga0307409_100000327 Ga0307409_10000032710 261
189 3300032002 Ga0307416_100001029 Ga0307416_10000102910 261
190 3300032005 Ga0307411_10016044 Ga0307411_100160443 261
191 3300035116 Ga0373945_0049383 Ga0373945_0049383_228_1025 261
192 3300035172 Ga0373955_0033724 Ga0373955_0033724_1083_1880 261
193 3300036401 Ga0373937_0078399 Ga0373937_0078399_179_976 261
194 3300037068 Ga0373925_0366118 Ga0373925_0366118_325_1122 261
195 3300046459 Ga0495629_0050213 Ga0495629_0050213_169_966 261
196 3300046472 Ga0495580_0110921 Ga0495580_0110921_753_1550 261
197 3300046472 Ga0495580_0344733 Ga0495580_0344733_100_897 261
198 3300046477 Ga0495664_0241877 Ga0495664_0241877_46_843 261
199 3300046511 Ga0495608_0205748 Ga0495608_0205748_273_1070 261
200 3300046663 Ga0495635_0065172 Ga0495635_0065172_1490_2287 261
201 3300046681 Ga0495647_0024215 Ga0495647_0024215_1122_1919 261
202 3300046681 Ga0495647_0105651 Ga0495647_0105651_94_891 261
203 3300046683 Ga0495658_0025881 Ga0495658_0025881_428_1225 261
204 3300046689 Ga0495613_0127979 Ga0495613_0127979_297_1094 261
205 3300048911 Ga0496108_0038538 Ga0496108_0038538_788_1585 261
206 3300053085 Ga0495619_0141307 Ga0495619_0141307_819_1616 261
207 3300053148 Ga0500590_005812 Ga0500590_005812_1713_2510 261
208 3300006353 Ga0075370_10002734 Ga0075370_100027345 262
209 3300031250 Ga0265331_10017178 Ga0265331_100171783 262
210 3300042135 Ga0450899_001396 Ga0450899_001396_1649_2437 262
211 3300049743 Ga0501081_0287807 Ga0501081_0287807_49_837 262
212 3300050496 nmdc:mga07m45_9928_c1 nmdc:mga07m45_9928_c1_586_1374 262
213 3300005331 Ga0070670_100051008 Ga0070670_1000510082 263
214 3300005354 Ga0070675_100054342 Ga0070675_1000543424 263
215 3300005364 Ga0070673_100016331 Ga0070673_1000163312 263
216 3300005456 Ga0070678_100013691 Ga0070678_1000136912 263
217 3300005543 Ga0070672_100024892 Ga0070672_1000248924 263
218 3300005618 Ga0068864_100012333 Ga0068864_1000123337 263
219 3300006237 Ga0097621_100017505 Ga0097621_1000175056 263
220 3300013308 Ga0157375_10295430 Ga0157375_102954302 263
221 3300014969 Ga0157376_10097654 Ga0157376_100976542 263
222 3300025925 Ga0207650_10056771 Ga0207650_100567713 263
223 3300025926 Ga0207659_10106008 Ga0207659_101060083 263
224 3300025931 Ga0207644_10089286 Ga0207644_100892863 263
225 3300025940 Ga0207691_10014528 Ga0207691_100145287 263
226 3300025945 Ga0207679_10154980 Ga0207679_101549802 263
227 3300026095 Ga0207676_10409967 Ga0207676_104099672 263
228 3300026121 Ga0207683_10012675 Ga0207683_100126757 263
229 3300034817 Ga0373948_0002626 Ga0373948_0002626_1361_2152 263
230 3300035088 Ga0373940_0001559 Ga0373940_0001559_2527_3318 263
231 3300035090 Ga0373949_0066929 Ga0373949_0066929_122_913 263
232 3300035114 Ga0373939_0000003 Ga0373939_0000003_58844_59635 263
233 3300035121 Ga0373960_0000565 Ga0373960_0000565_6091_6882 263
234 3300035691 Ga0373931_0001362 Ga0373931_0001362_685_1476 263
235 3300046543 Ga0495645_0146407 Ga0495645_0146407_39_842 263
236 3300048911 Ga0496108_0142554 Ga0496108_0142554_629_1432 263
237 iso_pu_bacteria 2894023352 2894023464 263
238 3300025935 Ga0207709_10438507 Ga0207709_104385071 264
239 3300039447 Ga0436361_0620560 Ga0436361_0620560_3493_4287 264
240 3300037471 Ga0395905_0348592 Ga0395905_0348592_169_969 265
241 3300042876 Ga0451577_0013997 Ga0451577_0013997_1717_2532 265
242 3300021361 Ga0213872_10010067 Ga0213872_100100673 266
243 3300037471 Ga0395905_0026155 Ga0395905_0026155_3988_4812 266
244 3300039447 Ga0436361_0202129 Ga0436361_0202129_35533_36333 266
245 3300042876 Ga0451577_0000191 Ga0451577_0000191_22053_22853 266
246 3300044712 Ga0453684_0000590 Ga0453684_0000590_27780_28580 266
247 3300045051 Ga0451576_0004219 Ga0451576_0004219_15832_16632 266
248 3300006051 Ga0075364_10060494 Ga0075364_100604942 267
249 2162886007 SwRhRL2b_contig_3140295 SwRhRL2b_0634.00000030 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

4

279

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b5m-assembly2.cif.gz_B neisseria ap endonuclease bound to the substrate with a cytosine orphan base 0.963 5 270
4b5h-assembly1.cif.gz_A substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions 0.9625 5 272
4b5h-assembly1.cif.gz_A substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions 0.9589 5 272
8igi-assembly2.cif.gz_B crystal structure of hp1526 (xtha)- a base excision dna repair protein in helicobacter pylori 0.9577 6 267
4f1r-assembly1.cif.gz_A structure analysis of the global metabolic regulator crc from pseudomonas aeruginos 0.9566 7 270
ID Description Score Start End Superfamily
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9685 5 270 3.60.10.10
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9575 5 270 3.60.10.10
4f1rA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9566 7 270 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9517 4 270 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9481 4 270 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A502DDK9-F1-model_v4 Exodeoxyribonuclease III (EC 3.1.11.2) 0.9923 5 270 GO:0003906
GO:0006284
GO:0008081
GO:0008311
GO:0046872
AF-A0A6N0BWP8-F1-model_v4 Exodeoxyribonuclease III (EC 3.1.11.2) 0.9918 5 270 GO:0003906
GO:0006284
GO:0008081
GO:0008311
GO:0046872
AF-E6V1E5-F1-model_v4 Exodeoxyribonuclease III Xth (EC 4.2.99.18) 0.9917 5 270 GO:0003906
GO:0006284
GO:0008081
GO:0008311
GO:0016829
GO:0046872
AF-A0A3A4RLJ3-F1-model_v4 Exodeoxyribonuclease III (EC 3.1.11.2) 0.9916 5 270 GO:0003906
GO:0006284
GO:0008081
GO:0008311
GO:0046872
AF-A0A2U0Z3A6-F1-model_v4 deleted 0.9916 39 270

Feature Viewer

pLDDT pTM Quality
94.7 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map