F360835
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 249 | 175 | 225 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300029957|Ga0265324_10000612|Ga0265324_1000061220 |
| Length | 290 |
| Sequence | MRIITLNLNGIRSAYNKGLLEWFAKQDADILCVQELKAQAADMTPDMLAPLGYHGYFHYAEKKGYSGVGIYSKRKPDNVTVGLGIPEFDAEGRYIEAQFGNLSVVSLYLPSGSSGEERQAVKFKFLEAFMPHLRQMMENSKGAVVGESRLLPQTAGSASNVSQPHMSPPFSSGRDIIVCGDWNIAHTEKDLKNWRGNKKNSGFLPEERAWLTELFNEVGFVDVFRKLHPELEAYTWWSNRGQAWAKDVGWRLDYHAVTPDMAARAVSAGIYKDQRFSDHAPMMVDYKDQE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 5 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 6 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 7 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 8 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 9 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 10 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 11 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 12 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 13 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 14 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 15 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 16 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 17 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 18 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 19 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 20 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 21 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 22 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 23 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 24 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 25 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 122 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 128 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 129 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 132 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 133 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 134 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 141 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 142 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 143 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 144 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 165 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 166 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 170 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 171 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 172 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 173 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 174 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 175 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.36 |
| Metatranscriptomes | 0 |
| Isolates | 9.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.83 |
| Nodule | 0.8 |
| Rhizoplane | 2.41 |
| Rhizosphere | 83.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3140295 | 2162886007 | Bacteria | 1886 |
| 2 | JGI25155J39150_1000167 | 3300002704 | Bacteria | 29016 |
| 3 | rootL2_10009071 | 3300003322 | Bacteria | 14793 |
| 4 | Ga0055538_1000024 | 3300003751 | Bacteria | 241526 |
| 5 | Ga0055531_10036338 | 3300003794 | Bacteria | 1522 |
| 6 | Ga0065704_10089564 | 3300005289 | Bacteria | 2848 |
| 7 | Ga0070676_10004263 | 3300005328 | Bacteria | 7511 |
| 8 | Ga0070683_100082454 | 3300005329 | Bacteria | 3012 |
| 9 | Ga0070670_100051008 | 3300005331 | Bacteria | 3554 |
| 10 | Ga0070670_100221405 | 3300005331 | Bacteria | 1646 |
| 11 | Ga0070670_100279937 | 3300005331 | Bacteria | 1456 |
| 12 | Ga0070666_10003268 | 3300005335 | Bacteria | 9843 |
| 13 | Ga0070680_100352614 | 3300005336 | Bacteria | 1251 |
| 14 | Ga0068868_100118931 | 3300005338 | Bacteria | 2154 |
| 15 | Ga0070689_100003968 | 3300005340 | Bacteria | 9936 |
| 16 | Ga0070661_100489176 | 3300005344 | Bacteria | 983 |
| 17 | Ga0070675_100000422 | 3300005354 | Bacteria | 28826 |
| 18 | Ga0070675_100027540 | 3300005354 | Bacteria | 4567 |
| 19 | Ga0070675_100054342 | 3300005354 | Bacteria | 3295 |
| 20 | Ga0070671_100006469 | 3300005355 | Bacteria | 9365 |
| 21 | Ga0070671_100053838 | 3300005355 | Bacteria | 3345 |
| 22 | Ga0070671_100356103 | 3300005355 | Bacteria | 1249 |
| 23 | Ga0070674_100206652 | 3300005356 | Bacteria | 1519 |
| 24 | Ga0070673_100016331 | 3300005364 | Bacteria | 5246 |
| 25 | Ga0070673_100089986 | 3300005364 | Bacteria | 2506 |
| 26 | Ga0070673_100279644 | 3300005364 | Bacteria | 1463 |
| 27 | Ga0070667_100036584 | 3300005367 | Bacteria | 4116 |
| 28 | Ga0070667_100043300 | 3300005367 | Bacteria | 3778 |
| 29 | Ga0070678_100013691 | 3300005456 | Bacteria | 5096 |
| 30 | Ga0070678_100031062 | 3300005456 | Bacteria | 3679 |
| 31 | Ga0070678_100167816 | 3300005456 | Bacteria | 1784 |
| 32 | Ga0070678_100256191 | 3300005456 | Bacteria | 1469 |
| 33 | Ga0070662_100516369 | 3300005457 | Bacteria | 998 |
| 34 | Ga0070681_10022044 | 3300005458 | Bacteria | 6392 |
| 35 | Ga0068867_100019675 | 3300005459 | Bacteria | 4810 |
| 36 | Ga0068867_100024700 | 3300005459 | Bacteria | 4307 |
| 37 | Ga0068867_100174351 | 3300005459 | Bacteria | 1705 |
| 38 | Ga0070685_10033434 | 3300005466 | Bacteria | 2889 |
| 39 | Ga0070706_100077728 | 3300005467 | Bacteria | 3072 |
| 40 | Ga0070707_100022060 | 3300005468 | Bacteria | 6020 |
| 41 | Ga0070707_100096850 | 3300005468 | Bacteria | 2858 |
| 42 | Ga0070699_100397888 | 3300005518 | Bacteria | 1245 |
| 43 | Ga0070672_100024892 | 3300005543 | Bacteria | 4431 |
| 44 | Ga0070672_100074369 | 3300005543 | Bacteria | 2710 |
| 45 | Ga0070664_100020901 | 3300005564 | Bacteria | 5393 |
| 46 | Ga0070664_100110682 | 3300005564 | Bacteria | 2397 |
| 47 | Ga0068854_100308622 | 3300005578 | Bacteria | 1282 |
| 48 | Ga0068856_100242195 | 3300005614 | Bacteria | 1819 |
| 49 | Ga0068852_100013568 | 3300005616 | Bacteria | 6237 |
| 50 | Ga0068852_100214833 | 3300005616 | Bacteria | 1826 |
| 51 | Ga0068852_100515487 | 3300005616 | Bacteria | 1192 |
| 52 | Ga0068859_100018531 | 3300005617 | Bacteria | 6995 |
| 53 | Ga0068864_100001444 | 3300005618 | Bacteria | 19588 |
| 54 | Ga0068864_100012333 | 3300005618 | Bacteria | 7062 |
| 55 | Ga0068851_10059415 | 3300005834 | Bacteria | 1955 |
| 56 | Ga0068863_100021924 | 3300005841 | Bacteria | 6095 |
| 57 | Ga0068858_100006313 | 3300005842 | Bacteria | 11543 |
| 58 | Ga0075368_10035047 | 3300006042 | Bacteria | 1958 |
| 59 | Ga0075363_100032524 | 3300006048 | Bacteria | 2710 |
| 60 | Ga0075364_10060494 | 3300006051 | Bacteria | 2484 |
| 61 | Ga0097621_100017505 | 3300006237 | Bacteria | 5443 |
| 62 | Ga0097621_100340165 | 3300006237 | Bacteria | 1332 |
| 63 | Ga0075370_10002734 | 3300006353 | Bacteria | 8263 |
| 64 | Ga0068871_100191155 | 3300006358 | Bacteria | 1763 |
| 65 | Ga0075434_100054369 | 3300006871 | Bacteria | 3978 |
| 66 | Ga0097620_100018531 | 3300006931 | Bacteria | 6995 |
| 67 | Ga0105248_10248931 | 3300009177 | Bacteria | 2000 |
| 68 | Ga0105248_10489341 | 3300009177 | Bacteria | 1387 |
| 69 | Ga0105237_10134756 | 3300009545 | Bacteria | 2464 |
| 70 | Ga0105238_10104924 | 3300009551 | Bacteria | 2807 |
| 71 | Ga0157371_10179442 | 3300013102 | Bacteria | 1514 |
| 72 | Ga0157370_10162734 | 3300013104 | Bacteria | 2076 |
| 73 | Ga0157369_10368656 | 3300013105 | Bacteria | 1491 |
| 74 | Ga0157374_10190984 | 3300013296 | Bacteria | 2003 |
| 75 | Ga0157374_10400986 | 3300013296 | Bacteria | 1368 |
| 76 | Ga0157378_10152300 | 3300013297 | Bacteria | 2155 |
| 77 | Ga0157372_10789114 | 3300013307 | Bacteria | 1104 |
| 78 | Ga0157375_10295430 | 3300013308 | Bacteria | 1783 |
| 79 | Ga0157379_10019975 | 3300014968 | Bacteria | 5919 |
| 80 | Ga0157376_10097654 | 3300014969 | Bacteria | 2559 |
| 81 | Ga0163161_10133106 | 3300017792 | Bacteria | 1877 |
| 82 | Ga0213872_10000033 | 3300021361 | Bacteria | 135667 |
| 83 | Ga0213872_10000412 | 3300021361 | Bacteria | 35039 |
| 84 | Ga0213872_10010067 | 3300021361 | Bacteria | 4510 |
| 85 | Ga0207697_10008205 | 3300025315 | Bacteria | 4590 |
| 86 | Ga0207682_10007140 | 3300025893 | Bacteria | 4468 |
| 87 | Ga0207682_10012324 | 3300025893 | Bacteria | 3338 |
| 88 | Ga0207682_10056428 | 3300025893 | Bacteria | 1635 |
| 89 | Ga0207682_10114465 | 3300025893 | Bacteria | 1190 |
| 90 | Ga0207645_10030400 | 3300025907 | Bacteria | 3480 |
| 91 | Ga0207643_10036661 | 3300025908 | Bacteria | 2750 |
| 92 | Ga0207684_10073622 | 3300025910 | Bacteria | 2901 |
| 93 | Ga0207684_10075344 | 3300025910 | Bacteria | 2868 |
| 94 | Ga0207652_10427974 | 3300025921 | Bacteria | 1194 |
| 95 | Ga0207650_10056771 | 3300025925 | Bacteria | 2910 |
| 96 | Ga0207650_10129751 | 3300025925 | Bacteria | 1971 |
| 97 | Ga0207650_10131191 | 3300025925 | Bacteria | 1961 |
| 98 | Ga0207650_10371204 | 3300025925 | Bacteria | 1180 |
| 99 | Ga0207659_10106008 | 3300025926 | Bacteria | 2128 |
| 100 | Ga0207659_10377733 | 3300025926 | Bacteria | 1181 |
| 101 | Ga0207644_10015847 | 3300025931 | Bacteria | 5068 |
| 102 | Ga0207644_10089286 | 3300025931 | Bacteria | 2294 |
| 103 | Ga0207706_10161664 | 3300025933 | Bacteria | 1968 |
| 104 | Ga0207709_10438507 | 3300025935 | Bacteria | 1007 |
| 105 | Ga0207669_10097224 | 3300025937 | Bacteria | 1935 |
| 106 | Ga0207691_10014528 | 3300025940 | Bacteria | 7510 |
| 107 | Ga0207691_10014735 | 3300025940 | Bacteria | 7451 |
| 108 | Ga0207691_10143358 | 3300025940 | Bacteria | 2104 |
| 109 | Ga0207711_10016074 | 3300025941 | Bacteria | 6210 |
| 110 | Ga0207711_10394824 | 3300025941 | Bacteria | 1285 |
| 111 | Ga0207689_10172453 | 3300025942 | Bacteria | 1783 |
| 112 | Ga0207661_10345230 | 3300025944 | Bacteria | 1342 |
| 113 | Ga0207679_10139001 | 3300025945 | Bacteria | 1960 |
| 114 | Ga0207679_10154980 | 3300025945 | Bacteria | 1869 |
| 115 | Ga0207651_10410374 | 3300025960 | Bacteria | 1154 |
| 116 | Ga0207651_10698591 | 3300025960 | Bacteria | 893 |
| 117 | Ga0207712_10057519 | 3300025961 | Bacteria | 2744 |
| 118 | Ga0207658_10167086 | 3300025986 | Bacteria | 1808 |
| 119 | Ga0207703_10006662 | 3300026035 | Bacteria | 9215 |
| 120 | Ga0207708_10128937 | 3300026075 | Bacteria | 1976 |
| 121 | Ga0207641_10013958 | 3300026088 | Bacteria | 6586 |
| 122 | Ga0207648_10032204 | 3300026089 | Bacteria | 4630 |
| 123 | Ga0207648_10045124 | 3300026089 | Bacteria | 3866 |
| 124 | Ga0207648_10057097 | 3300026089 | Bacteria | 3406 |
| 125 | Ga0207676_10010733 | 3300026095 | Bacteria | 6530 |
| 126 | Ga0207676_10409967 | 3300026095 | Bacteria | 1268 |
| 127 | Ga0207675_100020570 | 3300026118 | Bacteria | 6152 |
| 128 | Ga0207683_10012675 | 3300026121 | Bacteria | 7190 |
| 129 | Ga0207683_10201265 | 3300026121 | Bacteria | 1810 |
| 130 | Ga0207683_10339507 | 3300026121 | Bacteria | 1378 |
| 131 | Ga0207698_10161906 | 3300026142 | Bacteria | 1958 |
| 132 | Ga0209813_10022316 | 3300027866 | Bacteria | 1789 |
| 133 | Ga0265324_10000612 | 3300029957 | Bacteria | 24383 |
| 134 | Ga0265324_10027027 | 3300029957 | Bacteria | 2029 |
| 135 | Ga0265328_10000235 | 3300031239 | Bacteria | 25524 |
| 136 | Ga0265328_10059190 | 3300031239 | Bacteria | 1406 |
| 137 | Ga0265325_10001853 | 3300031241 | Bacteria | 14598 |
| 138 | Ga0265331_10000144 | 3300031250 | Bacteria | 92791 |
| 139 | Ga0265331_10001358 | 3300031250 | Bacteria | 17982 |
| 140 | Ga0265331_10017178 | 3300031250 | Bacteria | 3780 |
| 141 | Ga0265327_10000213 | 3300031251 | Bacteria | 121151 |
| 142 | Ga0265327_10000314 | 3300031251 | Bacteria | 92783 |
| 143 | Ga0265327_10006092 | 3300031251 | Bacteria | 9776 |
| 144 | Ga0265327_10006303 | 3300031251 | Bacteria | 9544 |
| 145 | Ga0265327_10083032 | 3300031251 | Bacteria | 1577 |
| 146 | Ga0265316_10036771 | 3300031344 | Bacteria | 3958 |
| 147 | Ga0307509_10070824 | 3300031507 | Bacteria | 3639 |
| 148 | Ga0307408_100067005 | 3300031548 | Bacteria | 2639 |
| 149 | Ga0265314_10001810 | 3300031711 | Bacteria | 23057 |
| 150 | Ga0265314_10013391 | 3300031711 | Bacteria | 6627 |
| 151 | Ga0307516_10085740 | 3300031730 | Bacteria | 2987 |
| 152 | Ga0307405_10036952 | 3300031731 | Bacteria | 2931 |
| 153 | Ga0307406_10055033 | 3300031901 | Bacteria | 2542 |
| 154 | Ga0307412_10007703 | 3300031911 | Bacteria | 6121 |
| 155 | Ga0307409_100000327 | 3300031995 | Bacteria | 19575 |
| 156 | Ga0307416_100001029 | 3300032002 | Bacteria | 14796 |
| 157 | Ga0307414_10030831 | 3300032004 | Bacteria | 3508 |
| 158 | Ga0307411_10016044 | 3300032005 | Bacteria | 4230 |
| 159 | Ga0373948_0002626 | 3300034817 | Bacteria | 2679 |
| 160 | Ga0373940_0001559 | 3300035088 | Bacteria | 4195 |
| 161 | Ga0373949_0066929 | 3300035090 | Bacteria | 934 |
| 162 | Ga0373939_0000003 | 3300035114 | Bacteria | 111914 |
| 163 | Ga0373945_0049383 | 3300035116 | Bacteria | 1544 |
| 164 | Ga0373960_0000565 | 3300035121 | Bacteria | 7508 |
| 165 | Ga0373955_0033724 | 3300035172 | Bacteria | 2698 |
| 166 | Ga0373931_0001362 | 3300035691 | Bacteria | 10454 |
| 167 | Ga0373931_0104017 | 3300035691 | Bacteria | 1601 |
| 168 | Ga0373937_0078399 | 3300036401 | Bacteria | 3053 |
| 169 | Ga0373925_0366118 | 3300037068 | Bacteria | 1172 |
| 170 | Ga0395905_0026155 | 3300037471 | Bacteria | 5504 |
| 171 | Ga0395905_0348592 | 3300037471 | Bacteria | 1372 |
| 172 | Ga0436361_0074660 | 3300039447 | Bacteria | 44726 |
| 173 | Ga0436361_0147565 | 3300039447 | Bacteria | 50932 |
| 174 | Ga0436361_0202129 | 3300039447 | Bacteria | 39168 |
| 175 | Ga0436361_0620560 | 3300039447 | Bacteria | 5994 |
| 176 | Ga0451851_0246194 | 3300041507 | Bacteria | 815 |
| 177 | Ga0439449_0045130 | 3300042007 | Bacteria | 1634 |
| 178 | Ga0450894_009769 | 3300042131 | Bacteria | 1243 |
| 179 | Ga0450899_001396 | 3300042135 | Bacteria | 2698 |
| 180 | Ga0451577_0000122 | 3300042876 | Bacteria | 171004 |
| 181 | Ga0451577_0000191 | 3300042876 | Bacteria | 128991 |
| 182 | Ga0451577_0007738 | 3300042876 | Bacteria | 10532 |
| 183 | Ga0451577_0013997 | 3300042876 | Bacteria | 7487 |
| 184 | Ga0453684_0000434 | 3300044712 | Bacteria | 170295 |
| 185 | Ga0453684_0000590 | 3300044712 | Bacteria | 134718 |
| 186 | Ga0453684_0016594 | 3300044712 | Bacteria | 11494 |
| 187 | Ga0453684_0017460 | 3300044712 | Bacteria | 11114 |
| 188 | Ga0453684_0419456 | 3300044712 | Unclassified | 1495 |
| 189 | Ga0451576_0004219 | 3300045051 | Bacteria | 18885 |
| 190 | Ga0451576_0012206 | 3300045051 | Bacteria | 9679 |
| 191 | Ga0451576_0081769 | 3300045051 | Bacteria | 3359 |
| 192 | Ga0451576_0108603 | 3300045051 | Bacteria | 2887 |
| 193 | Ga0495629_0050213 | 3300046459 | Bacteria | 2922 |
| 194 | Ga0495580_0110921 | 3300046472 | Bacteria | 1905 |
| 195 | Ga0495580_0344733 | 3300046472 | Bacteria | 1010 |
| 196 | Ga0495664_0241877 | 3300046477 | Bacteria | 1092 |
| 197 | Ga0495608_0205748 | 3300046511 | Bacteria | 1239 |
| 198 | Ga0495598_0013563 | 3300046537 | Bacteria | 2023 |
| 199 | Ga0495645_0146407 | 3300046543 | Bacteria | 1645 |
| 200 | Ga0495635_0065172 | 3300046663 | Bacteria | 2500 |
| 201 | Ga0495647_0024215 | 3300046681 | Bacteria | 2208 |
| 202 | Ga0495647_0105651 | 3300046681 | Bacteria | 1170 |
| 203 | Ga0495658_0025881 | 3300046683 | Bacteria | 3140 |
| 204 | Ga0495613_0127979 | 3300046689 | Bacteria | 1820 |
| 205 | Ga0496104_0122557 | 3300048907 | Bacteria | 2496 |
| 206 | Ga0496105_0102959 | 3300048908 | Bacteria | 2358 |
| 207 | Ga0496105_0581543 | 3300048908 | Bacteria | 871 |
| 208 | Ga0496108_0038538 | 3300048911 | Bacteria | 3982 |
| 209 | Ga0496108_0142554 | 3300048911 | Bacteria | 2065 |
| 210 | Ga0496113_0046620 | 3300048916 | Bacteria | 3218 |
| 211 | Ga0495678_002953 | 3300049459 | Bacteria | 10862 |
| 212 | Ga0501081_0287807 | 3300049743 | Bacteria | 1204 |
| 213 | nmdc:mga0k408_15424_c1 | 3300050493 | Bacteria | 4227 |
| 214 | nmdc:mga06z11_142138_c1 | 3300050494 | Bacteria | 1358 |
| 215 | nmdc:mga07m45_252697_c1 | 3300050496 | Bacteria | 1026 |
| 216 | nmdc:mga07m45_9928_c1 | 3300050496 | Bacteria | 4953 |
| 217 | nmdc:mga0n895_157447_c1 | 3300050512 | Bacteria | 2302 |
| 218 | Ga0495619_0141307 | 3300053085 | Bacteria | 1658 |
| 219 | Ga0500618_012451 | 3300053125 | Bacteria | 2227 |
| 220 | Ga0500618_012948 | 3300053125 | Bacteria | 2171 |
| 221 | Ga0500590_005812 | 3300053148 | Bacteria | 5965 |
| 222 | Ga0500600_0003966 | 3300053149 | Bacteria | 8627 |
| 223 | Ga0500622_0000011 | 3300053156 | Bacteria | 386096 |
| 224 | Ga0500661_008400 | 3300055283 | Bacteria | 1900 |
| 225 | Ga0590074_009042 | 3300059423 | Bacteria | 1660 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10009071 | rootL2_1000907110 | 209 |
| 2 | 3300041507 | Ga0451851_0246194 | Ga0451851_0246194_97_765 | 218 |
| 3 | 3300005518 | Ga0070699_100397888 | Ga0070699_1003978882 | 223 |
| 4 | 3300048908 | Ga0496105_0102959 | Ga0496105_0102959_14_712 | 227 |
| 5 | 3300053156 | Ga0500622_0000011 | Ga0500622_0000011_17614_18318 | 233 |
| 6 | 3300005564 | Ga0070664_100020901 | Ga0070664_1000209012 | 247 |
| 7 | 3300025945 | Ga0207679_10139001 | Ga0207679_101390012 | 247 |
| 8 | 3300005289 | Ga0065704_10089564 | Ga0065704_100895641 | 249 |
| 9 | iso_pu_bacteria | 2511231026 | 2511385425 | 251 |
| 10 | iso_pu_bacteria | 2521172590 | 2521560598 | 252 |
| 11 | iso_pu_bacteria | 2551306416 | 2553005717 | 252 |
| 12 | iso_pu_bacteria | 2765235838 | 2765571850 | 252 |
| 13 | iso_pu_bacteria | 2808606386 | 2808982147 | 252 |
| 14 | iso_pu_bacteria | 2808606415 | 2809130053 | 252 |
| 15 | iso_pu_bacteria | 2808606419 | 2809148892 | 252 |
| 16 | iso_pu_bacteria | 2839094727 | 2839098429 | 252 |
| 17 | iso_pu_bacteria | 2852618963 | 2852619027 | 252 |
| 18 | iso_pu_bacteria | 2894510363 | 2894514776 | 252 |
| 19 | iso_pu_bacteria | 2904439833 | 2904442929 | 252 |
| 20 | iso_pu_bacteria | 2904530477 | 2904534871 | 252 |
| 21 | iso_pu_bacteria | 2904584206 | 2904588786 | 252 |
| 22 | iso_pu_bacteria | 2904589729 | 2904594140 | 252 |
| 23 | iso_pu_bacteria | 2919046199 | 2919048572 | 252 |
| 24 | iso_pu_bacteria | 2919079590 | 2919083256 | 252 |
| 25 | iso_pu_bacteria | 2923510766 | 2923514400 | 252 |
| 26 | iso_pu_bacteria | 2928130867 | 2928133116 | 252 |
| 27 | iso_pu_bacteria | 2998344455 | 2998345494 | 252 |
| 28 | 3300029957 | Ga0265324_10027027 | Ga0265324_100270272 | 253 |
| 29 | 3300031251 | Ga0265327_10006092 | Ga0265327_1000609210 | 253 |
| 30 | 3300031711 | Ga0265314_10013391 | Ga0265314_100133917 | 253 |
| 31 | 3300044712 | Ga0453684_0419456 | Ga0453684_0419456_550_1320 | 253 |
| 32 | 3300045051 | Ga0451576_0012206 | Ga0451576_0012206_6490_7281 | 253 |
| 33 | iso_pu_bacteria | 2818991449 | 2819617290 | 253 |
| 34 | iso_pu_bacteria | 2904601388 | 2904605022 | 253 |
| 35 | 3300013307 | Ga0157372_10789114 | Ga0157372_107891142 | 254 |
| 36 | 3300042876 | Ga0451577_0007738 | Ga0451577_0007738_4891_5757 | 254 |
| 37 | 3300044712 | Ga0453684_0016594 | Ga0453684_0016594_4451_5317 | 254 |
| 38 | 3300049459 | Ga0495678_002953 | Ga0495678_002953_5375_6145 | 254 |
| 39 | iso_pu_bacteria | 8055225921 | 8055227575 | 254 |
| 40 | 3300029957 | Ga0265324_10000612 | Ga0265324_1000061220 | 255 |
| 41 | 3300031241 | Ga0265325_10001853 | Ga0265325_1000185313 | 255 |
| 42 | 3300031711 | Ga0265314_10001810 | Ga0265314_100018103 | 255 |
| 43 | 3300035691 | Ga0373931_0104017 | Ga0373931_0104017_165_932 | 255 |
| 44 | 3300048908 | Ga0496105_0581543 | Ga0496105_0581543_17_784 | 255 |
| 45 | 3300050493 | nmdc:mga0k408_15424_c1 | nmdc:mga0k408_15424_c1_1663_2442 | 255 |
| 46 | 3300050494 | nmdc:mga06z11_142138_c1 | nmdc:mga06z11_142138_c1_519_1298 | 255 |
| 47 | 3300050496 | nmdc:mga07m45_252697_c1 | nmdc:mga07m45_252697_c1_187_966 | 255 |
| 48 | 3300053125 | Ga0500618_012451 | Ga0500618_012451_978_1751 | 255 |
| 49 | 3300053125 | Ga0500618_012948 | Ga0500618_012948_439_1212 | 255 |
| 50 | 3300003751 | Ga0055538_1000024 | Ga0055538_100002482 | 256 |
| 51 | 3300009545 | Ga0105237_10134756 | Ga0105237_101347562 | 256 |
| 52 | 3300031239 | Ga0265328_10059190 | Ga0265328_100591902 | 256 |
| 53 | 3300031250 | Ga0265331_10001358 | Ga0265331_1000135812 | 256 |
| 54 | 3300031251 | Ga0265327_10083032 | Ga0265327_100830321 | 256 |
| 55 | 3300031344 | Ga0265316_10036771 | Ga0265316_100367713 | 256 |
| 56 | 3300031730 | Ga0307516_10085740 | Ga0307516_100857402 | 256 |
| 57 | 3300045051 | Ga0451576_0081769 | Ga0451576_0081769_1697_2602 | 256 |
| 58 | 3300055283 | Ga0500661_008400 | Ga0500661_008400_316_1104 | 256 |
| 59 | iso_pu_bacteria | 2643221603 | 2644029765 | 256 |
| 60 | 3300005336 | Ga0070680_100352614 | Ga0070680_1003526142 | 257 |
| 61 | 3300005458 | Ga0070681_10022044 | Ga0070681_100220442 | 257 |
| 62 | 3300005468 | Ga0070707_100096850 | Ga0070707_1000968503 | 257 |
| 63 | 3300005614 | Ga0068856_100242195 | Ga0068856_1002421951 | 257 |
| 64 | 3300006871 | Ga0075434_100054369 | Ga0075434_1000543694 | 257 |
| 65 | 3300025910 | Ga0207684_10075344 | Ga0207684_100753443 | 257 |
| 66 | 3300025921 | Ga0207652_10427974 | Ga0207652_104279742 | 257 |
| 67 | 3300031251 | Ga0265327_10000213 | Ga0265327_10000213110 | 257 |
| 68 | 3300032004 | Ga0307414_10030831 | Ga0307414_100308312 | 257 |
| 69 | 3300042876 | Ga0451577_0000122 | Ga0451577_0000122_69836_70612 | 257 |
| 70 | 3300044712 | Ga0453684_0000434 | Ga0453684_0000434_99518_100294 | 257 |
| 71 | 3300050512 | nmdc:mga0n895_157447_c1 | nmdc:mga0n895_157447_c1_153_929 | 257 |
| 72 | 3300031239 | Ga0265328_10000235 | Ga0265328_1000023526 | 258 |
| 73 | 3300031250 | Ga0265331_10000144 | Ga0265331_1000014462 | 258 |
| 74 | 3300031251 | Ga0265327_10000314 | Ga0265327_1000031462 | 258 |
| 75 | 3300031251 | Ga0265327_10006303 | Ga0265327_100063039 | 258 |
| 76 | 3300042007 | Ga0439449_0045130 | Ga0439449_0045130_264_1040 | 258 |
| 77 | 3300042131 | Ga0450894_009769 | Ga0450894_009769_57_833 | 258 |
| 78 | 3300048916 | Ga0496113_0046620 | Ga0496113_0046620_2299_3078 | 258 |
| 79 | 3300002704 | JGI25155J39150_1000167 | JGI25155J39150_100016726 | 260 |
| 80 | 3300003794 | Ga0055531_10036338 | Ga0055531_100363382 | 260 |
| 81 | 3300005616 | Ga0068852_100013568 | Ga0068852_1000135686 | 260 |
| 82 | 3300017792 | Ga0163161_10133106 | Ga0163161_101331062 | 260 |
| 83 | 3300021361 | Ga0213872_10000033 | Ga0213872_10000033134 | 260 |
| 84 | 3300021361 | Ga0213872_10000412 | Ga0213872_1000041219 | 260 |
| 85 | 3300039447 | Ga0436361_0074660 | Ga0436361_0074660_25205_25987 | 260 |
| 86 | 3300039447 | Ga0436361_0147565 | Ga0436361_0147565_28677_29459 | 260 |
| 87 | 3300044712 | Ga0453684_0017460 | Ga0453684_0017460_2386_3168 | 260 |
| 88 | 3300045051 | Ga0451576_0108603 | Ga0451576_0108603_306_1091 | 260 |
| 89 | 3300046537 | Ga0495598_0013563 | Ga0495598_0013563_36_833 | 260 |
| 90 | 3300048907 | Ga0496104_0122557 | Ga0496104_0122557_1260_2057 | 260 |
| 91 | 3300053149 | Ga0500600_0003966 | Ga0500600_0003966_5146_5937 | 260 |
| 92 | 3300059423 | Ga0590074_009042 | Ga0590074_009042_449_1231 | 260 |
| 93 | 3300005328 | Ga0070676_10004263 | Ga0070676_100042636 | 261 |
| 94 | 3300005329 | Ga0070683_100082454 | Ga0070683_1000824543 | 261 |
| 95 | 3300005331 | Ga0070670_100221405 | Ga0070670_1002214052 | 261 |
| 96 | 3300005331 | Ga0070670_100279937 | Ga0070670_1002799371 | 261 |
| 97 | 3300005335 | Ga0070666_10003268 | Ga0070666_100032685 | 261 |
| 98 | 3300005338 | Ga0068868_100118931 | Ga0068868_1001189312 | 261 |
| 99 | 3300005340 | Ga0070689_100003968 | Ga0070689_1000039688 | 261 |
| 100 | 3300005344 | Ga0070661_100489176 | Ga0070661_1004891761 | 261 |
| 101 | 3300005354 | Ga0070675_100000422 | Ga0070675_10000042223 | 261 |
| 102 | 3300005354 | Ga0070675_100027540 | Ga0070675_1000275402 | 261 |
| 103 | 3300005355 | Ga0070671_100006469 | Ga0070671_1000064694 | 261 |
| 104 | 3300005355 | Ga0070671_100053838 | Ga0070671_1000538384 | 261 |
| 105 | 3300005355 | Ga0070671_100356103 | Ga0070671_1003561032 | 261 |
| 106 | 3300005356 | Ga0070674_100206652 | Ga0070674_1002066522 | 261 |
| 107 | 3300005364 | Ga0070673_100089986 | Ga0070673_1000899862 | 261 |
| 108 | 3300005364 | Ga0070673_100279644 | Ga0070673_1002796442 | 261 |
| 109 | 3300005367 | Ga0070667_100036584 | Ga0070667_1000365846 | 261 |
| 110 | 3300005367 | Ga0070667_100043300 | Ga0070667_1000433004 | 261 |
| 111 | 3300005456 | Ga0070678_100031062 | Ga0070678_1000310623 | 261 |
| 112 | 3300005456 | Ga0070678_100167816 | Ga0070678_1001678162 | 261 |
| 113 | 3300005456 | Ga0070678_100256191 | Ga0070678_1002561912 | 261 |
| 114 | 3300005457 | Ga0070662_100516369 | Ga0070662_1005163691 | 261 |
| 115 | 3300005459 | Ga0068867_100019675 | Ga0068867_1000196754 | 261 |
| 116 | 3300005459 | Ga0068867_100024700 | Ga0068867_1000247005 | 261 |
| 117 | 3300005459 | Ga0068867_100174351 | Ga0068867_1001743512 | 261 |
| 118 | 3300005466 | Ga0070685_10033434 | Ga0070685_100334342 | 261 |
| 119 | 3300005467 | Ga0070706_100077728 | Ga0070706_1000777283 | 261 |
| 120 | 3300005468 | Ga0070707_100022060 | Ga0070707_1000220606 | 261 |
| 121 | 3300005543 | Ga0070672_100074369 | Ga0070672_1000743693 | 261 |
| 122 | 3300005564 | Ga0070664_100110682 | Ga0070664_1001106821 | 261 |
| 123 | 3300005578 | Ga0068854_100308622 | Ga0068854_1003086221 | 261 |
| 124 | 3300005616 | Ga0068852_100214833 | Ga0068852_1002148332 | 261 |
| 125 | 3300005616 | Ga0068852_100515487 | Ga0068852_1005154872 | 261 |
| 126 | 3300005617 | Ga0068859_100018531 | Ga0068859_1000185312 | 261 |
| 127 | 3300005618 | Ga0068864_100001444 | Ga0068864_10000144415 | 261 |
| 128 | 3300005834 | Ga0068851_10059415 | Ga0068851_100594153 | 261 |
| 129 | 3300005841 | Ga0068863_100021924 | Ga0068863_1000219241 | 261 |
| 130 | 3300005842 | Ga0068858_100006313 | Ga0068858_1000063138 | 261 |
| 131 | 3300006042 | Ga0075368_10035047 | Ga0075368_100350473 | 261 |
| 132 | 3300006048 | Ga0075363_100032524 | Ga0075363_1000325243 | 261 |
| 133 | 3300006237 | Ga0097621_100340165 | Ga0097621_1003401652 | 261 |
| 134 | 3300006358 | Ga0068871_100191155 | Ga0068871_1001911552 | 261 |
| 135 | 3300006931 | Ga0097620_100018531 | Ga0097620_1000185312 | 261 |
| 136 | 3300009177 | Ga0105248_10248931 | Ga0105248_102489313 | 261 |
| 137 | 3300009177 | Ga0105248_10489341 | Ga0105248_104893412 | 261 |
| 138 | 3300009551 | Ga0105238_10104924 | Ga0105238_101049243 | 261 |
| 139 | 3300013102 | Ga0157371_10179442 | Ga0157371_101794422 | 261 |
| 140 | 3300013104 | Ga0157370_10162734 | Ga0157370_101627342 | 261 |
| 141 | 3300013105 | Ga0157369_10368656 | Ga0157369_103686562 | 261 |
| 142 | 3300013296 | Ga0157374_10190984 | Ga0157374_101909842 | 261 |
| 143 | 3300013296 | Ga0157374_10400986 | Ga0157374_104009862 | 261 |
| 144 | 3300013297 | Ga0157378_10152300 | Ga0157378_101523003 | 261 |
| 145 | 3300014968 | Ga0157379_10019975 | Ga0157379_100199752 | 261 |
| 146 | 3300025315 | Ga0207697_10008205 | Ga0207697_100082053 | 261 |
| 147 | 3300025893 | Ga0207682_10007140 | Ga0207682_100071401 | 261 |
| 148 | 3300025893 | Ga0207682_10012324 | Ga0207682_100123244 | 261 |
| 149 | 3300025893 | Ga0207682_10056428 | Ga0207682_100564282 | 261 |
| 150 | 3300025893 | Ga0207682_10114465 | Ga0207682_101144652 | 261 |
| 151 | 3300025907 | Ga0207645_10030400 | Ga0207645_100304002 | 261 |
| 152 | 3300025908 | Ga0207643_10036661 | Ga0207643_100366612 | 261 |
| 153 | 3300025910 | Ga0207684_10073622 | Ga0207684_100736222 | 261 |
| 154 | 3300025925 | Ga0207650_10129751 | Ga0207650_101297512 | 261 |
| 155 | 3300025925 | Ga0207650_10131191 | Ga0207650_101311913 | 261 |
| 156 | 3300025925 | Ga0207650_10371204 | Ga0207650_103712042 | 261 |
| 157 | 3300025926 | Ga0207659_10377733 | Ga0207659_103777332 | 261 |
| 158 | 3300025931 | Ga0207644_10015847 | Ga0207644_100158475 | 261 |
| 159 | 3300025933 | Ga0207706_10161664 | Ga0207706_101616642 | 261 |
| 160 | 3300025937 | Ga0207669_10097224 | Ga0207669_100972243 | 261 |
| 161 | 3300025940 | Ga0207691_10014735 | Ga0207691_100147356 | 261 |
| 162 | 3300025940 | Ga0207691_10143358 | Ga0207691_101433582 | 261 |
| 163 | 3300025941 | Ga0207711_10016074 | Ga0207711_100160747 | 261 |
| 164 | 3300025941 | Ga0207711_10394824 | Ga0207711_103948241 | 261 |
| 165 | 3300025942 | Ga0207689_10172453 | Ga0207689_101724532 | 261 |
| 166 | 3300025944 | Ga0207661_10345230 | Ga0207661_103452302 | 261 |
| 167 | 3300025960 | Ga0207651_10410374 | Ga0207651_104103742 | 261 |
| 168 | 3300025960 | Ga0207651_10698591 | Ga0207651_106985911 | 261 |
| 169 | 3300025961 | Ga0207712_10057519 | Ga0207712_100575192 | 261 |
| 170 | 3300025986 | Ga0207658_10167086 | Ga0207658_101670862 | 261 |
| 171 | 3300026035 | Ga0207703_10006662 | Ga0207703_100066629 | 261 |
| 172 | 3300026075 | Ga0207708_10128937 | Ga0207708_101289373 | 261 |
| 173 | 3300026088 | Ga0207641_10013958 | Ga0207641_100139587 | 261 |
| 174 | 3300026089 | Ga0207648_10032204 | Ga0207648_100322042 | 261 |
| 175 | 3300026089 | Ga0207648_10045124 | Ga0207648_100451243 | 261 |
| 176 | 3300026089 | Ga0207648_10057097 | Ga0207648_100570974 | 261 |
| 177 | 3300026095 | Ga0207676_10010733 | Ga0207676_100107332 | 261 |
| 178 | 3300026118 | Ga0207675_100020570 | Ga0207675_1000205707 | 261 |
| 179 | 3300026121 | Ga0207683_10201265 | Ga0207683_102012652 | 261 |
| 180 | 3300026121 | Ga0207683_10339507 | Ga0207683_103395072 | 261 |
| 181 | 3300026142 | Ga0207698_10161906 | Ga0207698_101619061 | 261 |
| 182 | 3300027866 | Ga0209813_10022316 | Ga0209813_100223162 | 261 |
| 183 | 3300031507 | Ga0307509_10070824 | Ga0307509_100708242 | 261 |
| 184 | 3300031548 | Ga0307408_100067005 | Ga0307408_1000670052 | 261 |
| 185 | 3300031731 | Ga0307405_10036952 | Ga0307405_100369525 | 261 |
| 186 | 3300031901 | Ga0307406_10055033 | Ga0307406_100550332 | 261 |
| 187 | 3300031911 | Ga0307412_10007703 | Ga0307412_100077034 | 261 |
| 188 | 3300031995 | Ga0307409_100000327 | Ga0307409_10000032710 | 261 |
| 189 | 3300032002 | Ga0307416_100001029 | Ga0307416_10000102910 | 261 |
| 190 | 3300032005 | Ga0307411_10016044 | Ga0307411_100160443 | 261 |
| 191 | 3300035116 | Ga0373945_0049383 | Ga0373945_0049383_228_1025 | 261 |
| 192 | 3300035172 | Ga0373955_0033724 | Ga0373955_0033724_1083_1880 | 261 |
| 193 | 3300036401 | Ga0373937_0078399 | Ga0373937_0078399_179_976 | 261 |
| 194 | 3300037068 | Ga0373925_0366118 | Ga0373925_0366118_325_1122 | 261 |
| 195 | 3300046459 | Ga0495629_0050213 | Ga0495629_0050213_169_966 | 261 |
| 196 | 3300046472 | Ga0495580_0110921 | Ga0495580_0110921_753_1550 | 261 |
| 197 | 3300046472 | Ga0495580_0344733 | Ga0495580_0344733_100_897 | 261 |
| 198 | 3300046477 | Ga0495664_0241877 | Ga0495664_0241877_46_843 | 261 |
| 199 | 3300046511 | Ga0495608_0205748 | Ga0495608_0205748_273_1070 | 261 |
| 200 | 3300046663 | Ga0495635_0065172 | Ga0495635_0065172_1490_2287 | 261 |
| 201 | 3300046681 | Ga0495647_0024215 | Ga0495647_0024215_1122_1919 | 261 |
| 202 | 3300046681 | Ga0495647_0105651 | Ga0495647_0105651_94_891 | 261 |
| 203 | 3300046683 | Ga0495658_0025881 | Ga0495658_0025881_428_1225 | 261 |
| 204 | 3300046689 | Ga0495613_0127979 | Ga0495613_0127979_297_1094 | 261 |
| 205 | 3300048911 | Ga0496108_0038538 | Ga0496108_0038538_788_1585 | 261 |
| 206 | 3300053085 | Ga0495619_0141307 | Ga0495619_0141307_819_1616 | 261 |
| 207 | 3300053148 | Ga0500590_005812 | Ga0500590_005812_1713_2510 | 261 |
| 208 | 3300006353 | Ga0075370_10002734 | Ga0075370_100027345 | 262 |
| 209 | 3300031250 | Ga0265331_10017178 | Ga0265331_100171783 | 262 |
| 210 | 3300042135 | Ga0450899_001396 | Ga0450899_001396_1649_2437 | 262 |
| 211 | 3300049743 | Ga0501081_0287807 | Ga0501081_0287807_49_837 | 262 |
| 212 | 3300050496 | nmdc:mga07m45_9928_c1 | nmdc:mga07m45_9928_c1_586_1374 | 262 |
| 213 | 3300005331 | Ga0070670_100051008 | Ga0070670_1000510082 | 263 |
| 214 | 3300005354 | Ga0070675_100054342 | Ga0070675_1000543424 | 263 |
| 215 | 3300005364 | Ga0070673_100016331 | Ga0070673_1000163312 | 263 |
| 216 | 3300005456 | Ga0070678_100013691 | Ga0070678_1000136912 | 263 |
| 217 | 3300005543 | Ga0070672_100024892 | Ga0070672_1000248924 | 263 |
| 218 | 3300005618 | Ga0068864_100012333 | Ga0068864_1000123337 | 263 |
| 219 | 3300006237 | Ga0097621_100017505 | Ga0097621_1000175056 | 263 |
| 220 | 3300013308 | Ga0157375_10295430 | Ga0157375_102954302 | 263 |
| 221 | 3300014969 | Ga0157376_10097654 | Ga0157376_100976542 | 263 |
| 222 | 3300025925 | Ga0207650_10056771 | Ga0207650_100567713 | 263 |
| 223 | 3300025926 | Ga0207659_10106008 | Ga0207659_101060083 | 263 |
| 224 | 3300025931 | Ga0207644_10089286 | Ga0207644_100892863 | 263 |
| 225 | 3300025940 | Ga0207691_10014528 | Ga0207691_100145287 | 263 |
| 226 | 3300025945 | Ga0207679_10154980 | Ga0207679_101549802 | 263 |
| 227 | 3300026095 | Ga0207676_10409967 | Ga0207676_104099672 | 263 |
| 228 | 3300026121 | Ga0207683_10012675 | Ga0207683_100126757 | 263 |
| 229 | 3300034817 | Ga0373948_0002626 | Ga0373948_0002626_1361_2152 | 263 |
| 230 | 3300035088 | Ga0373940_0001559 | Ga0373940_0001559_2527_3318 | 263 |
| 231 | 3300035090 | Ga0373949_0066929 | Ga0373949_0066929_122_913 | 263 |
| 232 | 3300035114 | Ga0373939_0000003 | Ga0373939_0000003_58844_59635 | 263 |
| 233 | 3300035121 | Ga0373960_0000565 | Ga0373960_0000565_6091_6882 | 263 |
| 234 | 3300035691 | Ga0373931_0001362 | Ga0373931_0001362_685_1476 | 263 |
| 235 | 3300046543 | Ga0495645_0146407 | Ga0495645_0146407_39_842 | 263 |
| 236 | 3300048911 | Ga0496108_0142554 | Ga0496108_0142554_629_1432 | 263 |
| 237 | iso_pu_bacteria | 2894023352 | 2894023464 | 263 |
| 238 | 3300025935 | Ga0207709_10438507 | Ga0207709_104385071 | 264 |
| 239 | 3300039447 | Ga0436361_0620560 | Ga0436361_0620560_3493_4287 | 264 |
| 240 | 3300037471 | Ga0395905_0348592 | Ga0395905_0348592_169_969 | 265 |
| 241 | 3300042876 | Ga0451577_0013997 | Ga0451577_0013997_1717_2532 | 265 |
| 242 | 3300021361 | Ga0213872_10010067 | Ga0213872_100100673 | 266 |
| 243 | 3300037471 | Ga0395905_0026155 | Ga0395905_0026155_3988_4812 | 266 |
| 244 | 3300039447 | Ga0436361_0202129 | Ga0436361_0202129_35533_36333 | 266 |
| 245 | 3300042876 | Ga0451577_0000191 | Ga0451577_0000191_22053_22853 | 266 |
| 246 | 3300044712 | Ga0453684_0000590 | Ga0453684_0000590_27780_28580 | 266 |
| 247 | 3300045051 | Ga0451576_0004219 | Ga0451576_0004219_15832_16632 | 266 |
| 248 | 3300006051 | Ga0075364_10060494 | Ga0075364_100604942 | 267 |
| 249 | 2162886007 | SwRhRL2b_contig_3140295 | SwRhRL2b_0634.00000030 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b5m-assembly2.cif.gz_B | neisseria ap endonuclease bound to the substrate with a cytosine orphan base | 0.963 | 5 | 270 |
| 4b5h-assembly1.cif.gz_A | substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions | 0.9625 | 5 | 272 |
| 4b5h-assembly1.cif.gz_A | substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions | 0.9589 | 5 | 272 |
| 8igi-assembly2.cif.gz_B | crystal structure of hp1526 (xtha)- a base excision dna repair protein in helicobacter pylori | 0.9577 | 6 | 267 |
| 4f1r-assembly1.cif.gz_A | structure analysis of the global metabolic regulator crc from pseudomonas aeruginos | 0.9566 | 7 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b5gC00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9685 | 5 | 270 | 3.60.10.10 |
| 4b5gC00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9575 | 5 | 270 | 3.60.10.10 |
| 4f1rA00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9566 | 7 | 270 | 3.60.10.10 |
| 3g3cB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9517 | 4 | 270 | 3.60.10.10 |
| 3g3cB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9481 | 4 | 270 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A502DDK9-F1-model_v4 | Exodeoxyribonuclease III (EC 3.1.11.2) | 0.9923 | 5 | 270 |
GO:0003906
GO:0006284 GO:0008081 GO:0008311 GO:0046872 |
| AF-A0A6N0BWP8-F1-model_v4 | Exodeoxyribonuclease III (EC 3.1.11.2) | 0.9918 | 5 | 270 |
GO:0003906
GO:0006284 GO:0008081 GO:0008311 GO:0046872 |
| AF-E6V1E5-F1-model_v4 | Exodeoxyribonuclease III Xth (EC 4.2.99.18) | 0.9917 | 5 | 270 |
GO:0003906
GO:0006284 GO:0008081 GO:0008311 GO:0016829 GO:0046872 |
| AF-A0A3A4RLJ3-F1-model_v4 | Exodeoxyribonuclease III (EC 3.1.11.2) | 0.9916 | 5 | 270 |
GO:0003906
GO:0006284 GO:0008081 GO:0008311 GO:0046872 |
| AF-A0A2U0Z3A6-F1-model_v4 | deleted | 0.9916 | 39 | 270 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar