F360745

General Info

Members Datasets Scaffolds Average Seq Length
249 162 498 127

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10616153|Ga0157370_106161532
Length 144
Sequence MHPYVVEKHTDVVGDALAKTRLTPLEFQIMTTLWERGKASIREIQETFPEDDRPAYTTVQTTIYRMEDKNIVRRVRKVGNFHIFEPAVSRNAAQGRLIDDLLALFGGRTQPVMAHLVESGKLTLDDVKEAEKALRKLSKKEAKC

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
71 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
72 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 5.22
Rhizosphere 92.37
Stem 0
Stem Tuber 0
Unclassified 39.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10616153 3300013104 Unclassified 993
2 Ga0070658_11341493 3300005327 Unclassified 621
3 Ga0070658_11475925 3300005327 Unclassified 590
4 Ga0070676_10143944 3300005328 Unclassified 1520
5 Ga0070683_100381852 3300005329 Bacteria 1342
6 Ga0070690_100095740 3300005330 Unclassified 1961
7 Ga0070666_10041329 3300005335 Bacteria 3081
8 Ga0070666_10722737 3300005335 Unclassified 731
9 Ga0070682_100934870 3300005337 Bacteria 715
10 Ga0068868_100076513 3300005338 Bacteria 2676
11 Ga0070673_101297259 3300005364 Unclassified 684
12 Ga0070673_101937780 3300005364 Bacteria 559
13 Ga0070659_101492894 3300005366 Bacteria 602
14 Ga0070667_100622701 3300005367 Unclassified 995
15 Ga0070709_10000171 3300005434 Bacteria 40897
16 Ga0070714_100483468 3300005435 Bacteria 1179
17 Ga0070713_100000029 3300005436 Bacteria 90705
18 Ga0070713_100479194 3300005436 Unclassified 1172
19 Ga0070710_10028538 3300005437 Unclassified 2986
20 Ga0070701_10286214 3300005438 Unclassified 1008
21 Ga0070711_100345973 3300005439 Bacteria 1194
22 Ga0070708_100002495 3300005445 Bacteria 14200
23 Ga0070708_100214378 3300005445 Bacteria 1804
24 Ga0070663_101917202 3300005455 Bacteria 532
25 Ga0070678_100210209 3300005456 Unclassified 1612
26 Ga0070678_101434991 3300005456 Unclassified 645
27 Ga0070681_10030756 3300005458 Bacteria 5388
28 Ga0068867_100192564 3300005459 Unclassified 1628
29 Ga0068867_100738254 3300005459 Bacteria 872
30 Ga0070685_10158658 3300005466 Unclassified 1440
31 Ga0070679_100017605 3300005530 Bacteria 6917
32 Ga0070679_101969560 3300005530 Unclassified 533
33 Ga0070684_100014105 3300005535 Bacteria 6462
34 Ga0070684_100035864 3300005535 Bacteria 4248
35 Ga0070684_101553188 3300005535 Bacteria 624
36 Ga0068853_100327483 3300005539 Unclassified 1421
37 Ga0068853_101993856 3300005539 Bacteria 563
38 Ga0070672_100652844 3300005543 Unclassified 919
39 Ga0070686_101057957 3300005544 Unclassified 668
40 Ga0070693_100427601 3300005547 Unclassified 924
41 Ga0070665_100041728 3300005548 Bacteria 4613
42 Ga0070665_100439887 3300005548 Bacteria 1313
43 Ga0070665_100613729 3300005548 Bacteria 1101
44 Ga0070665_102130687 3300005548 Unclassified 565
45 Ga0068855_100084035 3300005563 Bacteria 3687
46 Ga0068855_100141276 3300005563 Bacteria 2744
47 Ga0068855_100174205 3300005563 Bacteria 2435
48 Ga0068855_101624125 3300005563 Unclassified 661
49 Ga0070664_100259303 3300005564 Bacteria 1564
50 Ga0068857_100003377 3300005577 Bacteria 13286
51 Ga0068857_100093101 3300005577 Bacteria 2699
52 Ga0068856_100010044 3300005614 Bacteria 9195
53 Ga0068856_100084953 3300005614 Unclassified 3144
54 Ga0068856_100092029 3300005614 Bacteria 3017
55 Ga0068852_100038551 3300005616 Unclassified 4017
56 Ga0068852_100125321 3300005616 Unclassified 2358
57 Ga0068851_10083148 3300005834 Bacteria 1675
58 Ga0068851_10356423 3300005834 Unclassified 852
59 Ga0068863_100085670 3300005841 Bacteria 2985
60 Ga0068860_100205641 3300005843 Unclassified 1909
61 Ga0068860_100515925 3300005843 Bacteria 1195
62 Ga0070717_10179993 3300006028 Unclassified 1842
63 Ga0070715_10014444 3300006163 Bacteria 2926
64 Ga0070716_100106109 3300006173 Unclassified 1732
65 Ga0070712_100002276 3300006175 Bacteria 11821
66 Ga0097621_100237407 3300006237 Unclassified 1593
67 Ga0068871_100044366 3300006358 Bacteria 3576
68 Ga0068871_100162706 3300006358 Bacteria 1909
69 Ga0075428_100095949 3300006844 Bacteria 3232
70 Ga0075430_100007135 3300006846 Bacteria 9426
71 Ga0075431_100189058 3300006847 Bacteria 2110
72 Ga0075434_100212332 3300006871 Bacteria 1955
73 Ga0075429_100001848 3300006880 Bacteria 17536
74 Ga0068865_100149255 3300006881 Unclassified 1772
75 Ga0068865_100363784 3300006881 Bacteria 1175
76 Ga0068865_100737222 3300006881 Bacteria 845
77 Ga0075436_100582283 3300006914 Unclassified 823
78 Ga0105240_10014099 3300009093 Bacteria 10923
79 Ga0105240_10115260 3300009093 Unclassified 3244
80 Ga0105240_11229387 3300009093 Unclassified 792
81 Ga0111539_10487895 3300009094 Bacteria 1435
82 Ga0105245_10007878 3300009098 Bacteria 9318
83 Ga0105245_10180989 3300009098 Bacteria 2014
84 Ga0114129_10004116 3300009147 Bacteria 20548
85 Ga0105243_10338796 3300009148 Unclassified 1377
86 Ga0105241_10125462 3300009174 Unclassified 2072
87 Ga0105241_10471248 3300009174 Bacteria 1114
88 Ga0105242_10003524 3300009176 Bacteria 12168
89 Ga0105242_10833608 3300009176 Unclassified 916
90 Ga0105242_11577458 3300009176 Unclassified 689
91 Ga0105248_10036958 3300009177 Bacteria 5462
92 Ga0105248_10117758 3300009177 Unclassified 2996
93 Ga0105248_11114974 3300009177 Unclassified 892
94 Ga0105238_10029260 3300009551 Bacteria 5612
95 Ga0105238_10079624 3300009551 Bacteria 3266
96 Ga0105238_10144444 3300009551 Bacteria 2356
97 Ga0105238_10567105 3300009551 Bacteria 1141
98 Ga0105238_11185229 3300009551 Unclassified 788
99 Ga0105239_10176021 3300010375 Unclassified 2393
100 Ga0157369_10041313 3300013105 Bacteria 5035
101 Ga0157369_10048758 3300013105 Unclassified 4594
102 Ga0157369_10055122 3300013105 Unclassified 4291
103 Ga0157369_10548089 3300013105 Unclassified 1195
104 Ga0157369_10891295 3300013105 Bacteria 912
105 Ga0157374_10112907 3300013296 Bacteria 2615
106 Ga0157374_10182200 3300013296 Unclassified 2052
107 Ga0157374_11386393 3300013296 Bacteria 726
108 Ga0157378_10283804 3300013297 Unclassified 1597
109 Ga0157378_10363123 3300013297 Unclassified 1417
110 Ga0157378_10747323 3300013297 Unclassified 1001
111 Ga0163162_10522514 3300013306 Unclassified 1316
112 Ga0157372_10008564 3300013307 Bacteria 10865
113 Ga0157372_10105842 3300013307 Bacteria 3217
114 Ga0157372_10483142 3300013307 Bacteria 1444
115 Ga0157375_10512476 3300013308 Unclassified 1363
116 Ga0157375_10782006 3300013308 Unclassified 1104
117 Ga0163163_12590710 3300014325 Bacteria 565
118 Ga0157379_10039833 3300014968 Bacteria 4193
119 Ga0224569_102042 3300022732 Bacteria 1667
120 Ga0224572_1000116 3300024225 Bacteria 6339
121 Ga0228598_1005346 3300024227 Bacteria 2684
122 Ga0228598_1070044 3300024227 Unclassified 701
123 Ga0207656_10039442 3300025321 Bacteria 1997
124 Ga0207656_10074273 3300025321 Bacteria 1517
125 Ga0207692_10092022 3300025898 Bacteria 1647
126 Ga0207680_10054440 3300025903 Unclassified 2407
127 Ga0207680_10424737 3300025903 Unclassified 941
128 Ga0207685_10166696 3300025905 Bacteria 1010
129 Ga0207699_10000491 3300025906 Bacteria 19853
130 Ga0207645_10081046 3300025907 Unclassified 2080
131 Ga0207643_10295615 3300025908 Bacteria 1007
132 Ga0207705_10643645 3300025909 Bacteria 824
133 Ga0207654_10083657 3300025911 Bacteria 1927
134 Ga0207654_10111443 3300025911 Unclassified 1703
135 Ga0207707_10025882 3300025912 Bacteria 5131
136 Ga0207695_10040618 3300025913 Bacteria 4985
137 Ga0207695_10451517 3300025913 Bacteria 1168
138 Ga0207693_10000031 3300025915 Bacteria 117500
139 Ga0207663_10162988 3300025916 Bacteria 1576
140 Ga0207660_10188122 3300025917 Bacteria 1606
141 Ga0207649_10113527 3300025920 Bacteria 1815
142 Ga0207694_10054241 3300025924 Bacteria 3110
143 Ga0207694_10399508 3300025924 Bacteria 1143
144 Ga0207694_10528090 3300025924 Unclassified 989
145 Ga0207694_11036183 3300025924 Unclassified 694
146 Ga0207687_10007828 3300025927 Bacteria 7006
147 Ga0207687_11694881 3300025927 Unclassified 542
148 Ga0207700_10000160 3300025928 Bacteria 40173
149 Ga0207664_10070804 3300025929 Bacteria 2807
150 Ga0207664_10427070 3300025929 Bacteria 1181
151 Ga0207644_11143325 3300025931 Bacteria 654
152 Ga0207686_10007119 3300025934 Bacteria 6017
153 Ga0207686_10016364 3300025934 Unclassified 4163
154 Ga0207686_10143939 3300025934 Bacteria 1651
155 Ga0207686_10308762 3300025934 Unclassified 1177
156 Ga0207709_11132057 3300025935 Unclassified 643
157 Ga0207704_10005952 3300025938 Bacteria 5654
158 Ga0207704_10010406 3300025938 Bacteria 4537
159 Ga0207665_10189584 3300025939 Bacteria 1493
160 Ga0207711_10166813 3300025941 Bacteria 1996
161 Ga0207711_11393778 3300025941 Unclassified 643
162 Ga0207661_10010590 3300025944 Bacteria 6642
163 Ga0207661_10015735 3300025944 Bacteria 5572
164 Ga0207661_10404419 3300025944 Bacteria 1238
165 Ga0207679_10610442 3300025945 Bacteria 984
166 Ga0207667_10016817 3300025949 Bacteria 8251
167 Ga0207667_10350721 3300025949 Bacteria 1505
168 Ga0207651_10853528 3300025960 Unclassified 809
169 Ga0207658_11567210 3300025986 Unclassified 602
170 Ga0207677_10042416 3300026023 Bacteria 3016
171 Ga0207703_10416880 3300026035 Unclassified 1249
172 Ga0207703_12374285 3300026035 Unclassified 506
173 Ga0207639_10033726 3300026041 Bacteria 3779
174 Ga0207702_10018416 3300026078 Bacteria 5777
175 Ga0207702_10229896 3300026078 Unclassified 1733
176 Ga0207702_11072828 3300026078 Unclassified 799
177 Ga0207641_10133139 3300026088 Unclassified 2235
178 Ga0207648_10022393 3300026089 Bacteria 5675
179 Ga0207674_10000311 3300026116 Bacteria 61841
180 Ga0207674_10104122 3300026116 Bacteria 2817
181 Ga0207683_10093541 3300026121 Bacteria 2679
182 Ga0207683_11372373 3300026121 Unclassified 654
183 Ga0207698_10012024 3300026142 Bacteria 5642
184 Ga0207698_10494985 3300026142 Unclassified 1188
185 Ga0265356_1000129 3300028017 Bacteria 13155
186 Ga0265356_1041627 3300028017 Unclassified 506
187 Ga0268266_10010051 3300028379 Bacteria 8297
188 Ga0268264_10175707 3300028381 Unclassified 1941
189 Ga0268264_10228357 3300028381 Bacteria 1717
190 Ga0307517_10277225 3300028786 Bacteria 959
191 Ga0265338_10976039 3300028800 Unclassified 574
192 Ga0265762_1001668 3300030760 Bacteria 4046
193 Ga0265760_10000136 3300031090 Bacteria 18480
194 Ga0265760_10002412 3300031090 Bacteria 5457
195 Ga0265760_10003400 3300031090 Bacteria 4629
196 Ga0265316_10444693 3300031344 Bacteria 930
197 Ga0265316_11026088 3300031344 Unclassified 573
198 Ga0265342_10450790 3300031712 Unclassified 660
199 Ga0307516_10015381 3300031730 Bacteria 8052
200 Ga0307516_10297923 3300031730 Bacteria 1289
201 Ga0307405_11898114 3300031731 Unclassified 531
202 Ga0307406_10440241 3300031901 Bacteria 1043
203 Ga0307416_100763396 3300032002 Unclassified 1060
204 Ga0307415_100024206 3300032126 Bacteria 3787
205 Ga0373956_0348394 3300035119 Bacteria 706
206 Ga0395899_0843829 3300037312 Unclassified 563
207 Ga0395900_0042731 3300037418 Bacteria 4670
208 Ga0395898_1028958 3300037466 Unclassified 759
209 Ga0436364_0431139 3300037853 Bacteria 846
210 Ga0395901_0352401 3300038443 Bacteria 1519
211 Ga0395901_0374556 3300038443 Unclassified 1466
212 Ga0451798_0961618 3300041458 Unclassified 794
213 Ga0451853_1197326 3300041512 Bacteria 544
214 Ga0466963_0793030 3300044694 Unclassified 668
215 Ga0466964_0068644 3300044706 Bacteria 1493
216 Ga0466971_0478579 3300044719 Unclassified 613
217 Ga0466957_0363288 3300044842 Bacteria 984
218 Ga0466967_0334333 3300045976 Bacteria 1463
219 Ga0466967_1778852 3300045976 Bacteria 613
220 Ga0495640_0676186 3300046533 Unclassified 620
221 Ga0495587_0661449 3300046536 Unclassified 574
222 Ga0495604_0664621 3300047317 Bacteria 664
223 Ga0496100_0088628 3300048903 Unclassified 2106
224 Ga0496101_0000613 3300048904 Bacteria 21795
225 Ga0496102_0266354 3300048905 Unclassified 1616
226 Ga0496104_0149064 3300048907 Unclassified 2246
227 Ga0496104_0644766 3300048907 Unclassified 968
228 Ga0496104_0783621 3300048907 Unclassified 860
229 Ga0496105_0229972 3300048908 Bacteria 1507
230 Ga0496105_1188186 3300048908 Bacteria 562
231 Ga0496106_0212216 3300048909 Unclassified 1542
232 Ga0496107_0366102 3300048910 Unclassified 1072
233 Ga0496114_0012074 3300048917 Bacteria 6912
234 Ga0496115_0109813 3300048918 Unclassified 2265
235 Ga0501033_0123772 3300049570 Bacteria 1875
236 Ga0501223_109494 3300049663 Unclassified 576
237 Ga0501080_0623385 3300049742 Bacteria 956
238 Ga0501035_0188368 3300049822 Bacteria 1775
239 Ga0501035_0393475 3300049822 Bacteria 1154
240 Ga0501044_0005813 3300049823 Bacteria 13666
241 Ga0501044_0106831 3300049823 Bacteria 2811
242 nmdc:mga05p37_474072_c1 3300050507 Bacteria 1443
243 nmdc:mga05p37_9432_c1 3300050507 Bacteria 11555
244 nmdc:mga09592_1558_c1 3300050508 Bacteria 18449
245 nmdc:mga06r32_7038_c1 3300050510 Bacteria 10120
246 nmdc:mga0rr50_1695493_c1 3300050513 Bacteria 533
247 nmdc:mga08x19_13540_c1 3300050514 Unclassified 4932
248 Ga0500619_003512 3300053154 Bacteria 3225
249 Ga0466962_0550456 3300061719 Unclassified 586
250 Ga0157370_10616153
251 Ga0070658_11341493
252 Ga0070658_11475925
253 Ga0070676_10143944
254 Ga0070683_100381852
255 Ga0070690_100095740
256 Ga0070666_10041329
257 Ga0070666_10722737
258 Ga0070682_100934870
259 Ga0068868_100076513
260 Ga0070673_101297259
261 Ga0070673_101937780
262 Ga0070659_101492894
263 Ga0070667_100622701
264 Ga0070709_10000171
265 Ga0070714_100483468
266 Ga0070713_100000029
267 Ga0070713_100479194
268 Ga0070710_10028538
269 Ga0070701_10286214
270 Ga0070711_100345973
271 Ga0070708_100002495
272 Ga0070708_100214378
273 Ga0070663_101917202
274 Ga0070678_100210209
275 Ga0070678_101434991
276 Ga0070681_10030756
277 Ga0068867_100192564
278 Ga0068867_100738254
279 Ga0070685_10158658
280 Ga0070679_100017605
281 Ga0070679_101969560
282 Ga0070684_100014105
283 Ga0070684_100035864
284 Ga0070684_101553188
285 Ga0068853_100327483
286 Ga0068853_101993856
287 Ga0070672_100652844
288 Ga0070686_101057957
289 Ga0070693_100427601
290 Ga0070665_100041728
291 Ga0070665_100439887
292 Ga0070665_100613729
293 Ga0070665_102130687
294 Ga0068855_100084035
295 Ga0068855_100141276
296 Ga0068855_100174205
297 Ga0068855_101624125
298 Ga0070664_100259303
299 Ga0068857_100003377
300 Ga0068857_100093101
301 Ga0068856_100010044
302 Ga0068856_100084953
303 Ga0068856_100092029
304 Ga0068852_100038551
305 Ga0068852_100125321
306 Ga0068851_10083148
307 Ga0068851_10356423
308 Ga0068863_100085670
309 Ga0068860_100205641
310 Ga0068860_100515925
311 Ga0070717_10179993
312 Ga0070715_10014444
313 Ga0070716_100106109
314 Ga0070712_100002276
315 Ga0097621_100237407
316 Ga0068871_100044366
317 Ga0068871_100162706
318 Ga0075428_100095949
319 Ga0075430_100007135
320 Ga0075431_100189058
321 Ga0075434_100212332
322 Ga0075429_100001848
323 Ga0068865_100149255
324 Ga0068865_100363784
325 Ga0068865_100737222
326 Ga0075436_100582283
327 Ga0105240_10014099
328 Ga0105240_10115260
329 Ga0105240_11229387
330 Ga0111539_10487895
331 Ga0105245_10007878
332 Ga0105245_10180989
333 Ga0114129_10004116
334 Ga0105243_10338796
335 Ga0105241_10125462
336 Ga0105241_10471248
337 Ga0105242_10003524
338 Ga0105242_10833608
339 Ga0105242_11577458
340 Ga0105248_10036958
341 Ga0105248_10117758
342 Ga0105248_11114974
343 Ga0105238_10029260
344 Ga0105238_10079624
345 Ga0105238_10144444
346 Ga0105238_10567105
347 Ga0105238_11185229
348 Ga0105239_10176021
349 Ga0157369_10041313
350 Ga0157369_10048758
351 Ga0157369_10055122
352 Ga0157369_10548089
353 Ga0157369_10891295
354 Ga0157374_10112907
355 Ga0157374_10182200
356 Ga0157374_11386393
357 Ga0157378_10283804
358 Ga0157378_10363123
359 Ga0157378_10747323
360 Ga0163162_10522514
361 Ga0157372_10008564
362 Ga0157372_10105842
363 Ga0157372_10483142
364 Ga0157375_10512476
365 Ga0157375_10782006
366 Ga0163163_12590710
367 Ga0157379_10039833
368 Ga0224569_102042
369 Ga0224572_1000116
370 Ga0228598_1005346
371 Ga0228598_1070044
372 Ga0207656_10039442
373 Ga0207656_10074273
374 Ga0207692_10092022
375 Ga0207680_10054440
376 Ga0207680_10424737
377 Ga0207685_10166696
378 Ga0207699_10000491
379 Ga0207645_10081046
380 Ga0207643_10295615
381 Ga0207705_10643645
382 Ga0207654_10083657
383 Ga0207654_10111443
384 Ga0207707_10025882
385 Ga0207695_10040618
386 Ga0207695_10451517
387 Ga0207693_10000031
388 Ga0207663_10162988
389 Ga0207660_10188122
390 Ga0207649_10113527
391 Ga0207694_10054241
392 Ga0207694_10399508
393 Ga0207694_10528090
394 Ga0207694_11036183
395 Ga0207687_10007828
396 Ga0207687_11694881
397 Ga0207700_10000160
398 Ga0207664_10070804
399 Ga0207664_10427070
400 Ga0207644_11143325
401 Ga0207686_10007119
402 Ga0207686_10016364
403 Ga0207686_10143939
404 Ga0207686_10308762
405 Ga0207709_11132057
406 Ga0207704_10005952
407 Ga0207704_10010406
408 Ga0207665_10189584
409 Ga0207711_10166813
410 Ga0207711_11393778
411 Ga0207661_10010590
412 Ga0207661_10015735
413 Ga0207661_10404419
414 Ga0207679_10610442
415 Ga0207667_10016817
416 Ga0207667_10350721
417 Ga0207651_10853528
418 Ga0207658_11567210
419 Ga0207677_10042416
420 Ga0207703_10416880
421 Ga0207703_12374285
422 Ga0207639_10033726
423 Ga0207702_10018416
424 Ga0207702_10229896
425 Ga0207702_11072828
426 Ga0207641_10133139
427 Ga0207648_10022393
428 Ga0207674_10000311
429 Ga0207674_10104122
430 Ga0207683_10093541
431 Ga0207683_11372373
432 Ga0207698_10012024
433 Ga0207698_10494985
434 Ga0265356_1000129
435 Ga0265356_1041627
436 Ga0268266_10010051
437 Ga0268264_10175707
438 Ga0268264_10228357
439 Ga0307517_10277225
440 Ga0265338_10976039
441 Ga0265762_1001668
442 Ga0265760_10000136
443 Ga0265760_10002412
444 Ga0265760_10003400
445 Ga0265316_10444693
446 Ga0265316_11026088
447 Ga0265342_10450790
448 Ga0307516_10015381
449 Ga0307516_10297923
450 Ga0307405_11898114
451 Ga0307406_10440241
452 Ga0307416_100763396
453 Ga0307415_100024206
454 Ga0373956_0348394
455 Ga0395899_0843829
456 Ga0395900_0042731
457 Ga0395898_1028958
458 Ga0436364_0431139
459 Ga0395901_0352401
460 Ga0395901_0374556
461 Ga0451798_0961618
462 Ga0451853_1197326
463 Ga0466963_0793030
464 Ga0466964_0068644
465 Ga0466971_0478579
466 Ga0466957_0363288
467 Ga0466967_0334333
468 Ga0466967_1778852
469 Ga0495640_0676186
470 Ga0495587_0661449
471 Ga0495604_0664621
472 Ga0496100_0088628
473 Ga0496101_0000613
474 Ga0496102_0266354
475 Ga0496104_0149064
476 Ga0496104_0644766
477 Ga0496104_0783621
478 Ga0496105_0229972
479 Ga0496105_1188186
480 Ga0496106_0212216
481 Ga0496107_0366102
482 Ga0496114_0012074
483 Ga0496115_0109813
484 Ga0501033_0123772
485 Ga0501223_109494
486 Ga0501080_0623385
487 Ga0501035_0188368
488 Ga0501035_0393475
489 Ga0501044_0005813
490 Ga0501044_0106831
491 nmdc:mga05p37_474072_c1
492 nmdc:mga05p37_9432_c1
493 nmdc:mga09592_1558_c1
494 nmdc:mga06r32_7038_c1
495 nmdc:mga0rr50_1695493_c1
496 nmdc:mga08x19_13540_c1
497 Ga0500619_003512
498 Ga0466962_0550456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

22

136

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8885 9 72
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8869 4 70
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8866 9 72
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8845 4 70
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.8662 8 71
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9093 6 69 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8893 7 70 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8885 9 72 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8885 7 70 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8866 9 72 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C2JAI3-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9318 5 127 GO:0003677
GO:0045892
AF-A0A2V9LQU5-F1-model_v4 Transcriptional regulator 0.9307 1 122 GO:0003677
GO:0045892
AF-A0A3D5P045-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.922 2 83 GO:0003677
GO:0045892
AF-A0A3N5L3E6-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9211 1 128 GO:0003677
GO:0045892
AF-A0A4Q1SAI5-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.913 15 126 GO:0003677
GO:0045892

Map