F360622

General Info

Members Datasets Scaffolds Average Seq Length
249 193 498 184

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10038995|Ga0081539_100389953
Length 213
Sequence MIDHLKDRWERVWRKLGVHQIPRNVFEELIRAYSSADRFYHNLAHVEDCLSMFDQTKFLTSHPEEVELAIWFHDAVYDTRRSDNEQESAAWAESVIVQAGLDRVIAERVSESILATRHHTEVSGKDAQLMVDVDLSILGREADVFWRYEENIRKEYAWVPENVFRQRRIEILRSFLDREHIYYDENYREMFEEKARANLKQAITKLLDVTSIT

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
171 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
175 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
176 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
177 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
178 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
179 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
180 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
181 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
182 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
183 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
184 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
185 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
186 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
187 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
188 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
189 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
190 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
191 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
192 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
193 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 0
Isolates 7.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.45
Nodule 4.82
Rhizoplane 5.22
Rhizosphere 65.06
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10038995 3300005985 Unclassified 2809
2 rootH2_10020146 3300003320 Bacteria 2409
3 rootH2_10068662 3300003320 Bacteria 1521
4 rootH2_10094682 3300003320 Bacteria 4205
5 rootL2_10034438 3300003322 Bacteria 2761
6 rootH1_10160234 3300003323 Bacteria 2955
7 rootH1_10217155 3300003323 Bacteria 1202
8 JGI25404J52841_10057336 3300003659 Bacteria 817
9 Ga0055539_1003212 3300003752 Bacteria 2318
10 Ga0055529_1012397 3300003763 Bacteria 1091
11 Ga0070676_10678149 3300005328 Bacteria 751
12 Ga0070690_100338657 3300005330 Bacteria 1089
13 Ga0070670_100110296 3300005331 Bacteria 2371
14 Ga0068869_100125797 3300005334 Bacteria 1965
15 Ga0068869_100152601 3300005334 Bacteria 1792
16 Ga0070666_10949304 3300005335 Bacteria 637
17 Ga0070680_100503851 3300005336 Bacteria 1036
18 Ga0070689_100235358 3300005340 Bacteria 1507
19 Ga0070661_100500953 3300005344 Bacteria 972
20 Ga0070668_100038259 3300005347 Bacteria 3666
21 Ga0070668_100045408 3300005347 Bacteria 3370
22 Ga0070668_100107116 3300005347 Bacteria 2222
23 Ga0070671_100206278 3300005355 Bacteria 1667
24 Ga0070673_100140640 3300005364 Bacteria 2035
25 Ga0070673_100424263 3300005364 Bacteria 1193
26 Ga0070667_100312937 3300005367 Bacteria 1416
27 Ga0070663_100045122 3300005455 Bacteria 3112
28 Ga0070663_100221547 3300005455 Bacteria 1485
29 Ga0070678_100291082 3300005456 Bacteria 1384
30 Ga0070681_10200906 3300005458 Bacteria 1911
31 Ga0068867_100234626 3300005459 Bacteria 1485
32 Ga0070685_10558233 3300005466 Bacteria 818
33 Ga0070707_100074295 3300005468 Bacteria 3278
34 Ga0070698_100019673 3300005471 Bacteria 7082
35 Ga0068853_101390958 3300005539 Bacteria 679
36 Ga0070665_100036014 3300005548 Bacteria 4979
37 Ga0070665_100073367 3300005548 Bacteria 3428
38 Ga0068855_100067805 3300005563 Bacteria 4155
39 Ga0070664_100054305 3300005564 Bacteria 3398
40 Ga0068857_100280097 3300005577 Bacteria 1534
41 Ga0068856_101239213 3300005614 Bacteria 762
42 Ga0068852_100266555 3300005616 Bacteria 1647
43 Ga0068852_100884683 3300005616 Bacteria 910
44 Ga0068859_100048895 3300005617 Bacteria 4248
45 Ga0068859_100141462 3300005617 Bacteria 2480
46 Ga0068866_10085395 3300005718 Bacteria 1706
47 Ga0068861_100073048 3300005719 Bacteria 2663
48 Ga0068861_100181218 3300005719 Bacteria 1754
49 Ga0068863_100073813 3300005841 Bacteria 3227
50 Ga0068858_100035695 3300005842 Bacteria 4610
51 Ga0068858_100111546 3300005842 Bacteria 2554
52 Ga0068860_100141254 3300005843 Bacteria 2314
53 Ga0068860_100524372 3300005843 Bacteria 1185
54 Ga0068862_100145464 3300005844 Bacteria 2106
55 Ga0081455_10038301 3300005937 Bacteria 4246
56 Ga0081455_10327052 3300005937 Bacteria 1089
57 Ga0081540_1006770 3300005983 Bacteria 8287
58 Ga0081540_1037838 3300005983 Bacteria 2552
59 Ga0075363_100122118 3300006048 Bacteria 1455
60 Ga0075363_100482340 3300006048 Bacteria 735
61 Ga0075364_10097811 3300006051 Bacteria 1952
62 Ga0075432_10334369 3300006058 Bacteria 638
63 Ga0075367_10243001 3300006178 Bacteria 1128
64 Ga0075369_10113485 3300006186 Bacteria 1222
65 Ga0075366_10087329 3300006195 Bacteria 1866
66 Ga0097621_100061594 3300006237 Bacteria 3078
67 Ga0097621_100444754 3300006237 Bacteria 1167
68 Ga0068871_100258782 3300006358 Bacteria 1518
69 Ga0097620_100048895 3300006931 Bacteria 4248
70 Ga0097620_100141459 3300006931 Bacteria 2480
71 Ga0099795_10019748 3300007788 Bacteria 2185
72 Ga0105240_10734612 3300009093 Bacteria 1074
73 Ga0105247_10051177 3300009101 Bacteria 2543
74 Ga0105241_10020943 3300009174 Bacteria 4833
75 Ga0105241_10279975 3300009174 Bacteria 1424
76 Ga0105241_10588794 3300009174 Bacteria 1003
77 Ga0105242_10678515 3300009176 Bacteria 1005
78 Ga0105248_10059889 3300009177 Bacteria 4276
79 Ga0105248_10214051 3300009177 Bacteria 2171
80 Ga0105237_10054821 3300009545 Bacteria 3994
81 Ga0105238_10061254 3300009551 Bacteria 3766
82 Ga0105239_10193579 3300010375 Bacteria 2276
83 Ga0105239_10273237 3300010375 Bacteria 1901
84 Ga0105239_10471106 3300010375 Bacteria 1426
85 Ga0157374_10129962 3300013296 Bacteria 2437
86 Ga0157378_10325728 3300013297 Bacteria 1494
87 Ga0163162_10769664 3300013306 Bacteria 1081
88 Ga0157375_10094105 3300013308 Bacteria 3064
89 Ga0157375_11232075 3300013308 Bacteria 878
90 Ga0163163_10871044 3300014325 Bacteria 964
91 Ga0157379_10430493 3300014968 Bacteria 1216
92 Ga0157376_10109383 3300014969 Bacteria 2430
93 Ga0163161_10308335 3300017792 Bacteria 1248
94 Ga0209677_102878 3300025253 Bacteria 6043
95 Ga0209148_1000253 3300025254 Bacteria 84643
96 Ga0209233_1015036 3300025261 Bacteria 2167
97 Ga0209233_1024739 3300025261 Bacteria 1496
98 Ga0209455_1001670 3300025272 Bacteria 9565
99 Ga0209758_1035491 3300025297 Bacteria 1965
100 Ga0207697_10034977 3300025315 Bacteria 2056
101 Ga0207710_10019712 3300025900 Bacteria 2879
102 Ga0207680_10071688 3300025903 Bacteria 2148
103 Ga0207680_10200674 3300025903 Bacteria 1359
104 Ga0207645_10202774 3300025907 Bacteria 1305
105 Ga0207654_10038930 3300025911 Bacteria 2671
106 Ga0207654_10190695 3300025911 Bacteria 1343
107 Ga0207654_10220695 3300025911 Bacteria 1257
108 Ga0207695_10000634 3300025913 Bacteria 70325
109 Ga0207695_10494681 3300025913 Bacteria 1105
110 Ga0207671_10011863 3300025914 Bacteria 7053
111 Ga0207649_10248095 3300025920 Bacteria 1281
112 Ga0207694_10219091 3300025924 Bacteria 1552
113 Ga0207687_10052710 3300025927 Bacteria 2840
114 Ga0207690_10443217 3300025932 Bacteria 1042
115 Ga0207706_10540446 3300025933 Bacteria 1004
116 Ga0207686_10235822 3300025934 Bacteria 1329
117 Ga0207709_10072687 3300025935 Bacteria 2188
118 Ga0207669_10541578 3300025937 Bacteria 938
119 Ga0207691_10397619 3300025940 Bacteria 1175
120 Ga0207689_10089090 3300025942 Bacteria 2534
121 Ga0207679_10361660 3300025945 Bacteria 1268
122 Ga0207667_10022616 3300025949 Bacteria 6939
123 Ga0207668_10052856 3300025972 Bacteria 2812
124 Ga0207668_10169567 3300025972 Bacteria 1710
125 Ga0207658_10219291 3300025986 Bacteria 1599
126 Ga0207658_10481991 3300025986 Bacteria 1102
127 Ga0207677_10469168 3300026023 Bacteria 1082
128 Ga0207703_10030186 3300026035 Bacteria 4282
129 Ga0207703_10093373 3300026035 Bacteria 2534
130 Ga0207678_10095290 3300026067 Bacteria 2543
131 Ga0207678_10282133 3300026067 Bacteria 1426
132 Ga0207702_10333698 3300026078 Bacteria 1447
133 Ga0207641_10227431 3300026088 Bacteria 1732
134 Ga0207674_10051668 3300026116 Bacteria 4194
135 Ga0207675_100049166 3300026118 Bacteria 3936
136 Ga0207675_100059277 3300026118 Bacteria 3572
137 Ga0207675_100219451 3300026118 Bacteria 1832
138 Ga0207683_10294173 3300026121 Bacteria 1485
139 Ga0207698_10235886 3300026142 Bacteria 1664
140 Ga0207698_10734144 3300026142 Bacteria 985
141 Ga0268266_10000446 3300028379 Bacteria 61283
142 Ga0268266_10026030 3300028379 Bacteria 4976
143 Ga0268266_10056880 3300028379 Bacteria 3364
144 Ga0268265_10234427 3300028380 Bacteria 1615
145 Ga0268264_10044665 3300028381 Bacteria 3676
146 Ga0268264_10754655 3300028381 Bacteria 969
147 Ga0307408_100784856 3300031548 Bacteria 863
148 Ga0307409_101268091 3300031995 Bacteria 761
149 Ga0307416_101017905 3300032002 Bacteria 932
150 Ga0307415_100446077 3300032126 Bacteria 1117
151 Ga0373943_0801447 3300035170 Bacteria 561
152 Ga0436363_0490344 3300039450 Bacteria 1325
153 Ga0451802_2000517 3300041460 Bacteria 1252
154 Ga0451853_3289778 3300041512 Bacteria 724
155 Ga0466967_0029586 3300045976 Bacteria 4586
156 Ga0495653_0301352 3300046463 Bacteria 1045
157 Ga0495606_0291337 3300046507 Bacteria 888
158 Ga0495616_0209458 3300046513 Bacteria 853
159 Ga0495648_0075399 3300046524 Bacteria 1940
160 Ga0495663_0036197 3300046525 Bacteria 1485
161 Ga0495652_0139277 3300046529 Bacteria 1910
162 Ga0495622_0051943 3300046557 Bacteria 1901
163 Ga0495668_0418909 3300046616 Bacteria 736
164 Ga0495634_0671278 3300046642 Bacteria 597
165 Ga0495625_0097748 3300046660 Bacteria 2020
166 Ga0495635_0011391 3300046663 Bacteria 6237
167 Ga0495657_0075628 3300046675 Bacteria 2189
168 Ga0495646_0285978 3300046680 Bacteria 875
169 Ga0495624_0066206 3300046690 Bacteria 2256
170 Ga0495624_0399948 3300046690 Bacteria 825
171 Ga0495649_0057761 3300046694 Bacteria 2092
172 Ga0495600_0079739 3300046809 Bacteria 2137
173 Ga0495604_0086569 3300047317 Bacteria 2335
174 Ga0495683_0054720 3300047323 Bacteria 1988
175 Ga0495675_0375192 3300047444 Bacteria 833
176 Ga0495686_0062854 3300047472 Bacteria 2302
177 Ga0495602_0093363 3300048088 Bacteria 2490
178 Ga0496100_0637158 3300048903 Bacteria 829
179 Ga0496100_0765621 3300048903 Bacteria 755
180 Ga0496101_0188292 3300048904 Bacteria 1592
181 Ga0496102_0760758 3300048905 Bacteria 891
182 Ga0496104_0748881 3300048907 Bacteria 884
183 Ga0496108_0334199 3300048911 Bacteria 1321
184 Ga0496109_0255485 3300048912 Bacteria 1650
185 Ga0496109_0933858 3300048912 Bacteria 805
186 Ga0496110_0712045 3300048913 Bacteria 906
187 Ga0496112_0108211 3300048915 Bacteria 2750
188 Ga0496114_0698815 3300048917 Bacteria 889
189 Ga0496115_0059689 3300048918 Bacteria 3072
190 Ga0496117_0171643 3300048920 Bacteria 1258
191 Ga0496118_0010571 3300048921 Bacteria 9121
192 Ga0496119_0012629 3300048922 Bacteria 6837
193 Ga0496119_0053923 3300048922 Bacteria 2452
194 Ga0496119_0252365 3300048922 Bacteria 889
195 Ga0496120_0037894 3300048923 Bacteria 2857
196 Ga0496121_0059965 3300048924 Bacteria 3134
197 Ga0496121_0063919 3300048924 Bacteria 3003
198 Ga0496121_0130266 3300048924 Bacteria 1884
199 Ga0496122_0251554 3300048925 Bacteria 988
200 Ga0496125_0104912 3300048928 Bacteria 2068
201 Ga0496125_0300217 3300048928 Bacteria 984
202 Ga0496126_0003373 3300048929 Bacteria 20236
203 Ga0496126_0104432 3300048929 Bacteria 2475
204 Ga0496126_0111753 3300048929 Bacteria 2379
205 Ga0496126_0236334 3300048929 Bacteria 1529
206 Ga0496126_0246750 3300048929 Bacteria 1489
207 Ga0495678_123485 3300049459 Bacteria 867
208 Ga0495682_0022447 3300049460 Bacteria 2360
209 Ga0501039_0248842 3300049575 Unclassified 1398
210 Ga0501069_0484912 3300049585 Bacteria 737
211 Ga0501076_0615420 3300049592 Unclassified 896
212 nmdc:mga03n38_177383_c1 3300050490 Bacteria 1089
213 nmdc:mga00v17_247118_c1 3300050491 Bacteria 1157
214 nmdc:mga06z11_283010_c1 3300050494 Bacteria 983
215 nmdc:mga07m45_42162_c1 3300050496 Bacteria 2558
216 nmdc:mga0qj67_181689_c1 3300050509 Bacteria 1708
217 nmdc:mga0n895_514450_c1 3300050512 Bacteria 1205
218 nmdc:mga0n895_813504_c1 3300050512 Bacteria 924
219 Ga0500610_0062261 3300053079 Bacteria 1947
220 Ga0500578_0279921 3300053086 Bacteria 995
221 Ga0500651_0129910 3300053093 Bacteria 1524
222 Ga0500566_0003143 3300053094 Bacteria 9866
223 Ga0500572_001467 3300053111 Bacteria 6427
224 Ga0500595_000941 3300053119 Bacteria 16447
225 Ga0500559_0014611 3300053136 Bacteria 3318
226 Ga0500559_0091248 3300053136 Bacteria 1395
227 Ga0500559_0290602 3300053136 Bacteria 768
228 Ga0500568_0001569 3300053139 Bacteria 14452
229 Ga0500638_000054 3300053162 Bacteria 23606
230 Ga0500637_0006042 3300053178 Bacteria 5922
231 Ga0500637_0360386 3300053178 Bacteria 770
232 2723848219 2721755755 Bacteria 8322773
233 2793071903 2791355197 Bacteria 8420563
234 2841943253 2841941048 Bacteria 8688029
235 2841976681 2841974524 Bacteria 8931498
236 2844316849 2844315083 Bacteria 8138177
237 2857512252 2857509624 Bacteria 7472071
238 2874608797 2874604998 Bacteria 7834745
239 2889037268 2889033259 Bacteria 9099371
240 2903755145 2903748898 Bacteria 9972761
241 2906604516 2906602504 Bacteria 8295279
242 2908745126 2908739725 Bacteria 8628932
243 2935884020 2935883170 Bacteria 7964738
244 3005507064 3005506211 Bacteria 6943378
245 3005596480 3005594810 Bacteria 8716512
246 3005719610 3005718088 Bacteria 8283608
247 8006970840 8006964411 Bacteria 8966052
248 8006985268 8006984368 Bacteria 9651211
249 8056675880 8056673599 Bacteria 7871253
250 Ga0081539_10038995
251 rootH2_10020146
252 rootH2_10068662
253 rootH2_10094682
254 rootL2_10034438
255 rootH1_10160234
256 rootH1_10217155
257 JGI25404J52841_10057336
258 Ga0055539_1003212
259 Ga0055529_1012397
260 Ga0070676_10678149
261 Ga0070690_100338657
262 Ga0070670_100110296
263 Ga0068869_100125797
264 Ga0068869_100152601
265 Ga0070666_10949304
266 Ga0070680_100503851
267 Ga0070689_100235358
268 Ga0070661_100500953
269 Ga0070668_100038259
270 Ga0070668_100045408
271 Ga0070668_100107116
272 Ga0070671_100206278
273 Ga0070673_100140640
274 Ga0070673_100424263
275 Ga0070667_100312937
276 Ga0070663_100045122
277 Ga0070663_100221547
278 Ga0070678_100291082
279 Ga0070681_10200906
280 Ga0068867_100234626
281 Ga0070685_10558233
282 Ga0070707_100074295
283 Ga0070698_100019673
284 Ga0068853_101390958
285 Ga0070665_100036014
286 Ga0070665_100073367
287 Ga0068855_100067805
288 Ga0070664_100054305
289 Ga0068857_100280097
290 Ga0068856_101239213
291 Ga0068852_100266555
292 Ga0068852_100884683
293 Ga0068859_100048895
294 Ga0068859_100141462
295 Ga0068866_10085395
296 Ga0068861_100073048
297 Ga0068861_100181218
298 Ga0068863_100073813
299 Ga0068858_100035695
300 Ga0068858_100111546
301 Ga0068860_100141254
302 Ga0068860_100524372
303 Ga0068862_100145464
304 Ga0081455_10038301
305 Ga0081455_10327052
306 Ga0081540_1006770
307 Ga0081540_1037838
308 Ga0075363_100122118
309 Ga0075363_100482340
310 Ga0075364_10097811
311 Ga0075432_10334369
312 Ga0075367_10243001
313 Ga0075369_10113485
314 Ga0075366_10087329
315 Ga0097621_100061594
316 Ga0097621_100444754
317 Ga0068871_100258782
318 Ga0097620_100048895
319 Ga0097620_100141459
320 Ga0099795_10019748
321 Ga0105240_10734612
322 Ga0105247_10051177
323 Ga0105241_10020943
324 Ga0105241_10279975
325 Ga0105241_10588794
326 Ga0105242_10678515
327 Ga0105248_10059889
328 Ga0105248_10214051
329 Ga0105237_10054821
330 Ga0105238_10061254
331 Ga0105239_10193579
332 Ga0105239_10273237
333 Ga0105239_10471106
334 Ga0157374_10129962
335 Ga0157378_10325728
336 Ga0163162_10769664
337 Ga0157375_10094105
338 Ga0157375_11232075
339 Ga0163163_10871044
340 Ga0157379_10430493
341 Ga0157376_10109383
342 Ga0163161_10308335
343 Ga0209677_102878
344 Ga0209148_1000253
345 Ga0209233_1015036
346 Ga0209233_1024739
347 Ga0209455_1001670
348 Ga0209758_1035491
349 Ga0207697_10034977
350 Ga0207710_10019712
351 Ga0207680_10071688
352 Ga0207680_10200674
353 Ga0207645_10202774
354 Ga0207654_10038930
355 Ga0207654_10190695
356 Ga0207654_10220695
357 Ga0207695_10000634
358 Ga0207695_10494681
359 Ga0207671_10011863
360 Ga0207649_10248095
361 Ga0207694_10219091
362 Ga0207687_10052710
363 Ga0207690_10443217
364 Ga0207706_10540446
365 Ga0207686_10235822
366 Ga0207709_10072687
367 Ga0207669_10541578
368 Ga0207691_10397619
369 Ga0207689_10089090
370 Ga0207679_10361660
371 Ga0207667_10022616
372 Ga0207668_10052856
373 Ga0207668_10169567
374 Ga0207658_10219291
375 Ga0207658_10481991
376 Ga0207677_10469168
377 Ga0207703_10030186
378 Ga0207703_10093373
379 Ga0207678_10095290
380 Ga0207678_10282133
381 Ga0207702_10333698
382 Ga0207641_10227431
383 Ga0207674_10051668
384 Ga0207675_100049166
385 Ga0207675_100059277
386 Ga0207675_100219451
387 Ga0207683_10294173
388 Ga0207698_10235886
389 Ga0207698_10734144
390 Ga0268266_10000446
391 Ga0268266_10026030
392 Ga0268266_10056880
393 Ga0268265_10234427
394 Ga0268264_10044665
395 Ga0268264_10754655
396 Ga0307408_100784856
397 Ga0307409_101268091
398 Ga0307416_101017905
399 Ga0307415_100446077
400 Ga0373943_0801447
401 Ga0436363_0490344
402 Ga0451802_2000517
403 Ga0451853_3289778
404 Ga0466967_0029586
405 Ga0495653_0301352
406 Ga0495606_0291337
407 Ga0495616_0209458
408 Ga0495648_0075399
409 Ga0495663_0036197
410 Ga0495652_0139277
411 Ga0495622_0051943
412 Ga0495668_0418909
413 Ga0495634_0671278
414 Ga0495625_0097748
415 Ga0495635_0011391
416 Ga0495657_0075628
417 Ga0495646_0285978
418 Ga0495624_0066206
419 Ga0495624_0399948
420 Ga0495649_0057761
421 Ga0495600_0079739
422 Ga0495604_0086569
423 Ga0495683_0054720
424 Ga0495675_0375192
425 Ga0495686_0062854
426 Ga0495602_0093363
427 Ga0496100_0637158
428 Ga0496100_0765621
429 Ga0496101_0188292
430 Ga0496102_0760758
431 Ga0496104_0748881
432 Ga0496108_0334199
433 Ga0496109_0255485
434 Ga0496109_0933858
435 Ga0496110_0712045
436 Ga0496112_0108211
437 Ga0496114_0698815
438 Ga0496115_0059689
439 Ga0496117_0171643
440 Ga0496118_0010571
441 Ga0496119_0012629
442 Ga0496119_0053923
443 Ga0496119_0252365
444 Ga0496120_0037894
445 Ga0496121_0059965
446 Ga0496121_0063919
447 Ga0496121_0130266
448 Ga0496122_0251554
449 Ga0496125_0104912
450 Ga0496125_0300217
451 Ga0496126_0003373
452 Ga0496126_0104432
453 Ga0496126_0111753
454 Ga0496126_0236334
455 Ga0496126_0246750
456 Ga0495678_123485
457 Ga0495682_0022447
458 Ga0501039_0248842
459 Ga0501069_0484912
460 Ga0501076_0615420
461 nmdc:mga03n38_177383_c1
462 nmdc:mga00v17_247118_c1
463 nmdc:mga06z11_283010_c1
464 nmdc:mga07m45_42162_c1
465 nmdc:mga0qj67_181689_c1
466 nmdc:mga0n895_514450_c1
467 nmdc:mga0n895_813504_c1
468 Ga0500610_0062261
469 Ga0500578_0279921
470 Ga0500651_0129910
471 Ga0500566_0003143
472 Ga0500572_001467
473 Ga0500595_000941
474 Ga0500559_0014611
475 Ga0500559_0091248
476 Ga0500559_0290602
477 Ga0500568_0001569
478 Ga0500638_000054
479 Ga0500637_0006042
480 Ga0500637_0360386
481 2723848219
482 2793071903
483 2841943253
484 2841976681
485 2844316849
486 2857512252
487 2874608797
488 2889037268
489 2903755145
490 2906604516
491 2908745126
492 2935884020
493 3005507064
494 3005596480
495 3005719610
496 8006970840
497 8006985268
498 8056675880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wzi-assembly1.cif.gz_A crystal structure of crosslink stabilized long-form pde4b 0.7037 4 180
1xn0-assembly1.cif.gz_A catalytic domain of human phosphodiesterase 4b in complex with (r,s)-rolipram 0.6997 4 180
5ohj-assembly1.cif.gz_A human phosphodiesterase 4b catalytic domain in complex with a pyrrolidinyl inhibitor. 0.6974 4 180
1ror-assembly2.cif.gz_B crystal structures of the catalytic domain of phosphodiesterase 4b2b complexed with amp 0.6951 4 180
1mkd-assembly1.cif.gz_B crystal structure of pde4d catalytic domain and zardaverine complex 0.6936 4 180
ID Description Score Start End Superfamily
af_Q54GY3_13_181_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.922 4 146 1.10.3210.10
af_Q4D8L8_47_257_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8552 4 145 1.10.3210.10
af_Q54GY3_13_181_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7802 4 146 1.10.3210.10
af_Q9W136_10_170_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7588 3 145 1.10.3210.10
af_Q9W136_10_170_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6762 3 145 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A2K8YM60-F1-model_v4 deleted 0.9997 1 181
AF-A0A1H4VFH1-F1-model_v4 Predicted metal-dependent phosphohydrolase, HD superfamily 0.999 1 181 GO:0016787
AF-A0A2D5X6Z1-F1-model_v4 Uncharacterized protein 0.999 104 180
AF-A0A431R1X1-F1-model_v4 deleted 0.9986 1 180
AF-A0A2J7QEM6-F1-model_v4 Uncharacterized protein 0.997 102 180

Map