F360572

General Info

Members Datasets Scaffolds Average Seq Length
249 134 498 272

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100322198|Ga0068853_1003221982
Length 300
Sequence MRWGRLTAPAPQAKAAGMDTSETIERKEPASPKAQKRAGGFGETLRFLLLMFVFAVLLRGFVAAPFSIPSGSMLPRMMIGDYLFVAKWPYGFSRFSLPFGIISFDGRVLAAEPARGDTVVFRYPGGDGEDYVKRLIGLPGDQVQMKGGILFLNGEPVPKVRVADYLMPVTPNSPCRSVAPGQVHVVARGDGQRFCAYPRYRETLPGGRSYEILDQVDGRADDTPVFLVPEDHYFMMGDNRDDSEDSRFPRSEGGVGFLPADHLIGRAMVTFFSTDGSAEWLKPWTWFSATRWERIGETYQ

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
100 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
105 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
113 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
114 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
118 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
119 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
120 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
121 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
122 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
123 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
124 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
125 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
126 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
127 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
128 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
129 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
130 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
131 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
134 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 2.01
Rhizosphere 95.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100322198 3300005539 Bacteria 1433
2 JGI24746J21847_1005684 3300001977 Bacteria 1945
3 JGI24034J26672_10006197 3300002239 Bacteria 1723
4 Ga0065712_10226202 3300005290 Bacteria 1025
5 Ga0065715_10000902 3300005293 Bacteria 21505
6 Ga0070658_10225917 3300005327 Bacteria 1584
7 Ga0070676_10003558 3300005328 Bacteria 8148
8 Ga0070670_100001324 3300005331 Bacteria 19783
9 Ga0070670_100070966 3300005331 Bacteria 2990
10 Ga0070670_100109138 3300005331 Bacteria 2384
11 Ga0070677_10000275 3300005333 Bacteria 18016
12 Ga0070668_100001117 3300005347 Bacteria 18924
13 Ga0070668_100001906 3300005347 Bacteria 15259
14 Ga0070668_100055225 3300005347 Bacteria 3065
15 Ga0070668_100285371 3300005347 Bacteria 1380
16 Ga0070668_100459368 3300005347 Bacteria 1096
17 Ga0070669_100003417 3300005353 Bacteria 11434
18 Ga0070669_100038251 3300005353 Bacteria 3483
19 Ga0070669_100063233 3300005353 Bacteria 2724
20 Ga0070669_100226092 3300005353 Bacteria 1481
21 Ga0070675_100003230 3300005354 Bacteria 12344
22 Ga0070671_100042256 3300005355 Bacteria 3789
23 Ga0070671_100064991 3300005355 Bacteria 3038
24 Ga0070671_100548234 3300005355 Bacteria 997
25 Ga0070674_100005112 3300005356 Bacteria 7542
26 Ga0070673_100012637 3300005364 Bacteria 5805
27 Ga0070667_100070152 3300005367 Bacteria 2983
28 Ga0070705_100103624 3300005440 Bacteria 1802
29 Ga0070663_100080962 3300005455 Bacteria 2386
30 Ga0070678_100039109 3300005456 Bacteria 3344
31 Ga0070662_100001356 3300005457 Bacteria 15048
32 Ga0070681_10198786 3300005458 Bacteria 1923
33 Ga0068867_100043824 3300005459 Bacteria 3276
34 Ga0068853_100066524 3300005539 Bacteria 3130
35 Ga0068853_100070971 3300005539 Bacteria 3032
36 Ga0070672_100004387 3300005543 Bacteria 9243
37 Ga0070672_100104547 3300005543 Bacteria 2301
38 Ga0070665_100049523 3300005548 Bacteria 4215
39 Ga0070665_100403435 3300005548 Bacteria 1375
40 Ga0070664_100021591 3300005564 Bacteria 5309
41 Ga0068859_100013576 3300005617 Bacteria 8166
42 Ga0068859_100169062 3300005617 Bacteria 2267
43 Ga0068861_100028481 3300005719 Bacteria 4076
44 Ga0068861_100595012 3300005719 Bacteria 1014
45 Ga0068863_100000001 3300005841 Bacteria 581116
46 Ga0068862_100005814 3300005844 Bacteria 10280
47 Ga0068862_100149508 3300005844 Bacteria 2078
48 Ga0068862_100192470 3300005844 Bacteria 1836
49 Ga0068862_100436956 3300005844 Bacteria 1231
50 Ga0097621_100065441 3300006237 Bacteria 2992
51 Ga0097621_100537952 3300006237 Bacteria 1062
52 Ga0068871_100076989 3300006358 Bacteria 2756
53 Ga0075431_100047854 3300006847 Bacteria 4409
54 Ga0068865_100356541 3300006881 Bacteria 1186
55 Ga0097620_100013576 3300006931 Bacteria 8166
56 Ga0097620_100169073 3300006931 Bacteria 2267
57 Ga0105243_10080315 3300009148 Bacteria 2660
58 Ga0105248_10215789 3300009177 Bacteria 2161
59 Ga0105249_10052881 3300009553 Bacteria 3711
60 Ga0105249_10060888 3300009553 Bacteria 3464
61 Ga0163162_10018686 3300013306 Bacteria 6791
62 Ga0163162_10156483 3300013306 Bacteria 2399
63 Ga0157375_10176349 3300013308 Bacteria 2287
64 Ga0163163_10207028 3300014325 Bacteria 2010
65 Ga0157380_10000713 3300014326 Bacteria 20783
66 Ga0157380_10002756 3300014326 Bacteria 11931
67 Ga0157380_10022797 3300014326 Bacteria 4721
68 Ga0157380_10059286 3300014326 Bacteria 3053
69 Ga0157380_10157788 3300014326 Bacteria 1968
70 Ga0157377_10098393 3300014745 Bacteria 1739
71 Ga0213876_10000873 3300021384 Bacteria 20190
72 Ga0207697_10001973 3300025315 Bacteria 10871
73 Ga0207682_10000595 3300025893 Bacteria 16781
74 Ga0207645_10010785 3300025907 Bacteria 6265
75 Ga0207707_10237349 3300025912 Bacteria 1586
76 Ga0207660_10001169 3300025917 Bacteria 17546
77 Ga0207681_10001614 3300025923 Bacteria 14537
78 Ga0207650_10000997 3300025925 Bacteria 21289
79 Ga0207650_10094194 3300025925 Bacteria 2294
80 Ga0207659_10000824 3300025926 Bacteria 18378
81 Ga0207644_10000131 3300025931 Bacteria 54340
82 Ga0207644_10023099 3300025931 Bacteria 4255
83 Ga0207644_10119418 3300025931 Bacteria 2005
84 Ga0207644_10269980 3300025931 Bacteria 1363
85 Ga0207706_10000401 3300025933 Bacteria 46630
86 Ga0207709_10171691 3300025935 Bacteria 1522
87 Ga0207670_10353684 3300025936 Bacteria 1164
88 Ga0207669_10004156 3300025937 Bacteria 6345
89 Ga0207691_10000693 3300025940 Bacteria 33328
90 Ga0207691_10165826 3300025940 Bacteria 1936
91 Ga0207651_10006209 3300025960 Bacteria 6223
92 Ga0207712_10030947 3300025961 Bacteria 3601
93 Ga0207712_10050221 3300025961 Bacteria 2911
94 Ga0207712_10085780 3300025961 Bacteria 2305
95 Ga0207712_10258226 3300025961 Bacteria 1412
96 Ga0207668_10000040 3300025972 Bacteria 106427
97 Ga0207668_10000673 3300025972 Bacteria 20991
98 Ga0207668_10014411 3300025972 Bacteria 4893
99 Ga0207668_10162260 3300025972 Bacteria 1743
100 Ga0207668_10234957 3300025972 Bacteria 1480
101 Ga0207658_10010094 3300025986 Bacteria 6414
102 Ga0207639_10069024 3300026041 Bacteria 2756
103 Ga0207639_10188374 3300026041 Bacteria 1760
104 Ga0207678_10035319 3300026067 Bacteria 4352
105 Ga0207708_10160494 3300026075 Bacteria 1775
106 Ga0207641_10000001 3300026088 Bacteria 1180841
107 Ga0207676_10030820 3300026095 Bacteria 4029
108 Ga0207676_10187814 3300026095 Bacteria 1816
109 Ga0207675_100051066 3300026118 Bacteria 3858
110 Ga0207675_100195970 3300026118 Bacteria 1939
111 Ga0207683_10056212 3300026121 Bacteria 3451
112 Ga0209974_10007473 3300027876 Bacteria 3765
113 Ga0209974_10019210 3300027876 Bacteria 2265
114 Ga0268266_10425313 3300028379 Bacteria 1259
115 Ga0268265_10018458 3300028380 Bacteria 4834
116 Ga0268265_10167869 3300028380 Bacteria 1872
117 Ga0268265_10341715 3300028380 Bacteria 1363
118 Ga0268264_10017104 3300028381 Bacteria 5937
119 Ga0307408_100014088 3300031548 Bacteria 5312
120 Ga0307408_100063193 3300031548 Bacteria 2707
121 Ga0307408_100063960 3300031548 Bacteria 2693
122 Ga0307408_100095302 3300031548 Bacteria 2256
123 Ga0307408_100176440 3300031548 Bacteria 1710
124 Ga0307405_10025060 3300031731 Bacteria 3418
125 Ga0307405_10045849 3300031731 Bacteria 2681
126 Ga0307405_10116497 3300031731 Bacteria 1820
127 Ga0307413_10007176 3300031824 Bacteria 5153
128 Ga0307413_10016226 3300031824 Bacteria 3840
129 Ga0307413_10020128 3300031824 Bacteria 3542
130 Ga0307413_10026871 3300031824 Bacteria 3179
131 Ga0307413_10027645 3300031824 Bacteria 3146
132 Ga0307413_10039163 3300031824 Bacteria 2754
133 Ga0307413_10043336 3300031824 Bacteria 2651
134 Ga0307413_10044919 3300031824 Bacteria 2614
135 Ga0307413_10195232 3300031824 Bacteria 1457
136 Ga0307410_10001711 3300031852 Bacteria 10120
137 Ga0307410_10014194 3300031852 Bacteria 4678
138 Ga0307410_10035579 3300031852 Bacteria 3235
139 Ga0307410_10052470 3300031852 Bacteria 2755
140 Ga0307410_10119221 3300031852 Bacteria 1921
141 Ga0307410_10121102 3300031852 Bacteria 1908
142 Ga0307410_10242605 3300031852 Bacteria 1397
143 Ga0307406_10028909 3300031901 Bacteria 3352
144 Ga0307406_10041480 3300031901 Bacteria 2867
145 Ga0307406_10041892 3300031901 Bacteria 2856
146 Ga0307407_10022808 3300031903 Bacteria 3255
147 Ga0307407_10075483 3300031903 Bacteria 2021
148 Ga0307407_10078100 3300031903 Bacteria 1993
149 Ga0307407_10314930 3300031903 Bacteria 1096
150 Ga0307407_10332736 3300031903 Bacteria 1069
151 Ga0307412_10054752 3300031911 Bacteria 2649
152 Ga0307412_10064764 3300031911 Bacteria 2470
153 Ga0307412_10078136 3300031911 Bacteria 2278
154 Ga0307412_10110613 3300031911 Bacteria 1961
155 Ga0307412_10150529 3300031911 Bacteria 1716
156 Ga0307412_10154462 3300031911 Bacteria 1697
157 Ga0307412_10367359 3300031911 Bacteria 1161
158 Ga0307409_100003478 3300031995 Bacteria 8561
159 Ga0307409_100032077 3300031995 Bacteria 3802
160 Ga0307409_100115529 3300031995 Bacteria 2260
161 Ga0307409_100137026 3300031995 Bacteria 2102
162 Ga0307409_100146625 3300031995 Bacteria 2042
163 Ga0307409_100170965 3300031995 Bacteria 1913
164 Ga0307409_100481955 3300031995 Bacteria 1204
165 Ga0307416_100015921 3300032002 Bacteria 5209
166 Ga0307416_100022690 3300032002 Bacteria 4536
167 Ga0307416_100024073 3300032002 Bacteria 4434
168 Ga0307416_100025055 3300032002 Bacteria 4366
169 Ga0307416_100294468 3300032002 Bacteria 1609
170 Ga0307416_100301810 3300032002 Bacteria 1592
171 Ga0307416_100522477 3300032002 Bacteria 1255
172 Ga0307414_10003772 3300032004 Bacteria 8145
173 Ga0307414_10026294 3300032004 Bacteria 3744
174 Ga0307414_10038104 3300032004 Bacteria 3225
175 Ga0307414_10069110 3300032004 Bacteria 2538
176 Ga0307414_10089893 3300032004 Bacteria 2277
177 Ga0307414_10105021 3300032004 Bacteria 2135
178 Ga0307414_10201242 3300032004 Bacteria 1620
179 Ga0307414_10258668 3300032004 Bacteria 1451
180 Ga0307414_10267012 3300032004 Bacteria 1431
181 Ga0307414_10301704 3300032004 Bacteria 1355
182 Ga0307411_10015343 3300032005 Bacteria 4299
183 Ga0307411_10026073 3300032005 Bacteria 3513
184 Ga0307411_10028422 3300032005 Bacteria 3399
185 Ga0307411_10078346 3300032005 Bacteria 2265
186 Ga0307411_10086888 3300032005 Bacteria 2170
187 Ga0307415_100044328 3300032126 Bacteria 2973
188 Ga0307415_100085984 3300032126 Bacteria 2261
189 Ga0307415_100086424 3300032126 Bacteria 2256
190 Ga0307415_100135779 3300032126 Bacteria 1870
191 Ga0395899_0114257 3300037312 Bacteria 1939
192 Ga0395900_0002008 3300037418 Bacteria 22966
193 Ga0395905_0000218 3300037471 Bacteria 87745
194 Ga0436364_0427882 3300037853 Bacteria 1119
195 Ga0395901_0002884 3300038443 Bacteria 17345
196 Ga0436365_1205090 3300039437 Bacteria 128002
197 Ga0439445_0051836 3300042004 Bacteria 1109
198 Ga0466963_0047891 3300044694 Bacteria 2822
199 Ga0466971_0241600 3300044719 Bacteria 859
200 Ga0466957_0008154 3300044842 Bacteria 5947
201 Ga0466967_0005907 3300045976 Bacteria 8581
202 Ga0495648_0014418 3300046524 Bacteria 5788
203 Ga0495663_0001618 3300046525 Bacteria 7041
204 Ga0495663_0008361 3300046525 Bacteria 2866
205 Ga0495654_0108307 3300046530 Bacteria 1270
206 Ga0495598_0005457 3300046537 Bacteria 2820
207 Ga0495598_0008298 3300046537 Bacteria 2414
208 Ga0495621_0000168 3300046539 Bacteria 14780
209 Ga0495621_0001871 3300046539 Bacteria 5527
210 Ga0495621_0001957 3300046539 Bacteria 5420
211 Ga0495633_0050990 3300046558 Bacteria 1950
212 Ga0495633_0119829 3300046558 Bacteria 1219
213 Ga0495659_0002838 3300046664 Bacteria 5566
214 Ga0495670_0005070 3300046691 Bacteria 6477
215 Ga0495670_0006356 3300046691 Bacteria 5803
216 Ga0495670_0013765 3300046691 Bacteria 3977
217 Ga0495670_0036804 3300046691 Bacteria 2439
218 Ga0495671_0089538 3300046692 Bacteria 1507
219 Ga0495677_0015534 3300047445 Bacteria 2766
220 Ga0495677_0050985 3300047445 Bacteria 1523
221 Ga0495685_074106 3300047447 Bacteria 1138
222 Ga0496107_0031909 3300048910 Bacteria 3762
223 Ga0496109_0140508 3300048912 Bacteria 2258
224 Ga0496110_0181116 3300048913 Bacteria 1913
225 Ga0496111_0134360 3300048914 Bacteria 1832
226 Ga0496114_0010834 3300048917 Bacteria 7260
227 Ga0501290_000259 3300049513 Bacteria 8716
228 Ga0501292_000005 3300049515 Bacteria 147536
229 Ga0501294_000590 3300049517 Bacteria 4149
230 Ga0501034_0159663 3300049571 Bacteria 2226
231 Ga0501070_0042512 3300049586 Bacteria 3785
232 Ga0501202_008200 3300049652 Bacteria 1901
233 Ga0501206_001316 3300049653 Bacteria 3105
234 Ga0501222_001476 3300049662 Bacteria 3295
235 Ga0501223_003505 3300049663 Bacteria 3406
236 Ga0501224_010029 3300049664 Bacteria 1387
237 Ga0501235_006567 3300049669 Bacteria 2533
238 Ga0501242_005544 3300049674 Bacteria 1423
239 Ga0501257_000095 3300049686 Bacteria 21617
240 Ga0501259_001473 3300049688 Bacteria 3916
241 Ga0501261_000032 3300049690 Bacteria 31219
242 Ga0501268_001536 3300049765 Bacteria 2895
243 Ga0501279_000020 3300049775 Bacteria 58285
244 Ga0501280_000025 3300049776 Bacteria 49396
245 Ga0501282_000777 3300049778 Bacteria 3665
246 Ga0501283_001225 3300049779 Bacteria 3382
247 nmdc:mga06r32_8778_c1 3300050510 Bacteria 9108
248 Ga0500643_010242 3300053087 Bacteria 3506
249 Ga0500594_0090338 3300053118 Bacteria 929
250 Ga0068853_100322198
251 JGI24746J21847_1005684
252 JGI24034J26672_10006197
253 Ga0065712_10226202
254 Ga0065715_10000902
255 Ga0070658_10225917
256 Ga0070676_10003558
257 Ga0070670_100001324
258 Ga0070670_100070966
259 Ga0070670_100109138
260 Ga0070677_10000275
261 Ga0070668_100001117
262 Ga0070668_100001906
263 Ga0070668_100055225
264 Ga0070668_100285371
265 Ga0070668_100459368
266 Ga0070669_100003417
267 Ga0070669_100038251
268 Ga0070669_100063233
269 Ga0070669_100226092
270 Ga0070675_100003230
271 Ga0070671_100042256
272 Ga0070671_100064991
273 Ga0070671_100548234
274 Ga0070674_100005112
275 Ga0070673_100012637
276 Ga0070667_100070152
277 Ga0070705_100103624
278 Ga0070663_100080962
279 Ga0070678_100039109
280 Ga0070662_100001356
281 Ga0070681_10198786
282 Ga0068867_100043824
283 Ga0068853_100066524
284 Ga0068853_100070971
285 Ga0070672_100004387
286 Ga0070672_100104547
287 Ga0070665_100049523
288 Ga0070665_100403435
289 Ga0070664_100021591
290 Ga0068859_100013576
291 Ga0068859_100169062
292 Ga0068861_100028481
293 Ga0068861_100595012
294 Ga0068863_100000001
295 Ga0068862_100005814
296 Ga0068862_100149508
297 Ga0068862_100192470
298 Ga0068862_100436956
299 Ga0097621_100065441
300 Ga0097621_100537952
301 Ga0068871_100076989
302 Ga0075431_100047854
303 Ga0068865_100356541
304 Ga0097620_100013576
305 Ga0097620_100169073
306 Ga0105243_10080315
307 Ga0105248_10215789
308 Ga0105249_10052881
309 Ga0105249_10060888
310 Ga0163162_10018686
311 Ga0163162_10156483
312 Ga0157375_10176349
313 Ga0163163_10207028
314 Ga0157380_10000713
315 Ga0157380_10002756
316 Ga0157380_10022797
317 Ga0157380_10059286
318 Ga0157380_10157788
319 Ga0157377_10098393
320 Ga0213876_10000873
321 Ga0207697_10001973
322 Ga0207682_10000595
323 Ga0207645_10010785
324 Ga0207707_10237349
325 Ga0207660_10001169
326 Ga0207681_10001614
327 Ga0207650_10000997
328 Ga0207650_10094194
329 Ga0207659_10000824
330 Ga0207644_10000131
331 Ga0207644_10023099
332 Ga0207644_10119418
333 Ga0207644_10269980
334 Ga0207706_10000401
335 Ga0207709_10171691
336 Ga0207670_10353684
337 Ga0207669_10004156
338 Ga0207691_10000693
339 Ga0207691_10165826
340 Ga0207651_10006209
341 Ga0207712_10030947
342 Ga0207712_10050221
343 Ga0207712_10085780
344 Ga0207712_10258226
345 Ga0207668_10000040
346 Ga0207668_10000673
347 Ga0207668_10014411
348 Ga0207668_10162260
349 Ga0207668_10234957
350 Ga0207658_10010094
351 Ga0207639_10069024
352 Ga0207639_10188374
353 Ga0207678_10035319
354 Ga0207708_10160494
355 Ga0207641_10000001
356 Ga0207676_10030820
357 Ga0207676_10187814
358 Ga0207675_100051066
359 Ga0207675_100195970
360 Ga0207683_10056212
361 Ga0209974_10007473
362 Ga0209974_10019210
363 Ga0268266_10425313
364 Ga0268265_10018458
365 Ga0268265_10167869
366 Ga0268265_10341715
367 Ga0268264_10017104
368 Ga0307408_100014088
369 Ga0307408_100063193
370 Ga0307408_100063960
371 Ga0307408_100095302
372 Ga0307408_100176440
373 Ga0307405_10025060
374 Ga0307405_10045849
375 Ga0307405_10116497
376 Ga0307413_10007176
377 Ga0307413_10016226
378 Ga0307413_10020128
379 Ga0307413_10026871
380 Ga0307413_10027645
381 Ga0307413_10039163
382 Ga0307413_10043336
383 Ga0307413_10044919
384 Ga0307413_10195232
385 Ga0307410_10001711
386 Ga0307410_10014194
387 Ga0307410_10035579
388 Ga0307410_10052470
389 Ga0307410_10119221
390 Ga0307410_10121102
391 Ga0307410_10242605
392 Ga0307406_10028909
393 Ga0307406_10041480
394 Ga0307406_10041892
395 Ga0307407_10022808
396 Ga0307407_10075483
397 Ga0307407_10078100
398 Ga0307407_10314930
399 Ga0307407_10332736
400 Ga0307412_10054752
401 Ga0307412_10064764
402 Ga0307412_10078136
403 Ga0307412_10110613
404 Ga0307412_10150529
405 Ga0307412_10154462
406 Ga0307412_10367359
407 Ga0307409_100003478
408 Ga0307409_100032077
409 Ga0307409_100115529
410 Ga0307409_100137026
411 Ga0307409_100146625
412 Ga0307409_100170965
413 Ga0307409_100481955
414 Ga0307416_100015921
415 Ga0307416_100022690
416 Ga0307416_100024073
417 Ga0307416_100025055
418 Ga0307416_100294468
419 Ga0307416_100301810
420 Ga0307416_100522477
421 Ga0307414_10003772
422 Ga0307414_10026294
423 Ga0307414_10038104
424 Ga0307414_10069110
425 Ga0307414_10089893
426 Ga0307414_10105021
427 Ga0307414_10201242
428 Ga0307414_10258668
429 Ga0307414_10267012
430 Ga0307414_10301704
431 Ga0307411_10015343
432 Ga0307411_10026073
433 Ga0307411_10028422
434 Ga0307411_10078346
435 Ga0307411_10086888
436 Ga0307415_100044328
437 Ga0307415_100085984
438 Ga0307415_100086424
439 Ga0307415_100135779
440 Ga0395899_0114257
441 Ga0395900_0002008
442 Ga0395905_0000218
443 Ga0436364_0427882
444 Ga0395901_0002884
445 Ga0436365_1205090
446 Ga0439445_0051836
447 Ga0466963_0047891
448 Ga0466971_0241600
449 Ga0466957_0008154
450 Ga0466967_0005907
451 Ga0495648_0014418
452 Ga0495663_0001618
453 Ga0495663_0008361
454 Ga0495654_0108307
455 Ga0495598_0005457
456 Ga0495598_0008298
457 Ga0495621_0000168
458 Ga0495621_0001871
459 Ga0495621_0001957
460 Ga0495633_0050990
461 Ga0495633_0119829
462 Ga0495659_0002838
463 Ga0495670_0005070
464 Ga0495670_0006356
465 Ga0495670_0013765
466 Ga0495670_0036804
467 Ga0495671_0089538
468 Ga0495677_0015534
469 Ga0495677_0050985
470 Ga0495685_074106
471 Ga0496107_0031909
472 Ga0496109_0140508
473 Ga0496110_0181116
474 Ga0496111_0134360
475 Ga0496114_0010834
476 Ga0501290_000259
477 Ga0501292_000005
478 Ga0501294_000590
479 Ga0501034_0159663
480 Ga0501070_0042512
481 Ga0501202_008200
482 Ga0501206_001316
483 Ga0501222_001476
484 Ga0501223_003505
485 Ga0501224_010029
486 Ga0501235_006567
487 Ga0501242_005544
488 Ga0501257_000095
489 Ga0501259_001473
490 Ga0501261_000032
491 Ga0501268_001536
492 Ga0501279_000020
493 Ga0501280_000025
494 Ga0501282_000777
495 Ga0501283_001225
496 nmdc:mga06r32_8778_c1
497 Ga0500643_010242
498 Ga0500594_0090338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

41

272

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4me8-assembly1.cif.gz_A crystal structure of a signal peptidase i (ef3073) from enterococcus faecalis v583 at 2.27 a resolution 0.8702 93 138
2e5q-assembly1.cif.gz_A solution structure of the tudor domain of phd finger protein 19, isoform b [homo sapiens] 0.6711 88 115
2xk0-assembly1.cif.gz_A solution structure of the tudor domain from drosophila polycomblike (pcl) 0.647 84 124
6wau-assembly1.cif.gz_A complex structure of phf19 0.6394 93 122
2hqe-assembly1.cif.gz_B crystal structure of human p100 tudor domain: large fragment 0.6036 81 132
ID Description Score Start End Superfamily
4me8A00 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8702 93 138 2.10.109.10
af_Q2FZT7_22_151_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8351 94 138 2.10.109.10
af_Q4DC79_1_67_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.7292 93 120 2.30.30.140
2xk0A00 Mainly Beta;Roll;SH3 type barrels.; 0.647 84 124 2.30.30.140
af_A0A368UMI2_206_316_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.6337 75 138 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A2N7SIG0-F1-model_v4 deleted 0.8558 14 138
AF-A0A530BR28-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8382 11 140 GO:0004252
GO:0006465
GO:0016020
AF-A0A435UQL8-F1-model_v4 deleted 0.829 14 121
AF-A0A527HFX1-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8278 11 125 GO:0004252
GO:0006465
GO:0016020
AF-A0A7C7GK83-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8269 19 147 GO:0004252
GO:0006465
GO:0016020

Map