F360332

General Info

Members Datasets Scaffolds Average Seq Length
248 181 198 380

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2858902515|2858905766
Length 428
Sequence VPPPPGDPLRSAPPGGPVSPTAPLRPAPGPVSPVAPARPAPGPAFPVAPLEPVAPRYGGGSLADVLPSALAVLGVPGAADLLGLAPRLAGVRRVAVLLVDGLGWYQIPTAAPYAPTLAGLAATVGRPLTSGFPSTTPTSLVTLGTGVAPGAHGVLGFKVRVPGTDRVLSHIEWTGDPEPLRWQPVATQLERARAAGVAVTVVSRPEYAGSGLTLAANRGGDYRGAADADALAAAMLTALAAGTGPTLVSGYHPDLDRHGHLSGVDSAPWRVAAAVVDALLARLVDGLPPDAALLVTADHGQLDVPAADRVDFDADLGLRAGVRVLAGEPRVRYLHVEPGAADDVVAAWSAVLGDAARVLHRDEAVATGWFGPVPEEHLRRVGDVVVVCRGTSAVVATRSEKPIESRLVAYHGADTAAEMTIPLLVVRG

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
4 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
5 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
6 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
7 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
8 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
9 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
10 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
11 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
12 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
13 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
14 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
15 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
16 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
17 2858868258 Micromonospora sp. MH33 Isolate Unclassified
18 2858882152 Micromonospora noduli MED15 Isolate Nodule
19 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
20 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
21 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
22 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
23 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
24 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
25 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
26 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
27 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
28 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
29 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
30 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
31 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
32 2902582711 Micromonospora sp. AP08 Isolate Unclassified
33 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
34 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
35 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
36 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
37 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
38 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
39 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
40 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
41 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
42 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
43 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
121 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
176 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
177 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
178 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
179 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
180 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
181 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.44
Metatranscriptomes 0.4
Isolates 20.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 1.21
Nodule 1.61
Rhizoplane 5.24
Rhizosphere 72.58
Stem 0
Stem Tuber 0
Unclassified 18.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000985 3300005329 Bacteria 21261
2 Ga0070683_100002409 3300005329 Bacteria 14856
3 Ga0070683_100057047 3300005329 Bacteria 3627
4 Ga0068869_100019875 3300005334 Bacteria 4599
5 Ga0068868_100025974 3300005338 Bacteria 4460
6 Ga0070661_100047239 3300005344 Bacteria 3150
7 Ga0070669_100034319 3300005353 Bacteria 3673
8 Ga0070675_100000270 3300005354 Bacteria 34199
9 Ga0070659_100076068 3300005366 Bacteria 2677
10 Ga0070713_100089366 3300005436 Bacteria 2646
11 Ga0070663_100105655 3300005455 Bacteria 2108
12 Ga0070662_100035233 3300005457 Bacteria 3534
13 Ga0070684_100059591 3300005535 Bacteria 3338
14 Ga0068855_100044649 3300005563 Bacteria 5244
15 Ga0068855_100280342 3300005563 Bacteria 1851
16 Ga0070664_100001748 3300005564 Bacteria 17393
17 Ga0068857_100002633 3300005577 Bacteria 14733
18 Ga0068857_100175535 3300005577 Bacteria 1949
19 Ga0068856_100175347 3300005614 Bacteria 2156
20 Ga0070702_100020516 3300005615 Bacteria 3464
21 Ga0068859_100010128 3300005617 Bacteria 9496
22 Ga0068864_100014012 3300005618 Bacteria 6647
23 Ga0068864_100302523 3300005618 Bacteria 1498
24 Ga0068858_100255012 3300005842 Bacteria 1667
25 Ga0068860_100172560 3300005843 Bacteria 2089
26 Ga0068862_100325332 3300005844 Bacteria 1420
27 Ga0075363_100018519 3300006048 Bacteria 3471
28 Ga0075362_10009066 3300006177 Bacteria 3831
29 Ga0075366_10095944 3300006195 Bacteria 1778
30 Ga0075428_100000984 3300006844 Bacteria 30156
31 Ga0075428_100005879 3300006844 Bacteria 13632
32 Ga0075428_100059157 3300006844 Bacteria 4196
33 Ga0075428_100242317 3300006844 Bacteria 1945
34 Ga0075428_100334406 3300006844 Bacteria 1627
35 Ga0075430_100000909 3300006846 Bacteria 23207
36 Ga0075430_100001883 3300006846 Bacteria 17177
37 Ga0075430_100215751 3300006846 Bacteria 1592
38 Ga0075431_100004163 3300006847 Bacteria 14136
39 Ga0075431_100048850 3300006847 Bacteria 4364
40 Ga0075431_100105820 3300006847 Bacteria 2903
41 Ga0075431_100262023 3300006847 Bacteria 1754
42 Ga0075429_100000467 3300006880 Bacteria 30156
43 Ga0075429_100051415 3300006880 Bacteria 3586
44 Ga0097620_100010128 3300006931 Bacteria 9496
45 Ga0111539_10014557 3300009094 Bacteria 9822
46 Ga0114129_10000059 3300009147 Bacteria 98984
47 Ga0114129_10004038 3300009147 Bacteria 20724
48 Ga0114129_10037325 3300009147 Bacteria 6860
49 Ga0114129_10090928 3300009147 Bacteria 4230
50 Ga0105248_10019979 3300009177 Bacteria 7416
51 Ga0105248_10394950 3300009177 Bacteria 1557
52 Ga0105238_10341189 3300009551 Bacteria 1486
53 Ga0105239_10269905 3300010375 Bacteria 1913
54 Ga0157378_10184345 3300013297 Bacteria 1965
55 Ga0163163_10002097 3300014325 Bacteria 16834
56 Ga0157380_10173757 3300014326 Bacteria 1885
57 Ga0157379_10023017 3300014968 Bacteria 5522
58 Ga0157379_10162618 3300014968 Bacteria 2015
59 Ga0206353_11729901 3300020082 Bacteria 1713
60 Ga0213874_10010998 3300021377 Bacteria 2280
61 Ga0207647_10056061 3300025904 Bacteria 2419
62 Ga0207707_10143914 3300025912 Bacteria 2084
63 Ga0207662_10142894 3300025918 Bacteria 1517
64 Ga0207659_10001393 3300025926 Bacteria 14405
65 Ga0207687_10020521 3300025927 Bacteria 4384
66 Ga0207700_10035200 3300025928 Bacteria 3605
67 Ga0207690_10010314 3300025932 Bacteria 5546
68 Ga0207706_10023651 3300025933 Bacteria 5517
69 Ga0207670_10277557 3300025936 Bacteria 1305
70 Ga0207689_10004062 3300025942 Bacteria 13297
71 Ga0207661_10001637 3300025944 Bacteria 15255
72 Ga0207661_10003403 3300025944 Bacteria 11043
73 Ga0207661_10013982 3300025944 Bacteria 5870
74 Ga0207679_10019713 3300025945 Bacteria 4538
75 Ga0207679_10024115 3300025945 Bacteria 4168
76 Ga0207668_10024346 3300025972 Bacteria 3906
77 Ga0207677_10001058 3300026023 Bacteria 15087
78 Ga0207678_10070074 3300026067 Bacteria 3006
79 Ga0207676_10094474 3300026095 Bacteria 2464
80 Ga0207674_10004493 3300026116 Bacteria 16764
81 Ga0207674_10154455 3300026116 Bacteria 2250
82 Ga0207428_10119681 3300027907 Bacteria 2020
83 Ga0268264_10104145 3300028381 Bacteria 2473
84 Ga0307515_10000356 3300028794 Bacteria 112492
85 Ga0307515_10014889 3300028794 Bacteria 14378
86 Ga0307515_10058708 3300028794 Bacteria 5534
87 Ga0307509_10010616 3300031507 Bacteria 11249
88 Ga0307509_10157147 3300031507 Bacteria 2178
89 Ga0307508_10044958 3300031616 Bacteria 3947
90 Ga0316579_10010895 3300031691 Bacteria 3852
91 Ga0316576_10001270 3300031727 Bacteria 13393
92 Ga0316576_10027343 3300031727 Bacteria 4010
93 Ga0316578_10002566 3300031728 Bacteria 8029
94 Ga0307516_10006104 3300031730 Bacteria 14218
95 Ga0307516_10029063 3300031730 Bacteria 5590
96 Ga0307405_10114489 3300031731 Bacteria 1833
97 Ga0316577_10020612 3300031733 Bacteria 3653
98 Ga0316577_10130898 3300031733 Bacteria 1412
99 Ga0307413_10020427 3300031824 Bacteria 3522
100 Ga0307410_10153211 3300031852 Bacteria 1718
101 Ga0307406_10004626 3300031901 Bacteria 7493
102 Ga0307406_10041057 3300031901 Bacteria 2880
103 Ga0307406_10115940 3300031901 Bacteria 1852
104 Ga0307407_10189360 3300031903 Bacteria 1370
105 Ga0307409_100009793 3300031995 Bacteria 5910
106 Ga0307409_100024324 3300031995 Bacteria 4222
107 Ga0307416_100005180 3300032002 Bacteria 7968
108 Ga0307416_100029630 3300032002 Bacteria 4092
109 Ga0307411_10021365 3300032005 Bacteria 3786
110 Ga0307411_10220580 3300032005 Bacteria 1471
111 Ga0307415_100067299 3300032126 Bacteria 2502
112 Ga0316585_10007294 3300032137 Bacteria 3184
113 Ga0316580_10003424 3300032139 Bacteria 4501
114 Ga0307507_10047480 3300033179 Bacteria 4193
115 Ga0316574_0003137 3300035398 Bacteria 8451
116 Ga0373935_0008473 3300035692 Bacteria 6154
117 Ga0373927_0040716 3300035695 Bacteria 3014
118 Ga0316582_0000324 3300036647 Bacteria 16745
119 Ga0316582_0088479 3300036647 Bacteria 2034
120 Ga0395899_0072656 3300037312 Bacteria 2517
121 Ga0395900_0001460 3300037418 Bacteria 28192
122 Ga0395898_0008855 3300037466 Bacteria 10607
123 Ga0395898_0257546 3300037466 Bacteria 1664
124 Ga0395905_0002907 3300037471 Bacteria 18691
125 Ga0395901_0004855 3300038443 Bacteria 13570
126 Ga0395901_0011508 3300038443 Bacteria 8966
127 Ga0436363_1015480 3300039450 Bacteria 15225
128 Ga0466969_0087081 3300044656 Bacteria 1483
129 Ga0466966_0082435 3300044684 Bacteria 2001
130 Ga0466966_0199809 3300044684 Bacteria 1210
131 Ga0466961_0012000 3300044693 Bacteria 5537
132 Ga0466961_0012695 3300044693 Bacteria 5396
133 Ga0466963_0018551 3300044694 Bacteria 4352
134 Ga0466963_0029480 3300044694 Bacteria 3533
135 Ga0466963_0058485 3300044694 Bacteria 2570
136 Ga0466963_0141432 3300044694 Bacteria 1667
137 Ga0466970_0128847 3300044765 Bacteria 1389
138 Ga0466970_0141383 3300044765 Bacteria 1326
139 Ga0466957_0115402 3300044842 Bacteria 1707
140 Ga0466957_0156330 3300044842 Bacteria 1478
141 Ga0466960_0021433 3300044901 Bacteria 2877
142 Ga0466960_0096794 3300044901 Bacteria 1513
143 Ga0466959_0114711 3300045049 Bacteria 1919
144 Ga0466959_0202602 3300045049 Bacteria 1381
145 Ga0466967_0011362 3300045976 Bacteria 6739
146 Ga0466967_0017733 3300045976 Bacteria 5664
147 Ga0466967_0028921 3300045976 Bacteria 4632
148 Ga0466967_0040987 3300045976 Bacteria 3989
149 Ga0466967_0186757 3300045976 Bacteria 1957
150 Ga0466967_0353987 3300045976 Unclassified 1422
151 Ga0466967_0394973 3300045976 Bacteria 1345
152 Ga0495603_0119469 3300046455 Bacteria 1536
153 Ga0495629_0011402 3300046459 Bacteria 6456
154 Ga0495630_0119370 3300046517 Bacteria 2000
155 Ga0495621_0047745 3300046539 Bacteria 1523
156 Ga0495613_0138905 3300046689 Bacteria 1737
157 Ga0495581_0032550 3300047315 Bacteria 3019
158 Ga0495581_0058716 3300047315 Bacteria 2222
159 Ga0495593_0065212 3300047673 Bacteria 1899
160 Ga0496101_0013725 3300048904 Bacteria 5433
161 Ga0496102_0118133 3300048905 Bacteria 2475
162 Ga0496103_0043597 3300048906 Bacteria 2763
163 Ga0496105_0145488 3300048908 Bacteria 1949
164 Ga0496109_0040674 3300048912 Bacteria 4210
165 Ga0496110_0002898 3300048913 Bacteria 12984
166 Ga0496110_0006823 3300048913 Bacteria 9080
167 Ga0496111_0001757 3300048914 Bacteria 12694
168 Ga0496111_0056244 3300048914 Bacteria 2846
169 Ga0496113_0003571 3300048916 Bacteria 9329
170 Ga0496114_0096404 3300048917 Bacteria 2518
171 Ga0496114_0199461 3300048917 Bacteria 1752
172 Ga0496115_0132601 3300048918 Bacteria 2054
173 Ga0496117_0004281 3300048920 Bacteria 15906
174 Ga0496118_0001119 3300048921 Bacteria 41534
175 Ga0496118_0117810 3300048921 Bacteria 1741
176 Ga0496119_0019413 3300048922 Bacteria 5008
177 Ga0496122_0028944 3300048925 Bacteria 4685
178 Ga0496123_0011665 3300048926 Bacteria 7586
179 Ga0496124_0003816 3300048927 Bacteria 18081
180 Ga0496124_0099198 3300048927 Bacteria 2362
181 Ga0501032_0053755 3300049569 Bacteria 2712
182 Ga0501037_0101677 3300049573 Bacteria 2074
183 Ga0501040_0223038 3300049576 Bacteria 1341
184 Ga0501074_0022234 3300049590 Bacteria 4609
185 nmdc:mga05p37_108846_c1 3300050507 Bacteria 3409
186 nmdc:mga05p37_183_c1 3300050507 Bacteria 61506
187 nmdc:mga05p37_55628_c1 3300050507 Bacteria 4870
188 nmdc:mga09592_119075_c1 3300050508 Bacteria 2267
189 nmdc:mga09592_130315_c1 3300050508 Bacteria 2164
190 nmdc:mga0qj67_31_c3 3300050509 Bacteria 66411
191 nmdc:mga0qj67_510_c1 3300050509 Bacteria 26591
192 nmdc:mga06r32_16480_c1 3300050510 Bacteria 6734
193 nmdc:mga06r32_19_c1 3300050510 Bacteria 98901
194 nmdc:mga06r32_98051_c1 3300050510 Bacteria 2873
195 nmdc:mga08y16_99544_c1 3300050511 Bacteria 3027
196 Ga0466962_0035831 3300061719 Bacteria 2374
197 Ga0466962_0039751 3300061719 Bacteria 2252
198 Ga0466962_0125183 3300061719 Bacteria 1241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025904 Ga0207647_10056061 Ga0207647_100560611 286
2 3300025936 Ga0207670_10277557 Ga0207670_102775571 294
3 3300026116 Ga0207674_10154455 Ga0207674_101544552 321
4 3300048917 Ga0496114_0199461 Ga0496114_0199461_715_1725 328
5 3300049576 Ga0501040_0223038 Ga0501040_0223038_308_1318 328
6 3300045976 Ga0466967_0017733 Ga0466967_0017733_3382_4554 329
7 3300021377 Ga0213874_10010998 Ga0213874_100109982 336
8 3300039450 Ga0436363_1015480 Ga0436363_1015480_4176_5312 336
9 3300026095 Ga0207676_10094474 Ga0207676_100944742 339
10 3300044842 Ga0466957_0156330 Ga0466957_0156330_91_1260 339
11 3300006195 Ga0075366_10095944 Ga0075366_100959442 340
12 3300025972 Ga0207668_10024346 Ga0207668_100243463 340
13 3300045049 Ga0466959_0114711 Ga0466959_0114711_604_1761 341
14 3300061719 Ga0466962_0125183 Ga0466962_0125183_25_1182 341
15 3300028381 Ga0268264_10104145 Ga0268264_101041452 343
16 3300044765 Ga0466970_0141383 Ga0466970_0141383_92_1174 344
17 3300033179 Ga0307507_10047480 Ga0307507_100474803 348
18 3300044693 Ga0466961_0012695 Ga0466961_0012695_3720_4808 350
19 3300035692 Ga0373935_0008473 Ga0373935_0008473_2786_3955 351
20 3300005577 Ga0068857_100175535 Ga0068857_1001755352 353
21 3300005842 Ga0068858_100255012 Ga0068858_1002550122 353
22 3300009177 Ga0105248_10394950 Ga0105248_103949502 353
23 3300014325 Ga0163163_10002097 Ga0163163_100020975 353
24 3300014968 Ga0157379_10023017 Ga0157379_100230173 353
25 3300048912 Ga0496109_0040674 Ga0496109_0040674_1970_3067 353
26 3300048913 Ga0496110_0002898 Ga0496110_0002898_4547_5644 353
27 3300048914 Ga0496111_0001757 Ga0496111_0001757_485_1582 353
28 3300048916 Ga0496113_0003571 Ga0496113_0003571_861_1958 353
29 iso_pu_bacteria 2869061728 2869067405 353
30 3300009177 Ga0105248_10019979 Ga0105248_100199794 354
31 3300005329 Ga0070683_100057047 Ga0070683_1000570471 355
32 3300020082 Ga0206353_11729901 Ga0206353_117299012 355
33 3300025944 Ga0207661_10013982 Ga0207661_100139823 355
34 3300045976 Ga0466967_0040987 Ga0466967_0040987_81_1268 355
35 3300006177 Ga0075362_10009066 Ga0075362_100090664 356
36 3300035695 Ga0373927_0040716 Ga0373927_0040716_165_1310 356
37 3300044684 Ga0466966_0199809 Ga0466966_0199809_74_1183 357
38 3300044765 Ga0466970_0128847 Ga0466970_0128847_53_1159 357
39 3300047315 Ga0495581_0058716 Ga0495581_0058716_318_1460 357
40 3300048927 Ga0496124_0099198 Ga0496124_0099198_1065_2231 358
41 3300031731 Ga0307405_10114489 Ga0307405_101144892 359
42 3300031824 Ga0307413_10020427 Ga0307413_100204272 359
43 3300031901 Ga0307406_10004626 Ga0307406_100046263 359
44 3300032005 Ga0307411_10220580 Ga0307411_102205802 359
45 3300045049 Ga0466959_0202602 Ga0466959_0202602_56_1216 359
46 3300047315 Ga0495581_0032550 Ga0495581_0032550_670_1854 359
47 3300048904 Ga0496101_0013725 Ga0496101_0013725_2195_3319 359
48 3300048905 Ga0496102_0118133 Ga0496102_0118133_137_1261 359
49 3300048906 Ga0496103_0043597 Ga0496103_0043597_1324_2448 359
50 3300048921 Ga0496118_0117810 Ga0496118_0117810_580_1704 359
51 3300005563 Ga0068855_100044649 Ga0068855_1000446493 361
52 3300005614 Ga0068856_100175347 Ga0068856_1001753472 361
53 3300006048 Ga0075363_100018519 Ga0075363_1000185193 361
54 3300010375 Ga0105239_10269905 Ga0105239_102699052 361
55 3300038443 Ga0395901_0011508 Ga0395901_0011508_2945_4120 361
56 3300044694 Ga0466963_0018551 Ga0466963_0018551_793_1911 361
57 3300044842 Ga0466957_0115402 Ga0466957_0115402_440_1558 361
58 3300044901 Ga0466960_0021433 Ga0466960_0021433_880_2052 361
59 3300045976 Ga0466967_0186757 Ga0466967_0186757_316_1488 361
60 3300061719 Ga0466962_0039751 Ga0466962_0039751_840_2021 361
61 iso_pu_bacteria 2751185788 2753301866 361
62 iso_pu_bacteria 2919042368 2919046129 361
63 iso_pu_bacteria 2928104781 2928107424 361
64 iso_pu_bacteria 2984551494 2984554018 361
65 3300006847 Ga0075431_100105820 Ga0075431_1001058202 362
66 3300031995 Ga0307409_100024324 Ga0307409_1000243242 362
67 3300037466 Ga0395898_0257546 Ga0395898_0257546_123_1301 362
68 3300044694 Ga0466963_0029480 Ga0466963_0029480_299_1429 362
69 3300045976 Ga0466967_0028921 Ga0466967_0028921_2942_4072 362
70 3300046455 Ga0495603_0119469 Ga0495603_0119469_100_1293 362
71 3300046459 Ga0495629_0011402 Ga0495629_0011402_699_1892 362
72 3300046517 Ga0495630_0119370 Ga0495630_0119370_585_1778 362
73 3300046689 Ga0495613_0138905 Ga0495613_0138905_363_1556 362
74 3300047673 Ga0495593_0065212 Ga0495593_0065212_15_1208 362
75 3300050510 nmdc:mga06r32_98051_c1 nmdc:mga06r32_98051_c1_451_1545 362
76 iso_pu_bacteria 2832004796 2832010524 362
77 iso_pu_bacteria 2866065130 2866066438 362
78 iso_pu_bacteria 2904501621 2904502863 362
79 iso_pu_bacteria 2908674828 2908677912 362
80 iso_pu_bacteria 2909074476 2909075017 362
81 iso_pu_bacteria 2919039151 2919042324 362
82 iso_pu_bacteria 2928500415 2928503636 362
83 3300005455 Ga0070663_100105655 Ga0070663_1001056552 363
84 3300006844 Ga0075428_100005879 Ga0075428_1000058793 363
85 3300006844 Ga0075428_100334406 Ga0075428_1003344062 363
86 3300006847 Ga0075431_100262023 Ga0075431_1002620232 363
87 3300026067 Ga0207678_10070074 Ga0207678_100700742 363
88 3300028794 Ga0307515_10000356 Ga0307515_100003569 363
89 3300028794 Ga0307515_10058708 Ga0307515_100587084 363
90 3300031507 Ga0307509_10157147 Ga0307509_101571472 363
91 3300031730 Ga0307516_10006104 Ga0307516_100061044 363
92 3300031730 Ga0307516_10029063 Ga0307516_100290634 363
93 3300046539 Ga0495621_0047745 Ga0495621_0047745_368_1498 363
94 3300048920 Ga0496117_0004281 Ga0496117_0004281_7243_8394 363
95 3300048921 Ga0496118_0001119 Ga0496118_0001119_7283_8434 363
96 3300048922 Ga0496119_0019413 Ga0496119_0019413_1661_2812 363
97 3300048925 Ga0496122_0028944 Ga0496122_0028944_2189_3340 363
98 3300048926 Ga0496123_0011665 Ga0496123_0011665_5419_6570 363
99 3300048927 Ga0496124_0003816 Ga0496124_0003816_179_1330 363
100 3300044684 Ga0466966_0082435 Ga0466966_0082435_51_1232 364
101 3300044694 Ga0466963_0058485 Ga0466963_0058485_780_1961 364
102 3300061719 Ga0466962_0035831 Ga0466962_0035831_348_1529 364
103 iso_pu_bacteria 8001781756 8001789942 364
104 3300005563 Ga0068855_100280342 Ga0068855_1002803422 365
105 3300005617 Ga0068859_100010128 Ga0068859_1000101284 365
106 3300005618 Ga0068864_100302523 Ga0068864_1003025232 365
107 3300006931 Ga0097620_100010128 Ga0097620_1000101288 365
108 3300013297 Ga0157378_10184345 Ga0157378_101843452 365
109 3300031507 Ga0307509_10010616 Ga0307509_100106163 365
110 3300031727 Ga0316576_10027343 Ga0316576_100273432 365
111 3300031728 Ga0316578_10002566 Ga0316578_100025665 365
112 3300031733 Ga0316577_10020612 Ga0316577_100206123 365
113 3300032139 Ga0316580_10003424 Ga0316580_100034243 365
114 3300035398 Ga0316574_0003137 Ga0316574_0003137_4841_5998 365
115 3300036647 Ga0316582_0088479 Ga0316582_0088479_241_1398 365
116 3300044694 Ga0466963_0141432 Ga0466963_0141432_146_1276 365
117 3300045976 Ga0466967_0353987 Ga0466967_0353987_183_1313 365
118 iso_pu_bacteria 2751185782 2753268319 365
119 iso_pu_bacteria 3001889506 3001891289 365
120 3300005618 Ga0068864_100014012 Ga0068864_1000140122 366
121 3300006844 Ga0075428_100242317 Ga0075428_1002423172 366
122 3300006880 Ga0075429_100051415 Ga0075429_1000514153 366
123 3300031691 Ga0316579_10010895 Ga0316579_100108956 366
124 3300031727 Ga0316576_10001270 Ga0316576_100012703 366
125 3300031733 Ga0316577_10130898 Ga0316577_101308982 366
126 3300032137 Ga0316585_10007294 Ga0316585_100072943 366
127 3300036647 Ga0316582_0000324 Ga0316582_0000324_3521_4681 366
128 3300044693 Ga0466961_0012000 Ga0466961_0012000_2103_3299 366
129 3300050507 nmdc:mga05p37_55628_c1 nmdc:mga05p37_55628_c1_3397_4527 366
130 3300050508 nmdc:mga09592_119075_c1 nmdc:mga09592_119075_c1_865_1995 366
131 iso_pu_bacteria 2675903059 2676483538 366
132 iso_pu_bacteria 8003856774 8003857895 366
133 3300005329 Ga0070683_100002409 Ga0070683_10000240912 367
134 3300005334 Ga0068869_100019875 Ga0068869_1000198752 367
135 3300005338 Ga0068868_100025974 Ga0068868_1000259742 367
136 3300005344 Ga0070661_100047239 Ga0070661_1000472392 367
137 3300005353 Ga0070669_100034319 Ga0070669_1000343192 367
138 3300005354 Ga0070675_100000270 Ga0070675_10000027013 367
139 3300005366 Ga0070659_100076068 Ga0070659_1000760682 367
140 3300005457 Ga0070662_100035233 Ga0070662_1000352332 367
141 3300005535 Ga0070684_100059591 Ga0070684_1000595914 367
142 3300005564 Ga0070664_100001748 Ga0070664_1000017482 367
143 3300005577 Ga0068857_100002633 Ga0068857_1000026337 367
144 3300005615 Ga0070702_100020516 Ga0070702_1000205162 367
145 3300005843 Ga0068860_100172560 Ga0068860_1001725602 367
146 3300005844 Ga0068862_100325332 Ga0068862_1003253322 367
147 3300006844 Ga0075428_100059157 Ga0075428_1000591573 367
148 3300009094 Ga0111539_10014557 Ga0111539_100145577 367
149 3300009147 Ga0114129_10004038 Ga0114129_100040386 367
150 3300014326 Ga0157380_10173757 Ga0157380_101737572 367
151 3300014968 Ga0157379_10162618 Ga0157379_101626182 367
152 3300025918 Ga0207662_10142894 Ga0207662_101428942 367
153 3300025926 Ga0207659_10001393 Ga0207659_1000139312 367
154 3300025927 Ga0207687_10020521 Ga0207687_100205214 367
155 3300025932 Ga0207690_10010314 Ga0207690_100103144 367
156 3300025933 Ga0207706_10023651 Ga0207706_100236514 367
157 3300025942 Ga0207689_10004062 Ga0207689_100040625 367
158 3300025944 Ga0207661_10001637 Ga0207661_100016372 367
159 3300025945 Ga0207679_10019713 Ga0207679_100197132 367
160 3300026023 Ga0207677_10001058 Ga0207677_100010589 367
161 3300026116 Ga0207674_10004493 Ga0207674_100044935 367
162 3300027907 Ga0207428_10119681 Ga0207428_101196812 367
163 3300031616 Ga0307508_10044958 Ga0307508_100449584 367
164 3300044656 Ga0466969_0087081 Ga0466969_0087081_29_1228 367
165 3300049569 Ga0501032_0053755 Ga0501032_0053755_883_2049 367
166 3300049573 Ga0501037_0101677 Ga0501037_0101677_184_1350 367
167 3300049590 Ga0501074_0022234 Ga0501074_0022234_2486_3652 367
168 3300050511 nmdc:mga08y16_99544_c1 nmdc:mga08y16_99544_c1_939_2087 367
169 iso_pu_bacteria 2501939600 2501945129 367
170 iso_pu_bacteria 2515154129 2515719123 367
171 iso_pu_bacteria 2515154202 2516083330 367
172 iso_pu_bacteria 2515154203 2516088565 367
173 iso_pu_bacteria 2622736626 2623590827 367
174 iso_pu_bacteria 2772190715 2772644197 367
175 iso_pu_bacteria 2831935698 2831936303 367
176 iso_pu_bacteria 2855676851 2855678652 367
177 iso_pu_bacteria 2856858025 2856864490 367
178 iso_pu_bacteria 2857288857 2857289317 367
179 iso_pu_bacteria 2858848962 2858855171 367
180 iso_pu_bacteria 2858868258 2858873413 367
181 iso_pu_bacteria 2858882152 2858888736 367
182 iso_pu_bacteria 2858888857 2858888989 367
183 iso_pu_bacteria 2858895516 2858897417 367
184 iso_pu_bacteria 2858902515 2858905766 367
185 iso_pu_bacteria 2867302475 2867303530 367
186 iso_pu_bacteria 2867312974 2867316117 367
187 iso_pu_bacteria 2867319477 2867320983 367
188 iso_pu_bacteria 2867507094 2867511765 367
189 iso_pu_bacteria 2869068681 2869074517 367
190 iso_pu_bacteria 2880489317 2880489675 367
191 iso_pu_bacteria 2880495981 2880496028 367
192 iso_pu_bacteria 2902582711 2902583429 367
193 iso_pu_bacteria 2929219909 2929224702 367
194 iso_pu_bacteria 2996221748 2996227563 367
195 iso_pu_bacteria 8003870546 8003878054 367
196 iso_pu_bacteria 8054704163 8054707764 367
197 iso_pu_bacteria 8054727385 8054732792 367
198 iso_pu_bacteria 8054734606 8054739019 367
199 3300006847 Ga0075431_100048850 Ga0075431_1000488503 368
200 3300009147 Ga0114129_10090928 Ga0114129_100909283 368
201 3300031901 Ga0307406_10041057 Ga0307406_100410573 368
202 3300031995 Ga0307409_100009793 Ga0307409_1000097935 368
203 3300032005 Ga0307411_10021365 Ga0307411_100213653 368
204 3300037312 Ga0395899_0072656 Ga0395899_0072656_543_1703 368
205 3300037418 Ga0395900_0001460 Ga0395900_0001460_22898_24058 368
206 3300037466 Ga0395898_0008855 Ga0395898_0008855_5312_6472 368
207 3300037471 Ga0395905_0002907 Ga0395905_0002907_9017_10177 368
208 3300038443 Ga0395901_0004855 Ga0395901_0004855_3896_5056 368
209 3300048917 Ga0496114_0096404 Ga0496114_0096404_903_2072 368
210 3300050510 nmdc:mga06r32_16480_c1 nmdc:mga06r32_16480_c1_4292_5467 368
211 3300005436 Ga0070713_100089366 Ga0070713_1000893662 369
212 3300025928 Ga0207700_10035200 Ga0207700_100352002 369
213 3300045976 Ga0466967_0394973 Ga0466967_0394973_104_1276 369
214 3300048908 Ga0496105_0145488 Ga0496105_0145488_701_1876 369
215 3300048913 Ga0496110_0006823 Ga0496110_0006823_978_2153 369
216 3300048914 Ga0496111_0056244 Ga0496111_0056244_1054_2229 369
217 3300048918 Ga0496115_0132601 Ga0496115_0132601_580_1755 369
218 3300009551 Ga0105238_10341189 Ga0105238_103411892 370
219 3300031852 Ga0307410_10153211 Ga0307410_101532112 370
220 3300031901 Ga0307406_10115940 Ga0307406_101159402 370
221 3300031903 Ga0307407_10189360 Ga0307407_101893601 370
222 3300032002 Ga0307416_100005180 Ga0307416_1000051805 370
223 3300032002 Ga0307416_100029630 Ga0307416_1000296302 370
224 3300032126 Ga0307415_100067299 Ga0307415_1000672993 370
225 3300044901 Ga0466960_0096794 Ga0466960_0096794_129_1313 370
226 3300045976 Ga0466967_0011362 Ga0466967_0011362_5030_6205 370
227 iso_pu_bacteria 2622736605 2623498588 370
228 iso_pu_bacteria 8057568493 8057568730 370
229 3300009147 Ga0114129_10037325 Ga0114129_100373254 372
230 3300050507 nmdc:mga05p37_108846_c1 nmdc:mga05p37_108846_c1_2203_3375 372
231 3300050508 nmdc:mga09592_130315_c1 nmdc:mga09592_130315_c1_239_1411 372
232 3300006844 Ga0075428_100000984 Ga0075428_10000098423 373
233 3300006846 Ga0075430_100000909 Ga0075430_10000090919 373
234 3300006846 Ga0075430_100001883 Ga0075430_10000188310 373
235 3300006846 Ga0075430_100215751 Ga0075430_1002157512 373
236 3300006847 Ga0075431_100004163 Ga0075431_10000416312 373
237 3300006880 Ga0075429_100000467 Ga0075429_10000046723 373
238 3300009147 Ga0114129_10000059 Ga0114129_1000005983 373
239 3300050507 nmdc:mga05p37_183_c1 nmdc:mga05p37_183_c1_58756_59937 373
240 3300050509 nmdc:mga0qj67_31_c3 nmdc:mga0qj67_31_c3_59767_60948 373
241 3300050509 nmdc:mga0qj67_510_c1 nmdc:mga0qj67_510_c1_7382_8566 373
242 3300050510 nmdc:mga06r32_19_c1 nmdc:mga06r32_19_c1_5338_6519 373
243 3300005329 Ga0070683_100000985 Ga0070683_10000098519 374
244 3300025912 Ga0207707_10143914 Ga0207707_101439142 374
245 3300025944 Ga0207661_10003403 Ga0207661_100034033 374
246 3300025945 Ga0207679_10024115 Ga0207679_100241153 374
247 3300028794 Ga0307515_10014889 Ga0307515_100148899 374
248 iso_pu_bacteria 2861520306 2861520899 374

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01663

Phosphodiest

Type I phosphodiesterase / nucleotide pyrophosphatase

94

414

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gtz-assembly1.cif.gz_A crystal structure of mouse enpp1 in complex with cmp 0.8178 42 365
7cba-assembly2.cif.gz_B crystal structure of snake venom phosphodiesterase (pde) from taiwan cobra (naja atra atra) in complex with isorhamnetin and citrate 0.8133 38 365
6c01-assembly2.cif.gz_B human ectonucleotide pyrophosphatase / phosphodiesterase 3 (enpp3, npp3, cd203c) 0.8121 38 365
3igy-assembly1.cif.gz_B crystal structures of leishmania mexicana phosphoglycerate mutase at high cobalt concentrations 0.8099 129 240
6aek-assembly1.cif.gz_A crystal structure of enpp1 in complex with papg 0.8094 42 365
ID Description Score Start End Superfamily
af_Q4D8M1_2_151_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8417 194 240 3.40.720.10
4b56B01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8078 42 240 3.40.720.10
2gsnB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8044 42 240 3.40.720.10
af_Q22129_14_436_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8022 42 367 3.40.720.10
4lqyA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7976 42 240 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A6N9Y6F9-F1-model_v4 deleted 0.9908 218 368
AF-A0A6V8K5A0-F1-model_v4 Alkaline phosphatase family protein 0.9898 3 369 GO:0006796
GO:0016787
AF-A0A1Q7C1K3-F1-model_v4 Alkaline phosphatase family protein 0.9889 32 369 GO:0006796
GO:0016787
AF-A0A1C6RMC4-F1-model_v4 Type I phosphodiesterase / nucleotide pyrophosphatase 0.9885 3 368 GO:0006796
GO:0016787
AF-A0A1A9B8S0-F1-model_v4 Type I phosphodiesterase / nucleotide pyrophosphatase 0.9878 3 368 GO:0006796
GO:0016787

Feature Viewer

pLDDT pTM Quality
96.07 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map