F360176

General Info

Members Datasets Scaffolds Average Seq Length
248 190 221 310

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0030768|Ga0495625_0030768_1471_2532
Length 344
Sequence LSRAGEVADPAIRRSGKALRMKAFIVDRYQKKGALRFGDMPEPIFGQDDVLVEIHAAGLNPLDSKIRDGAFKALIPYRPPFILGHDLAGIVVRVGANVGHFKPGDEVYARPRDGRIGTFAEHIAIDQADVALKPRTISMVEAASIPLAGLTAWQALVEQAGLKEGQKVLIHAGSGGVGTIAIQLAKHLGATVATTTSTANDIVIDYRKQDFQKLLSGYDVVLNSLDGATLRKSLDVLKPGGRLISISGPPDADFARDQGLNWLLRQVMRLLSFRIRRKAAALGVRYSFLFMRANGSQLGEITALVEKGFIRPVVDRIFPFDATNEALAYVETGRVKGKVVVNLR

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
3 2643221714 Streptomyces sp. Root264 Isolate Unclassified
4 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
5 2738541358 Bacillus sp. OV752 Isolate Unclassified
6 2738543006 Bacillus sp. OK077 Isolate Unclassified
7 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
8 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
9 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
10 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
11 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
12 2891562705 Microbispora tritici MT50 Isolate Unclassified
13 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
14 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
15 2965761152 Bacillus sp. COPE52 Isolate Unclassified
16 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
17 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
18 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
19 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
181 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
182 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
183 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
184 8023444577 Bacillus sp. BH32 Isolate Unclassified
185 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
186 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
187 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
188 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
189 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
190 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.11
Metatranscriptomes 0
Isolates 10.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.1
Nodule 0
Rhizoplane 5.65
Rhizosphere 65.32
Stem 0
Stem Tuber 0
Unclassified 16.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000926 3300002987 Bacteria 12771
2 JGI25159J45721_1015858 3300002987 Bacteria 1632
3 JGI25151J46595_10006416 3300003187 Bacteria 5914
4 JGI25151J46595_10009302 3300003187 Bacteria 4660
5 JGI25151J46595_10010754 3300003187 Bacteria 4235
6 JGI25151J46595_10055982 3300003187 Bacteria 1296
7 rootL2_10069414 3300003322 Bacteria 7788
8 rootH1_10239843 3300003323 Bacteria 3094
9 Ga0055525_1000030 3300003759 Bacteria 318094
10 Ga0055527_1000033 3300003760 Bacteria 140664
11 Ga0055535_1001782 3300003761 Bacteria 9466
12 Ga0055542_1000075 3300003762 Bacteria 140936
13 Ga0055529_1001244 3300003763 Bacteria 9468
14 Ga0065715_10188005 3300005293 Bacteria 1419
15 Ga0070676_10174567 3300005328 Bacteria 1393
16 Ga0070689_100082992 3300005340 Bacteria 2518
17 Ga0070687_100112311 3300005343 Bacteria 1544
18 Ga0070668_100000404 3300005347 Bacteria 28624
19 Ga0070668_100182417 3300005347 Bacteria 1715
20 Ga0070669_100005283 3300005353 Bacteria 9325
21 Ga0070671_100030410 3300005355 Bacteria 4456
22 Ga0070667_100000022 3300005367 Bacteria 204861
23 Ga0070681_10496556 3300005458 Bacteria 1133
24 Ga0070699_100354901 3300005518 Bacteria 1321
25 Ga0070679_100057788 3300005530 Bacteria 3866
26 Ga0068853_100238971 3300005539 Bacteria 1664
27 Ga0070665_100002997 3300005548 Bacteria 18231
28 Ga0070665_100019097 3300005548 Bacteria 6877
29 Ga0068855_100156319 3300005563 Bacteria 2590
30 Ga0068855_100376472 3300005563 Bacteria 1559
31 Ga0068854_100000935 3300005578 Bacteria 17548
32 Ga0068859_100002659 3300005617 Bacteria 18141
33 Ga0068863_100000141 3300005841 Bacteria 75574
34 Ga0068863_100001550 3300005841 Bacteria 22696
35 Ga0068860_100000038 3300005843 Bacteria 232936
36 Ga0068860_100007882 3300005843 Bacteria 10634
37 Ga0068862_100000064 3300005844 Bacteria 124473
38 Ga0081538_10007232 3300005981 Bacteria 9632
39 Ga0081539_10000988 3300005985 Bacteria 52904
40 Ga0070717_10387145 3300006028 Bacteria 1254
41 Ga0075430_100027322 3300006846 Bacteria 4849
42 Ga0097620_100002659 3300006931 Bacteria 18141
43 Ga0105251_10053182 3300009011 Bacteria 1926
44 Ga0105244_10014792 3300009036 Bacteria 4497
45 Ga0105244_10103622 3300009036 Bacteria 1390
46 Ga0105250_10002454 3300009092 Bacteria 9309
47 Ga0105240_10000001 3300009093 Bacteria 2887840
48 Ga0105247_10000021 3300009101 Bacteria 229443
49 Ga0114129_10120311 3300009147 Bacteria 3616
50 Ga0114129_10182489 3300009147 Bacteria 2855
51 Ga0105241_10008773 3300009174 Bacteria 7429
52 Ga0105248_10000141 3300009177 Bacteria 82929
53 Ga0105238_10167046 3300009551 Bacteria 2176
54 Ga0105249_10000060 3300009553 Bacteria 153462
55 Ga0105029_101189 3300009984 Bacteria 1576
56 Ga0157369_10000343 3300013105 Bacteria 61648
57 Ga0157369_10108005 3300013105 Bacteria 2960
58 Ga0157369_10216735 3300013105 Bacteria 2005
59 Ga0157375_10551779 3300013308 Bacteria 1314
60 Ga0157379_10009617 3300014968 Bacteria 8418
61 Ga0209672_100004 3300025228 Bacteria 1467504
62 Ga0209563_100028 3300025230 Bacteria 509539
63 Ga0209258_100003 3300025242 Bacteria 1467504
64 Ga0209148_1000016 3300025254 Bacteria 804369
65 Ga0209455_1000004 3300025272 Bacteria 1467504
66 Ga0209130_1000213 3300025284 Bacteria 76301
67 Ga0209130_1000875 3300025284 Bacteria 24644
68 Ga0209025_1000143 3300025294 Bacteria 181917
69 Ga0209025_1002120 3300025294 Bacteria 22339
70 Ga0209025_1005388 3300025294 Bacteria 10469
71 Ga0209025_1005783 3300025294 Bacteria 9919
72 Ga0209025_1007234 3300025294 Bacteria 8351
73 Ga0209025_1014375 3300025294 Bacteria 4872
74 Ga0209025_1027970 3300025294 Bacteria 2777
75 Ga0209025_1037668 3300025294 Bacteria 2141
76 Ga0207696_1002454 3300025711 Bacteria 9072
77 Ga0207696_1033164 3300025711 Bacteria 1549
78 Ga0207655_1009559 3300025728 Bacteria 6006
79 Ga0207655_1085163 3300025728 Bacteria 1128
80 Ga0207692_10171333 3300025898 Bacteria 1258
81 Ga0207710_10000027 3300025900 Bacteria 307001
82 Ga0207647_10000849 3300025904 Bacteria 23718
83 Ga0207699_10027730 3300025906 Bacteria 3140
84 Ga0207643_10055201 3300025908 Bacteria 2259
85 Ga0207707_10052787 3300025912 Bacteria 3538
86 Ga0207695_10000001 3300025913 Bacteria 2888630
87 Ga0207695_10013047 3300025913 Bacteria 9925
88 Ga0207671_10000654 3300025914 Bacteria 45328
89 Ga0207681_10196178 3300025923 Bacteria 1548
90 Ga0207664_10199050 3300025929 Bacteria 1728
91 Ga0207644_10032305 3300025931 Bacteria 3651
92 Ga0207690_10084797 3300025932 Bacteria 2222
93 Ga0207711_10000311 3300025941 Bacteria 52029
94 Ga0207689_10203402 3300025942 Bacteria 1635
95 Ga0207651_10106154 3300025960 Bacteria 2097
96 Ga0207712_10000051 3300025961 Bacteria 153466
97 Ga0207668_10037924 3300025972 Bacteria 3230
98 Ga0207668_10059112 3300025972 Bacteria 2684
99 Ga0207658_10000716 3300025986 Bacteria 28697
100 Ga0207703_10099801 3300026035 Bacteria 2458
101 Ga0207678_10188317 3300026067 Bacteria 1763
102 Ga0207641_10000162 3300026088 Bacteria 94111
103 Ga0207641_10005300 3300026088 Bacteria 11017
104 Ga0207675_100006487 3300026118 Bacteria 11069
105 Ga0268266_10011762 3300028379 Bacteria 7591
106 Ga0268266_10019236 3300028379 Bacteria 5816
107 Ga0268266_10368624 3300028379 Unclassified 1352
108 Ga0268265_10000028 3300028380 Bacteria 236467
109 Ga0268264_10000092 3300028381 Bacteria 232950
110 Ga0268264_10085679 3300028381 Bacteria 2705
111 Ga0265324_10018772 3300029957 Unclassified 2495
112 Ga0307512_10077267 3300030522 Bacteria 2421
113 Ga0307513_10000002 3300031456 Bacteria 842612
114 Ga0307509_10185911 3300031507 Bacteria 1936
115 Ga0307508_10033541 3300031616 Bacteria 4634
116 Ga0307508_10093660 3300031616 Bacteria 2594
117 Ga0307416_100347489 3300032002 Bacteria 1499
118 Ga0307411_10029270 3300032005 Bacteria 3360
119 Ga0307415_100000994 3300032126 Bacteria 13080
120 Ga0373953_0007349 3300035117 Bacteria 3685
121 Ga0373956_0057945 3300035119 Bacteria 1751
122 Ga0373946_0000148 3300035171 Bacteria 21418
123 Ga0373937_0166515 3300036401 Bacteria 2067
124 Ga0237819_00107 3300038705 Bacteria 30668
125 Ga0237819_01242 3300038705 Bacteria 7045
126 Ga0439460_0009005 3300042461 Bacteria 2526
127 Ga0466969_0002255 3300044656 Bacteria 10305
128 Ga0466969_0008754 3300044656 Bacteria 5364
129 Ga0466969_0103245 3300044656 Bacteria 1340
130 Ga0466969_0148643 3300044656 Bacteria 1080
131 Ga0466972_0096864 3300044658 Bacteria 1397
132 Ga0453683_0000287 3300044673 Bacteria 65266
133 Ga0466965_0020729 3300044683 Bacteria 3162
134 Ga0466966_0099348 3300044684 Bacteria 1801
135 Ga0466966_0122503 3300044684 Bacteria 1596
136 Ga0466961_0034628 3300044693 Bacteria 3242
137 Ga0466961_0056214 3300044693 Bacteria 2507
138 Ga0466963_0011350 3300044694 Bacteria 5422
139 Ga0453684_0173542 3300044712 Bacteria 2538
140 Ga0466970_0097638 3300044765 Bacteria 1598
141 Ga0466970_0141787 3300044765 Bacteria 1324
142 Ga0466957_0176336 3300044842 Bacteria 1394
143 Ga0466960_0001649 3300044901 Bacteria 8175
144 Ga0466960_0082041 3300044901 Unclassified 1627
145 Ga0466959_0001411 3300045049 Bacteria 14688
146 Ga0466959_0141582 3300045049 Bacteria 1699
147 Ga0466959_0159017 3300045049 Bacteria 1589
148 Ga0451576_0775572 3300045051 Unclassified 1007
149 Ga0466958_0127870 3300045836 Bacteria 1594
150 Ga0466967_0124524 3300045976 Bacteria 2386
151 Ga0466967_0230985 3300045976 Bacteria 1761
152 Ga0495592_0158768 3300046454 Bacteria 1558
153 Ga0495651_0060520 3300046462 Bacteria 2900
154 Ga0495653_0053900 3300046463 Bacteria 3075
155 Ga0495583_0006119 3300046506 Bacteria 7939
156 Ga0495630_0276942 3300046517 Bacteria 1282
157 Ga0495667_0049729 3300046559 Bacteria 2767
158 Ga0495668_0007010 3300046616 Bacteria 7277
159 Ga0495625_0030768 3300046660 Bacteria 4000
160 Ga0495657_0121420 3300046675 Bacteria 1645
161 Ga0495623_0164402 3300046679 Bacteria 1302
162 Ga0495604_0004272 3300047317 Bacteria 11314
163 Ga0495680_0011038 3300047322 Bacteria 8025
164 Ga0495677_0013976 3300047445 Bacteria 2923
165 Ga0495684_0003425 3300047471 Bacteria 12434
166 Ga0496100_0011859 3300048903 Bacteria 4975
167 Ga0496101_0001183 3300048904 Bacteria 15603
168 Ga0496102_0000363 3300048905 Bacteria 54674
169 Ga0496102_0000458 3300048905 Bacteria 45701
170 Ga0496102_0335517 3300048905 Bacteria 1424
171 Ga0496103_0000196 3300048906 Bacteria 60369
172 Ga0496103_0000466 3300048906 Bacteria 34185
173 Ga0496104_0530040 3300048907 Bacteria 1089
174 Ga0496106_0015855 3300048909 Bacteria 5573
175 Ga0496107_0344763 3300048910 Bacteria 1108
176 Ga0496108_0171524 3300048911 Bacteria 1877
177 Ga0496109_0439675 3300048912 Bacteria 1232
178 Ga0496114_0177960 3300048917 Bacteria 1856
179 Ga0496116_0000269 3300048919 Bacteria 90518
180 Ga0496116_0027360 3300048919 Bacteria 4153
181 Ga0496117_0000568 3300048920 Bacteria 60692
182 Ga0496117_0010358 3300048920 Bacteria 8515
183 Ga0496118_0000136 3300048921 Bacteria 130016
184 Ga0496118_0004365 3300048921 Bacteria 16817
185 Ga0496119_0004758 3300048922 Bacteria 13337
186 Ga0496119_0172414 3300048922 Unclassified 1141
187 Ga0496120_0092723 3300048923 Bacteria 1610
188 Ga0496121_0003515 3300048924 Bacteria 22263
189 Ga0496121_0005922 3300048924 Bacteria 15464
190 Ga0496122_0002464 3300048925 Bacteria 26185
191 Ga0496124_0140494 3300048927 Bacteria 1906
192 Ga0496125_0010158 3300048928 Bacteria 9540
193 Ga0496125_0021201 3300048928 Bacteria 6069
194 Ga0496126_0000799 3300048929 Bacteria 56430
195 Ga0496126_0009328 3300048929 Bacteria 10442
196 Ga0501032_0006076 3300049569 Bacteria 8897
197 Ga0501032_0271669 3300049569 Bacteria 1098
198 Ga0501033_0025229 3300049570 Bacteria 4478
199 Ga0501033_0116068 3300049570 Bacteria 1945
200 Ga0501034_0046338 3300049571 Bacteria 4393
201 Ga0501034_0091127 3300049571 Bacteria 3046
202 Ga0501036_0074541 3300049572 Bacteria 2870
203 Ga0501037_0094523 3300049573 Bacteria 2161
204 Ga0501037_0241578 3300049573 Bacteria 1266
205 Ga0501038_0071800 3300049574 Bacteria 2935
206 Ga0501039_0056211 3300049575 Bacteria 3048
207 Ga0501043_0034023 3300049579 Bacteria 4008
208 Ga0501047_0057783 3300049581 Bacteria 3750
209 Ga0501047_0308433 3300049581 Bacteria 1424
210 Ga0501070_0195280 3300049586 Bacteria 1662
211 Ga0501080_0575310 3300049742 Bacteria 1002
212 Ga0501083_0044143 3300049744 Bacteria 3018
213 Ga0501035_0036421 3300049822 Bacteria 4458
214 Ga0501044_0019406 3300049823 Bacteria 7274
215 Ga0501044_0063122 3300049823 Bacteria 3785
216 Ga0501045_0080935 3300049824 Bacteria 2395
217 nmdc:mga08y16_593078_c1 3300050511 Bacteria 1117
218 Ga0500566_0004805 3300053094 Bacteria 8050
219 Ga0500568_0000054 3300053139 Bacteria 111105
220 Ga0500585_107131 3300053144 Bacteria 1004
221 Ga0500603_000867 3300053150 Bacteria 7205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0172414 Ga0496119_0172414_304_1119 265
2 3300048910 Ga0496107_0344763 Ga0496107_0344763_177_1016 268
3 3300045976 Ga0466967_0230985 Ga0466967_0230985_461_1411 273
4 iso_pu_bacteria 2643221714 2644626068 275
5 3300009984 Ga0105029_101189 Ga0105029_1011892 281
6 3300046679 Ga0495623_0164402 Ga0495623_0164402_264_1196 281
7 3300053144 Ga0500585_107131 Ga0500585_107131_98_973 281
8 3300009093 Ga0105240_10000001 Ga0105240_100000011881 288
9 3300025908 Ga0207643_10055201 Ga0207643_100552012 288
10 3300025913 Ga0207695_10000001 Ga0207695_100000011884 288
11 3300050511 nmdc:mga08y16_593078_c1 nmdc:mga08y16_593078_c1_68_1066 288
12 3300003759 Ga0055525_1000030 Ga0055525_1000030200 289
13 3300003760 Ga0055527_1000033 Ga0055527_100003396 289
14 3300003761 Ga0055535_1001782 Ga0055535_100178211 289
15 3300003762 Ga0055542_1000075 Ga0055542_10000753 289
16 3300005328 Ga0070676_10174567 Ga0070676_101745672 289
17 3300025228 Ga0209672_100004 Ga0209672_1000044 289
18 3300025230 Ga0209563_100028 Ga0209563_10002866 289
19 3300025242 Ga0209258_100003 Ga0209258_1000034 289
20 3300025254 Ga0209148_1000016 Ga0209148_10000164 289
21 3300025272 Ga0209455_1000004 Ga0209455_10000044 289
22 3300042461 Ga0439460_0009005 Ga0439460_0009005_1070_2071 289
23 3300045051 Ga0451576_0775572 Ga0451576_0775572_103_987 289
24 3300049744 Ga0501083_0044143 Ga0501083_0044143_44_1042 289
25 3300003763 Ga0055529_1001244 Ga0055529_100124411 290
26 3300025960 Ga0207651_10106154 Ga0207651_101061542 290
27 3300030522 Ga0307512_10077267 Ga0307512_100772672 290
28 3300044658 Ga0466972_0096864 Ga0466972_0096864_243_1193 290
29 3300044683 Ga0466965_0020729 Ga0466965_0020729_1635_2585 290
30 3300044765 Ga0466970_0097638 Ga0466970_0097638_331_1281 290
31 3300044901 Ga0466960_0001649 Ga0466960_0001649_539_1489 290
32 3300005353 Ga0070669_100005283 Ga0070669_1000052834 291
33 3300005367 Ga0070667_100000022 Ga0070667_10000002241 291
34 3300005548 Ga0070665_100019097 Ga0070665_1000190976 291
35 3300005617 Ga0068859_100002659 Ga0068859_1000026593 291
36 3300005841 Ga0068863_100000141 Ga0068863_10000014191 291
37 3300005843 Ga0068860_100000038 Ga0068860_100000038189 291
38 3300005844 Ga0068862_100000064 Ga0068862_10000006466 291
39 3300005985 Ga0081539_10000988 Ga0081539_1000098856 291
40 3300006931 Ga0097620_100002659 Ga0097620_10000265919 291
41 3300009101 Ga0105247_10000021 Ga0105247_1000002173 291
42 3300009177 Ga0105248_10000141 Ga0105248_1000014110 291
43 3300009553 Ga0105249_10000060 Ga0105249_1000006019 291
44 3300025900 Ga0207710_10000027 Ga0207710_1000002773 291
45 3300025923 Ga0207681_10196178 Ga0207681_101961782 291
46 3300025941 Ga0207711_10000311 Ga0207711_1000031110 291
47 3300025961 Ga0207712_10000051 Ga0207712_10000051156 291
48 3300025986 Ga0207658_10000716 Ga0207658_100007164 291
49 3300026035 Ga0207703_10099801 Ga0207703_100998012 291
50 3300026088 Ga0207641_10000162 Ga0207641_1000016274 291
51 3300028379 Ga0268266_10368624 Ga0268266_103686242 291
52 3300028380 Ga0268265_10000028 Ga0268265_10000028192 291
53 3300028381 Ga0268264_10000092 Ga0268264_1000009274 291
54 3300048905 Ga0496102_0000458 Ga0496102_0000458_37610_38548 291
55 3300048906 Ga0496103_0000466 Ga0496103_0000466_26746_27684 291
56 3300048919 Ga0496116_0027360 Ga0496116_0027360_1141_2079 291
57 3300048920 Ga0496117_0010358 Ga0496117_0010358_6086_7024 291
58 3300048921 Ga0496118_0004365 Ga0496118_0004365_10962_11900 291
59 3300048923 Ga0496120_0092723 Ga0496120_0092723_215_1153 291
60 3300048924 Ga0496121_0005922 Ga0496121_0005922_1423_2361 291
61 3300048928 Ga0496125_0010158 Ga0496125_0010158_4897_5835 291
62 3300048929 Ga0496126_0009328 Ga0496126_0009328_2273_3211 291
63 3300005841 Ga0068863_100001550 Ga0068863_1000015507 292
64 3300014968 Ga0157379_10009617 Ga0157379_100096174 292
65 3300025972 Ga0207668_10037924 Ga0207668_100379244 292
66 3300026088 Ga0207641_10005300 Ga0207641_100053007 292
67 3300048903 Ga0496100_0011859 Ga0496100_0011859_1386_2339 292
68 3300048904 Ga0496101_0001183 Ga0496101_0001183_3908_4861 292
69 3300048905 Ga0496102_0000363 Ga0496102_0000363_35674_36627 292
70 3300048906 Ga0496103_0000196 Ga0496103_0000196_23762_24715 292
71 3300048911 Ga0496108_0171524 Ga0496108_0171524_182_1135 292
72 3300048912 Ga0496109_0439675 Ga0496109_0439675_225_1178 292
73 3300048919 Ga0496116_0000269 Ga0496116_0000269_61183_62136 292
74 3300048920 Ga0496117_0000568 Ga0496117_0000568_35978_36931 292
75 3300048921 Ga0496118_0000136 Ga0496118_0000136_93390_94343 292
76 3300048924 Ga0496121_0003515 Ga0496121_0003515_5334_6287 292
77 3300048927 Ga0496124_0140494 Ga0496124_0140494_735_1688 292
78 3300048928 Ga0496125_0021201 Ga0496125_0021201_694_1647 292
79 3300048929 Ga0496126_0000799 Ga0496126_0000799_5159_6112 292
80 3300013105 Ga0157369_10000343 Ga0157369_1000034349 294
81 3300045049 Ga0466959_0141582 Ga0466959_0141582_154_1089 294
82 iso_pu_bacteria 2837183177 2837185521 294
83 3300048922 Ga0496119_0004758 Ga0496119_0004758_735_1688 295
84 3300049742 Ga0501080_0575310 Ga0501080_0575310_16_948 296
85 3300046506 Ga0495583_0006119 Ga0495583_0006119_4956_5957 297
86 3300046616 Ga0495668_0007010 Ga0495668_0007010_3033_4034 297
87 3300046660 Ga0495625_0030768 Ga0495625_0030768_1471_2532 297
88 3300047445 Ga0495677_0013976 Ga0495677_0013976_1266_2267 297
89 3300006028 Ga0070717_10387145 Ga0070717_103871451 298
90 3300013308 Ga0157375_10551779 Ga0157375_105517792 298
91 3300044901 Ga0466960_0082041 Ga0466960_0082041_575_1495 298
92 3300048905 Ga0496102_0335517 Ga0496102_0335517_45_965 298
93 3300048909 Ga0496106_0015855 Ga0496106_0015855_722_1642 298
94 iso_pu_bacteria 2791355406 2793976022 298
95 iso_pu_bacteria 8047893842 8047900870 298
96 iso_pu_bacteria 8048356638 8048358032 298
97 iso_pu_bacteria 8048369669 8048377811 298
98 iso_pu_bacteria 8048379754 8048386908 298
99 3300005293 Ga0065715_10188005 Ga0065715_101880051 299
100 3300005458 Ga0070681_10496556 Ga0070681_104965561 299
101 3300005530 Ga0070679_100057788 Ga0070679_1000577881 299
102 3300005539 Ga0068853_100238971 Ga0068853_1002389713 299
103 3300005563 Ga0068855_100376472 Ga0068855_1003764722 299
104 3300013105 Ga0157369_10108005 Ga0157369_101080051 299
105 3300025912 Ga0207707_10052787 Ga0207707_100527872 299
106 3300044693 Ga0466961_0034628 Ga0466961_0034628_2217_3152 299
107 3300048925 Ga0496122_0002464 Ga0496122_0002464_10247_11191 299
108 iso_pu_bacteria 2856741275 2856744564 299
109 iso_pu_bacteria 2873314349 2873316115 299
110 iso_pu_bacteria 2891562705 2891566000 299
111 3300032005 Ga0307411_10029270 Ga0307411_100292702 300
112 3300053094 Ga0500566_0004805 Ga0500566_0004805_3063_3995 300
113 3300053150 Ga0500603_000867 Ga0500603_000867_956_1888 300
114 iso_pu_bacteria 3006486233 3006489065 300
115 3300006846 Ga0075430_100027322 Ga0075430_1000273222 301
116 3300009147 Ga0114129_10120311 Ga0114129_101203112 301
117 3300044712 Ga0453684_0173542 Ga0453684_0173542_780_1706 301
118 3300003322 rootL2_10069414 rootL2_100694141 302
119 3300003323 rootH1_10239843 rootH1_102398434 302
120 3300005347 Ga0070668_100000404 Ga0070668_10000040420 302
121 3300005518 Ga0070699_100354901 Ga0070699_1003549011 302
122 3300009147 Ga0114129_10182489 Ga0114129_101824894 302
123 3300029957 Ga0265324_10018772 Ga0265324_100187722 302
124 3300031456 Ga0307513_10000002 Ga0307513_10000002456 302
125 3300031507 Ga0307509_10185911 Ga0307509_101859113 302
126 3300031616 Ga0307508_10033541 Ga0307508_100335415 302
127 3300032002 Ga0307416_100347489 Ga0307416_1003474892 302
128 3300032126 Ga0307415_100000994 Ga0307415_1000009947 302
129 3300048907 Ga0496104_0530040 Ga0496104_0530040_123_1052 302
130 3300048917 Ga0496114_0177960 Ga0496114_0177960_104_1033 302
131 3300053139 Ga0500568_0000054 Ga0500568_0000054_66441_67400 302
132 iso_pu_bacteria 2915358134 2915362986 302
133 3300005340 Ga0070689_100082992 Ga0070689_1000829922 303
134 3300005343 Ga0070687_100112311 Ga0070687_1001123112 303
135 3300005563 Ga0068855_100156319 Ga0068855_1001563192 303
136 3300005578 Ga0068854_100000935 Ga0068854_1000009357 303
137 3300009174 Ga0105241_10008773 Ga0105241_100087732 303
138 3300009551 Ga0105238_10167046 Ga0105238_101670463 303
139 3300013105 Ga0157369_10216735 Ga0157369_102167351 303
140 3300025898 Ga0207692_10171333 Ga0207692_101713331 303
141 3300025904 Ga0207647_10000849 Ga0207647_100008497 303
142 3300025906 Ga0207699_10027730 Ga0207699_100277303 303
143 3300025913 Ga0207695_10013047 Ga0207695_100130475 303
144 3300025914 Ga0207671_10000654 Ga0207671_1000065427 303
145 3300025929 Ga0207664_10199050 Ga0207664_101990503 303
146 3300025942 Ga0207689_10203402 Ga0207689_102034022 303
147 3300026067 Ga0207678_10188317 Ga0207678_101883172 303
148 3300028379 Ga0268266_10011762 Ga0268266_100117624 303
149 3300035117 Ga0373953_0007349 Ga0373953_0007349_787_1719 303
150 3300035119 Ga0373956_0057945 Ga0373956_0057945_435_1367 303
151 3300035171 Ga0373946_0000148 Ga0373946_0000148_20435_21367 303
152 3300036401 Ga0373937_0166515 Ga0373937_0166515_1052_1996 303
153 3300044656 Ga0466969_0002255 Ga0466969_0002255_8972_9961 303
154 3300044656 Ga0466969_0008754 Ga0466969_0008754_533_1465 303
155 3300044656 Ga0466969_0103245 Ga0466969_0103245_14_946 303
156 3300044684 Ga0466966_0099348 Ga0466966_0099348_201_1133 303
157 3300044684 Ga0466966_0122503 Ga0466966_0122503_208_1197 303
158 3300044693 Ga0466961_0056214 Ga0466961_0056214_845_1777 303
159 3300044765 Ga0466970_0141787 Ga0466970_0141787_95_1084 303
160 3300045049 Ga0466959_0001411 Ga0466959_0001411_219_1208 303
161 3300045049 Ga0466959_0159017 Ga0466959_0159017_134_1066 303
162 3300045836 Ga0466958_0127870 Ga0466958_0127870_146_1078 303
163 3300046454 Ga0495592_0158768 Ga0495592_0158768_380_1312 303
164 3300046462 Ga0495651_0060520 Ga0495651_0060520_1087_2019 303
165 3300046463 Ga0495653_0053900 Ga0495653_0053900_909_1853 303
166 3300046517 Ga0495630_0276942 Ga0495630_0276942_302_1246 303
167 3300046559 Ga0495667_0049729 Ga0495667_0049729_1009_1953 303
168 3300046675 Ga0495657_0121420 Ga0495657_0121420_239_1183 303
169 3300047317 Ga0495604_0004272 Ga0495604_0004272_6427_7359 303
170 3300047322 Ga0495680_0011038 Ga0495680_0011038_6668_7612 303
171 3300047471 Ga0495684_0003425 Ga0495684_0003425_1385_2329 303
172 3300049569 Ga0501032_0006076 Ga0501032_0006076_6407_7339 303
173 3300049569 Ga0501032_0271669 Ga0501032_0271669_83_1015 303
174 3300049570 Ga0501033_0025229 Ga0501033_0025229_1979_2911 303
175 3300049570 Ga0501033_0116068 Ga0501033_0116068_807_1739 303
176 3300049571 Ga0501034_0046338 Ga0501034_0046338_152_1084 303
177 3300049571 Ga0501034_0091127 Ga0501034_0091127_1492_2424 303
178 3300049572 Ga0501036_0074541 Ga0501036_0074541_1612_2544 303
179 3300049573 Ga0501037_0094523 Ga0501037_0094523_200_1132 303
180 3300049573 Ga0501037_0241578 Ga0501037_0241578_152_1084 303
181 3300049574 Ga0501038_0071800 Ga0501038_0071800_918_1850 303
182 3300049575 Ga0501039_0056211 Ga0501039_0056211_912_1844 303
183 3300049579 Ga0501043_0034023 Ga0501043_0034023_1479_2411 303
184 3300049581 Ga0501047_0057783 Ga0501047_0057783_1595_2527 303
185 3300049581 Ga0501047_0308433 Ga0501047_0308433_280_1212 303
186 3300049586 Ga0501070_0195280 Ga0501070_0195280_454_1386 303
187 3300049822 Ga0501035_0036421 Ga0501035_0036421_2238_3170 303
188 3300049823 Ga0501044_0019406 Ga0501044_0019406_5888_6820 303
189 3300049823 Ga0501044_0063122 Ga0501044_0063122_1482_2414 303
190 3300049824 Ga0501045_0080935 Ga0501045_0080935_125_1057 303
191 iso_pu_bacteria 8056667051 8056671643 303
192 3300005981 Ga0081538_10007232 Ga0081538_100072322 304
193 3300025932 Ga0207690_10084797 Ga0207690_100847972 304
194 3300026118 Ga0207675_100006487 Ga0207675_1000064879 304
195 3300044656 Ga0466969_0148643 Ga0466969_0148643_51_1055 304
196 iso_pu_bacteria 2558860112 2558908191 304
197 iso_pu_bacteria 2703719227 2705994555 304
198 iso_pu_bacteria 2738541358 2739155946 304
199 iso_pu_bacteria 2738543006 2739208725 304
200 iso_pu_bacteria 2870782633 2870789476 304
201 iso_pu_bacteria 2870782633 2870790323 304
202 iso_pu_bacteria 2965761152 2965763929 304
203 iso_pu_bacteria 2979083700 2979086353 304
204 iso_pu_bacteria 8022621104 8022625076 304
205 iso_pu_bacteria 8023444577 8023446336 304
206 3300005347 Ga0070668_100182417 Ga0070668_1001824172 305
207 3300005355 Ga0070671_100030410 Ga0070671_1000304103 305
208 3300005548 Ga0070665_100002997 Ga0070665_10000299715 305
209 3300005843 Ga0068860_100007882 Ga0068860_1000078823 305
210 3300025931 Ga0207644_10032305 Ga0207644_100323054 305
211 3300025972 Ga0207668_10059112 Ga0207668_100591122 305
212 3300028379 Ga0268266_10019236 Ga0268266_100192365 305
213 3300028381 Ga0268264_10085679 Ga0268264_100856792 305
214 3300031616 Ga0307508_10093660 Ga0307508_100936602 305
215 3300044694 Ga0466963_0011350 Ga0466963_0011350_1731_2681 305
216 3300044842 Ga0466957_0176336 Ga0466957_0176336_285_1235 305
217 3300045976 Ga0466967_0124524 Ga0466967_0124524_1161_2111 305
218 iso_pu_bacteria 8054472261 8054472805 305
219 3300044673 Ga0453683_0000287 Ga0453683_0000287_4681_5616 306
220 iso_pu_bacteria 2643221632 2644181516 306
221 iso_pu_bacteria 2912757875 2912758511 306
222 iso_pu_bacteria 2997600082 2997601827 306
223 3300002987 JGI25159J45721_1000926 JGI25159J45721_10009264 308
224 3300002987 JGI25159J45721_1015858 JGI25159J45721_10158581 308
225 3300003187 JGI25151J46595_10006416 JGI25151J46595_100064163 308
226 3300003187 JGI25151J46595_10009302 JGI25151J46595_100093023 308
227 3300003187 JGI25151J46595_10010754 JGI25151J46595_100107543 308
228 3300003187 JGI25151J46595_10055982 JGI25151J46595_100559822 308
229 3300009011 Ga0105251_10053182 Ga0105251_100531822 308
230 3300009036 Ga0105244_10014792 Ga0105244_100147923 308
231 3300009036 Ga0105244_10103622 Ga0105244_101036222 308
232 3300009092 Ga0105250_10002454 Ga0105250_100024546 308
233 3300025284 Ga0209130_1000213 Ga0209130_10002134 308
234 3300025284 Ga0209130_1000875 Ga0209130_10008757 308
235 3300025294 Ga0209025_1000143 Ga0209025_100014322 308
236 3300025294 Ga0209025_1002120 Ga0209025_100212024 308
237 3300025294 Ga0209025_1005388 Ga0209025_10053883 308
238 3300025294 Ga0209025_1005783 Ga0209025_10057833 308
239 3300025294 Ga0209025_1007234 Ga0209025_10072345 308
240 3300025294 Ga0209025_1014375 Ga0209025_10143753 308
241 3300025294 Ga0209025_1027970 Ga0209025_10279703 308
242 3300025294 Ga0209025_1037668 Ga0209025_10376682 308
243 3300025711 Ga0207696_1002454 Ga0207696_100245410 308
244 3300025711 Ga0207696_1033164 Ga0207696_10331642 308
245 3300025728 Ga0207655_1009559 Ga0207655_10095592 308
246 3300025728 Ga0207655_1085163 Ga0207655_10851631 308
247 3300038705 Ga0237819_00107 Ga0237819_00107_19216_20142 308
248 3300038705 Ga0237819_01242 Ga0237819_01242_3166_4092 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

199

341

0.94

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

176

278

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

46

135

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.939 1 306
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9302 1 306
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9201 1 308
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9173 1 308
2vn8-assembly2.cif.gz_B crystal structure of human reticulon 4 interacting protein 1 in complex with nadph 0.9148 2 306
ID Description Score Start End Superfamily
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9583 1 119 3.90.180.10
af_Q9LK96_31_155_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9483 2 119 3.90.180.10
af_I1LVH0_49_172_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9452 2 124 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9435 1 124 3.90.180.10
af_O94564_145_291_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.943 126 235 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2A8BL52-F1-model_v4 NADPH:quinone reductase 1 1 308 GO:0016491
AF-A0A1S9XML4-F1-model_v4 deleted 0.9995 1 308
AF-A0A1G7PUL5-F1-model_v4 Alcohol dehydrogenase GroES-like domain-containing protein 0.9863 1 131
AF-A0A0R1STS2-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9784 1 145
AF-A0A254NLG6-F1-model_v4 NADPH:quinone reductase 0.9768 1 308 GO:0008270
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.94 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map