F360123

General Info

Members Datasets Scaffolds Average Seq Length
248 167 496 378

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0088182|Ga0466960_0088182_118_1350
Length 410
Sequence VTGVRIGIVTREWPPDVYGGAGVHVEHLVAALRSLPAAAAEGSTGGLDVEVHCFGGPRPDAVGHPVPAGLVGANGALQAVGVDVEIAGVLADVDLVHSHTWYANGAGQLAQLVHGIPHVVTAHSLEPRRPWKADQLGGGYRLSSWVERTAYLAADAVIAVSNGMRADVLDAYPELDPAKVHVVGNGVDAEAYRPTPDPDVVRSFGVDPDVPYALYVGRITRQKGLVHLLAAAEQLPPEAQLVLCAGAADTPAERQQVADAVAGLQQRRGGGVVWIEAMVPRDQLVPLITGATVFVVPSVYEPLGIVNLEAAACGTAVVASAVGGIPEVVDDGRTGLLVPYDPEDPAAFEAGLAARIAELLADPQRAAAMGAAGRERVLSEFGWPAIAQQTVQVYSEVLQHRDPPGRTAAR

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
80 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 2558860280 Kutzneria sp. 744 Isolate Unclassified
161 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
162 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
163 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
164 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
165 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
166 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
167 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 1.21
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 5.24
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0088182 3300044901 Bacteria 1577
2 JGI25406J46586_10000697 3300003203 Bacteria 15666
3 Ga0070658_10042174 3300005327 Bacteria 3683
4 Ga0070658_10149250 3300005327 Bacteria 1956
5 Ga0070658_10165441 3300005327 Bacteria 1857
6 Ga0070676_10035130 3300005328 Bacteria 2881
7 Ga0070683_100114098 3300005329 Bacteria 2550
8 Ga0070670_100144408 3300005331 Bacteria 2058
9 Ga0070680_100002676 3300005336 Bacteria 13205
10 Ga0070680_100105620 3300005336 Bacteria 2341
11 Ga0070680_100121094 3300005336 Bacteria 2184
12 Ga0070682_100150251 3300005337 Bacteria 1597
13 Ga0070660_100146549 3300005339 Bacteria 1896
14 Ga0070687_100129831 3300005343 Bacteria 1453
15 Ga0070661_100040350 3300005344 Bacteria 3405
16 Ga0070661_100229157 3300005344 Bacteria 1427
17 Ga0070674_100021529 3300005356 Bacteria 4142
18 Ga0070688_100074619 3300005365 Bacteria 2179
19 Ga0070710_10000110 3300005437 Bacteria 38306
20 Ga0070710_10076986 3300005437 Bacteria 1937
21 Ga0070711_100058822 3300005439 Bacteria 2666
22 Ga0070663_100059877 3300005455 Bacteria 2737
23 Ga0070681_10000109 3300005458 Bacteria 61563
24 Ga0070681_10023082 3300005458 Bacteria 6256
25 Ga0070685_10019568 3300005466 Bacteria 3654
26 Ga0070698_100026890 3300005471 Bacteria 5983
27 Ga0070679_100000237 3300005530 Bacteria 45794
28 Ga0070679_100080582 3300005530 Bacteria 3245
29 Ga0070679_100185061 3300005530 Bacteria 2054
30 Ga0070684_100256006 3300005535 Bacteria 1600
31 Ga0070665_100221307 3300005548 Bacteria 1893
32 Ga0068855_100026463 3300005563 Bacteria 6938
33 Ga0068857_100188454 3300005577 Bacteria 1878
34 Ga0068856_100044467 3300005614 Bacteria 4371
35 Ga0068852_100022571 3300005616 Bacteria 5049
36 Ga0068864_100159562 3300005618 Bacteria 2049
37 Ga0068864_100186638 3300005618 Bacteria 1898
38 Ga0068870_10086020 3300005840 Bacteria 1748
39 Ga0081455_10004381 3300005937 Bacteria 15902
40 Ga0081455_10009828 3300005937 Bacteria 9797
41 Ga0081539_10000882 3300005985 Bacteria 57376
42 Ga0075363_100026036 3300006048 Bacteria 2990
43 Ga0068865_100012908 3300006881 Bacteria 5269
44 Ga0105240_10044010 3300009093 Bacteria 5676
45 Ga0111539_10136209 3300009094 Bacteria 2876
46 Ga0105245_10085350 3300009098 Bacteria 2894
47 Ga0105245_10230092 3300009098 Bacteria 1793
48 Ga0105245_10245604 3300009098 Bacteria 1737
49 Ga0105247_10109685 3300009101 Bacteria 1775
50 Ga0105243_10047172 3300009148 Bacteria 3390
51 Ga0105237_10034224 3300009545 Bacteria 5145
52 Ga0105237_10096772 3300009545 Bacteria 2942
53 Ga0105238_10200902 3300009551 Bacteria 1969
54 Ga0105249_10051492 3300009553 Bacteria 3756
55 Ga0105239_10184107 3300010375 Bacteria 2337
56 Ga0157369_10021316 3300013105 Bacteria 7248
57 Ga0157369_10163557 3300013105 Bacteria 2348
58 Ga0157374_10273755 3300013296 Bacteria 1665
59 Ga0157378_10192717 3300013297 Bacteria 1923
60 Ga0163162_10144300 3300013306 Bacteria 2495
61 Ga0157375_10056153 3300013308 Bacteria 3886
62 Ga0157375_10278068 3300013308 Bacteria 1837
63 Ga0157379_10021363 3300014968 Bacteria 5728
64 Ga0206353_10039244 3300020082 Bacteria 2926
65 Ga0206353_10055354 3300020082 Bacteria 2117
66 Ga0206353_10565212 3300020082 Bacteria 2769
67 Ga0207688_10002283 3300025901 Bacteria 10309
68 Ga0207645_10079949 3300025907 Bacteria 2096
69 Ga0207705_10057547 3300025909 Bacteria 2804
70 Ga0207705_10085824 3300025909 Bacteria 2300
71 Ga0207707_10000290 3300025912 Bacteria 53506
72 Ga0207707_10017289 3300025912 Bacteria 6285
73 Ga0207707_10023245 3300025912 Bacteria 5424
74 Ga0207695_10102539 3300025913 Bacteria 2854
75 Ga0207693_10084793 3300025915 Bacteria 2482
76 Ga0207660_10002079 3300025917 Bacteria 13261
77 Ga0207660_10122912 3300025917 Bacteria 1968
78 Ga0207662_10102483 3300025918 Bacteria 1775
79 Ga0207657_10033293 3300025919 Bacteria 4647
80 Ga0207657_10082412 3300025919 Bacteria 2700
81 Ga0207649_10093086 3300025920 Bacteria 1977
82 Ga0207652_10000185 3300025921 Bacteria 66048
83 Ga0207652_10020920 3300025921 Bacteria 5394
84 Ga0207652_10064911 3300025921 Bacteria 3160
85 Ga0207652_10164711 3300025921 Bacteria 1988
86 Ga0207646_10167237 3300025922 Bacteria 1985
87 Ga0207659_10078592 3300025926 Bacteria 2431
88 Ga0207687_10031074 3300025927 Bacteria 3607
89 Ga0207687_10043202 3300025927 Bacteria 3105
90 Ga0207700_10052563 3300025928 Bacteria 3047
91 Ga0207664_10191001 3300025929 Bacteria 1763
92 Ga0207644_10150270 3300025931 Bacteria 1802
93 Ga0207670_10131664 3300025936 Bacteria 1833
94 Ga0207669_10143765 3300025937 Bacteria 1660
95 Ga0207704_10020099 3300025938 Bacteria 3524
96 Ga0207665_10017815 3300025939 Bacteria 4668
97 Ga0207689_10012927 3300025942 Bacteria 7127
98 Ga0207667_10132954 3300025949 Bacteria 2562
99 Ga0207668_10215088 3300025972 Bacteria 1539
100 Ga0207708_10020865 3300026075 Bacteria 4942
101 Ga0207648_10057561 3300026089 Bacteria 3391
102 Ga0207674_10220880 3300026116 Bacteria 1843
103 Ga0207674_10221514 3300026116 Bacteria 1840
104 Ga0207698_10055180 3300026142 Bacteria 3060
105 Ga0207698_10208471 3300026142 Bacteria 1756
106 Ga0207428_10146848 3300027907 Bacteria 1797
107 Ga0268266_10015037 3300028379 Bacteria 6643
108 Ga0316177_1036696 3300030731 Bacteria 15660
109 Ga0314311_1090928 3300030733 Bacteria 5582
110 Ga0314311_1247087 3300030733 Bacteria 1419
111 Ga0265327_10000329 3300031251 Bacteria 90292
112 Ga0307513_10073668 3300031456 Bacteria 3554
113 Ga0307408_100066148 3300031548 Bacteria 2654
114 Ga0316579_10071461 3300031691 Bacteria 1645
115 Ga0316576_10009079 3300031727 Bacteria 6398
116 Ga0316576_10014642 3300031727 Bacteria 5242
117 Ga0316576_10017450 3300031727 Bacteria 4876
118 Ga0316578_10017445 3300031728 Bacteria 3905
119 Ga0316578_10055193 3300031728 Bacteria 2331
120 Ga0307413_10054789 3300031824 Bacteria 2422
121 Ga0307407_10063931 3300031903 Bacteria 2161
122 Ga0307407_10078545 3300031903 Bacteria 1988
123 Ga0307412_10088031 3300031911 Bacteria 2165
124 Ga0307409_100007348 3300031995 Bacteria 6583
125 Ga0307409_100108552 3300031995 Bacteria 2321
126 Ga0307409_100242135 3300031995 Bacteria 1643
127 Ga0307409_100261161 3300031995 Bacteria 1589
128 Ga0307409_100335417 3300031995 Bacteria 1421
129 Ga0307416_100027134 3300032002 Bacteria 4234
130 Ga0307416_100360470 3300032002 Bacteria 1476
131 Ga0307411_10174860 3300032005 Bacteria 1623
132 Ga0307415_100035244 3300032126 Bacteria 3267
133 Ga0307415_100074404 3300032126 Bacteria 2400
134 Ga0307507_10059306 3300033179 Bacteria 3584
135 Ga0307507_10068413 3300033179 Bacteria 3239
136 Ga0373945_0061975 3300035116 Bacteria 1398
137 Ga0373957_0046244 3300035120 Bacteria 1651
138 Ga0373955_0036481 3300035172 Bacteria 2608
139 Ga0316574_0102275 3300035398 Bacteria 1834
140 Ga0373924_0023892 3300035410 Bacteria 2404
141 Ga0316584_0000570 3300036712 Bacteria 19892
142 Ga0373925_0230793 3300037068 Bacteria 1480
143 Ga0395900_0039789 3300037418 Bacteria 4844
144 Ga0395900_0079708 3300037418 Bacteria 3365
145 Ga0395905_0090180 3300037471 Bacteria 2874
146 Ga0395901_0007078 3300038443 Bacteria 11339
147 Ga0395901_0024569 3300038443 Bacteria 6187
148 Ga0395901_0034256 3300038443 Bacteria 5244
149 Ga0395901_0136005 3300038443 Bacteria 2583
150 Ga0451577_0243901 3300042876 Bacteria 1626
151 Ga0466969_0032368 3300044656 Bacteria 2658
152 Ga0466972_0040789 3300044658 Bacteria 2261
153 Ga0466972_0155913 3300044658 Bacteria 1073
154 Ga0466965_0036666 3300044683 Bacteria 2406
155 Ga0466965_0076247 3300044683 Bacteria 1692
156 Ga0466966_0010561 3300044684 Bacteria 6138
157 Ga0466966_0037785 3300044684 Bacteria 3111
158 Ga0466961_0005161 3300044693 Bacteria 8218
159 Ga0466961_0007076 3300044693 Bacteria 7136
160 Ga0466961_0042869 3300044693 Bacteria 2899
161 Ga0466963_0004819 3300044694 Bacteria 7867
162 Ga0466963_0194798 3300044694 Bacteria 1416
163 Ga0466963_0300977 3300044694 Bacteria 1128
164 Ga0466964_0028143 3300044706 Bacteria 2212
165 Ga0466971_0028720 3300044719 Bacteria 2487
166 Ga0466971_0099087 3300044719 Bacteria 1338
167 Ga0466970_0043296 3300044765 Bacteria 2395
168 Ga0466970_0052963 3300044765 Bacteria 2167
169 Ga0466970_0157365 3300044765 Bacteria 1256
170 Ga0466957_0047653 3300044842 Bacteria 2604
171 Ga0466957_0111897 3300044842 Bacteria 1732
172 Ga0466957_0120417 3300044842 Bacteria 1673
173 Ga0466960_0062654 3300044901 Bacteria 1828
174 Ga0466959_0013225 3300045049 Bacteria 5977
175 Ga0466959_0038575 3300045049 Bacteria 3530
176 Ga0466959_0065786 3300045049 Bacteria 2631
177 Ga0466959_0071242 3300045049 Bacteria 2517
178 Ga0466959_0117389 3300045049 Bacteria 1894
179 Ga0466958_0029150 3300045836 Bacteria 3274
180 Ga0466958_0080970 3300045836 Bacteria 1998
181 Ga0466967_0000499 3300045976 Bacteria 19175
182 Ga0466967_0000737 3300045976 Bacteria 16779
183 Ga0466967_0002533 3300045976 Bacteria 11435
184 Ga0466967_0003860 3300045976 Bacteria 9930
185 Ga0466967_0011997 3300045976 Bacteria 6602
186 Ga0466967_0014131 3300045976 Bacteria 6204
187 Ga0466967_0062289 3300045976 Bacteria 3311
188 Ga0466967_0076894 3300045976 Bacteria 3003
189 Ga0466967_0125281 3300045976 Bacteria 2379
190 Ga0466967_0134235 3300045976 Bacteria 2301
191 Ga0466967_0186416 3300045976 Bacteria 1959
192 Ga0466967_0439779 3300045976 Bacteria 1273
193 Ga0495592_0006697 3300046454 Bacteria 8591
194 Ga0495664_0102093 3300046477 Bacteria 1728
195 Ga0495586_0042651 3300046535 Bacteria 2443
196 Ga0495645_0028602 3300046543 Bacteria 4051
197 Ga0495600_0176740 3300046809 Bacteria 1376
198 Ga0495604_0104291 3300047317 Bacteria 2078
199 Ga0495674_0152586 3300047319 Bacteria 1936
200 Ga0495676_0264990 3300047321 Bacteria 1168
201 Ga0496100_0002834 3300048903 Bacteria 8885
202 Ga0496101_0019238 3300048904 Bacteria 4659
203 Ga0496102_0000015 3300048905 Bacteria 304524
204 Ga0496103_0000020 3300048906 Bacteria 234050
205 Ga0496105_0030673 3300048908 Bacteria 4405
206 Ga0496108_0013128 3300048911 Bacteria 6751
207 Ga0496108_0071081 3300048911 Bacteria 2936
208 Ga0496109_0019416 3300048912 Bacteria 5994
209 Ga0496110_0009211 3300048913 Bacteria 7979
210 Ga0496111_0073013 3300048914 Bacteria 2498
211 Ga0496111_0140017 3300048914 Bacteria 1793
212 Ga0496114_0121828 3300048917 Bacteria 2244
213 Ga0496115_0106868 3300048918 Bacteria 2298
214 Ga0496116_0000178 3300048919 Bacteria 128023
215 Ga0496117_0000047 3300048920 Bacteria 299632
216 Ga0496118_0000050 3300048921 Bacteria 244124
217 Ga0496119_0002385 3300048922 Bacteria 20639
218 Ga0496120_0004499 3300048923 Bacteria 11666
219 Ga0496121_0012441 3300048924 Bacteria 9276
220 Ga0496124_0002610 3300048927 Bacteria 23269
221 Ga0496125_0045497 3300048928 Bacteria 3692
222 Ga0496126_0000049 3300048929 Bacteria 317568
223 Ga0501031_0018169 3300049568 Bacteria 4575
224 Ga0501032_0022097 3300049569 Bacteria 4415
225 Ga0501033_0068045 3300049570 Bacteria 2619
226 Ga0501034_0197469 3300049571 Bacteria 1971
227 Ga0501038_0003778 3300049574 Bacteria 14089
228 Ga0501043_0005595 3300049579 Bacteria 10123
229 Ga0501047_0003422 3300049581 Bacteria 15003
230 Ga0501047_0110253 3300049581 Bacteria 2635
231 Ga0501070_0033420 3300049586 Bacteria 4304
232 Ga0501035_0002060 3300049822 Bacteria 20007
233 Ga0501044_0008159 3300049823 Bacteria 11491
234 Ga0501044_0163602 3300049823 Bacteria 2200
235 Ga0501044_0325604 3300049823 Bacteria 1460
236 nmdc:mga08y16_363709_c1 3300050511 Bacteria 1485
237 Ga0495601_0076734 3300053077 Bacteria 2140
238 Ga0466962_0007724 3300061719 Bacteria 5153
239 Ga0466962_0021124 3300061719 Bacteria 3127
240 Ga0466962_0042130 3300061719 Bacteria 2185
241 2559426981 2558860280 Bacteria 11429938
242 2623500576 2622736605 Bacteria 4992138
243 2739203915 2738543005 Bacteria 5278128
244 2791914021 2791354901 Bacteria 8322202
245 2816511567 2816332139 Bacteria 9138787
246 2915362356 2915358134 Bacteria 6050864
247 2928145645 2928142448 Bacteria 5288925
248 8054475715 8054472261 Bacteria 7464355
249 Ga0466960_0088182
250 JGI25406J46586_10000697
251 Ga0070658_10042174
252 Ga0070658_10149250
253 Ga0070658_10165441
254 Ga0070676_10035130
255 Ga0070683_100114098
256 Ga0070670_100144408
257 Ga0070680_100002676
258 Ga0070680_100105620
259 Ga0070680_100121094
260 Ga0070682_100150251
261 Ga0070660_100146549
262 Ga0070687_100129831
263 Ga0070661_100040350
264 Ga0070661_100229157
265 Ga0070674_100021529
266 Ga0070688_100074619
267 Ga0070710_10000110
268 Ga0070710_10076986
269 Ga0070711_100058822
270 Ga0070663_100059877
271 Ga0070681_10000109
272 Ga0070681_10023082
273 Ga0070685_10019568
274 Ga0070698_100026890
275 Ga0070679_100000237
276 Ga0070679_100080582
277 Ga0070679_100185061
278 Ga0070684_100256006
279 Ga0070665_100221307
280 Ga0068855_100026463
281 Ga0068857_100188454
282 Ga0068856_100044467
283 Ga0068852_100022571
284 Ga0068864_100159562
285 Ga0068864_100186638
286 Ga0068870_10086020
287 Ga0081455_10004381
288 Ga0081455_10009828
289 Ga0081539_10000882
290 Ga0075363_100026036
291 Ga0068865_100012908
292 Ga0105240_10044010
293 Ga0111539_10136209
294 Ga0105245_10085350
295 Ga0105245_10230092
296 Ga0105245_10245604
297 Ga0105247_10109685
298 Ga0105243_10047172
299 Ga0105237_10034224
300 Ga0105237_10096772
301 Ga0105238_10200902
302 Ga0105249_10051492
303 Ga0105239_10184107
304 Ga0157369_10021316
305 Ga0157369_10163557
306 Ga0157374_10273755
307 Ga0157378_10192717
308 Ga0163162_10144300
309 Ga0157375_10056153
310 Ga0157375_10278068
311 Ga0157379_10021363
312 Ga0206353_10039244
313 Ga0206353_10055354
314 Ga0206353_10565212
315 Ga0207688_10002283
316 Ga0207645_10079949
317 Ga0207705_10057547
318 Ga0207705_10085824
319 Ga0207707_10000290
320 Ga0207707_10017289
321 Ga0207707_10023245
322 Ga0207695_10102539
323 Ga0207693_10084793
324 Ga0207660_10002079
325 Ga0207660_10122912
326 Ga0207662_10102483
327 Ga0207657_10033293
328 Ga0207657_10082412
329 Ga0207649_10093086
330 Ga0207652_10000185
331 Ga0207652_10020920
332 Ga0207652_10064911
333 Ga0207652_10164711
334 Ga0207646_10167237
335 Ga0207659_10078592
336 Ga0207687_10031074
337 Ga0207687_10043202
338 Ga0207700_10052563
339 Ga0207664_10191001
340 Ga0207644_10150270
341 Ga0207670_10131664
342 Ga0207669_10143765
343 Ga0207704_10020099
344 Ga0207665_10017815
345 Ga0207689_10012927
346 Ga0207667_10132954
347 Ga0207668_10215088
348 Ga0207708_10020865
349 Ga0207648_10057561
350 Ga0207674_10220880
351 Ga0207674_10221514
352 Ga0207698_10055180
353 Ga0207698_10208471
354 Ga0207428_10146848
355 Ga0268266_10015037
356 Ga0316177_1036696
357 Ga0314311_1090928
358 Ga0314311_1247087
359 Ga0265327_10000329
360 Ga0307513_10073668
361 Ga0307408_100066148
362 Ga0316579_10071461
363 Ga0316576_10009079
364 Ga0316576_10014642
365 Ga0316576_10017450
366 Ga0316578_10017445
367 Ga0316578_10055193
368 Ga0307413_10054789
369 Ga0307407_10063931
370 Ga0307407_10078545
371 Ga0307412_10088031
372 Ga0307409_100007348
373 Ga0307409_100108552
374 Ga0307409_100242135
375 Ga0307409_100261161
376 Ga0307409_100335417
377 Ga0307416_100027134
378 Ga0307416_100360470
379 Ga0307411_10174860
380 Ga0307415_100035244
381 Ga0307415_100074404
382 Ga0307507_10059306
383 Ga0307507_10068413
384 Ga0373945_0061975
385 Ga0373957_0046244
386 Ga0373955_0036481
387 Ga0316574_0102275
388 Ga0373924_0023892
389 Ga0316584_0000570
390 Ga0373925_0230793
391 Ga0395900_0039789
392 Ga0395900_0079708
393 Ga0395905_0090180
394 Ga0395901_0007078
395 Ga0395901_0024569
396 Ga0395901_0034256
397 Ga0395901_0136005
398 Ga0451577_0243901
399 Ga0466969_0032368
400 Ga0466972_0040789
401 Ga0466972_0155913
402 Ga0466965_0036666
403 Ga0466965_0076247
404 Ga0466966_0010561
405 Ga0466966_0037785
406 Ga0466961_0005161
407 Ga0466961_0007076
408 Ga0466961_0042869
409 Ga0466963_0004819
410 Ga0466963_0194798
411 Ga0466963_0300977
412 Ga0466964_0028143
413 Ga0466971_0028720
414 Ga0466971_0099087
415 Ga0466970_0043296
416 Ga0466970_0052963
417 Ga0466970_0157365
418 Ga0466957_0047653
419 Ga0466957_0111897
420 Ga0466957_0120417
421 Ga0466960_0062654
422 Ga0466959_0013225
423 Ga0466959_0038575
424 Ga0466959_0065786
425 Ga0466959_0071242
426 Ga0466959_0117389
427 Ga0466958_0029150
428 Ga0466958_0080970
429 Ga0466967_0000499
430 Ga0466967_0000737
431 Ga0466967_0002533
432 Ga0466967_0003860
433 Ga0466967_0011997
434 Ga0466967_0014131
435 Ga0466967_0062289
436 Ga0466967_0076894
437 Ga0466967_0125281
438 Ga0466967_0134235
439 Ga0466967_0186416
440 Ga0466967_0439779
441 Ga0495592_0006697
442 Ga0495664_0102093
443 Ga0495586_0042651
444 Ga0495645_0028602
445 Ga0495600_0176740
446 Ga0495604_0104291
447 Ga0495674_0152586
448 Ga0495676_0264990
449 Ga0496100_0002834
450 Ga0496101_0019238
451 Ga0496102_0000015
452 Ga0496103_0000020
453 Ga0496105_0030673
454 Ga0496108_0013128
455 Ga0496108_0071081
456 Ga0496109_0019416
457 Ga0496110_0009211
458 Ga0496111_0073013
459 Ga0496111_0140017
460 Ga0496114_0121828
461 Ga0496115_0106868
462 Ga0496116_0000178
463 Ga0496117_0000047
464 Ga0496118_0000050
465 Ga0496119_0002385
466 Ga0496120_0004499
467 Ga0496121_0012441
468 Ga0496124_0002610
469 Ga0496125_0045497
470 Ga0496126_0000049
471 Ga0501031_0018169
472 Ga0501032_0022097
473 Ga0501033_0068045
474 Ga0501034_0197469
475 Ga0501038_0003778
476 Ga0501043_0005595
477 Ga0501047_0003422
478 Ga0501047_0110253
479 Ga0501070_0033420
480 Ga0501035_0002060
481 Ga0501044_0008159
482 Ga0501044_0163602
483 Ga0501044_0325604
484 nmdc:mga08y16_363709_c1
485 Ga0495601_0076734
486 Ga0466962_0007724
487 Ga0466962_0021124
488 Ga0466962_0042130
489 2559426981
490 2623500576
491 2739203915
492 2791914021
493 2816511567
494 2915362356
495 2928145645
496 8054475715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

198

376

0.81

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

18

191

0.81

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

100

390

0.81

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

227

392

0.8

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

210

362

0.75

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

19

186

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tvp-assembly1.cif.gz_A structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm 0.9318 2 385
6tvp-assembly1.cif.gz_A structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm 0.9249 2 385
6tvp-assembly1.cif.gz_B structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm 0.8534 2 385
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8504 197 364
6tvp-assembly1.cif.gz_B structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm 0.8494 2 385
ID Description Score Start End Superfamily
af_P9WMZ1_187_386_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9966 188 383 3.40.50.2000
af_P9WMZ1_1_186_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9756 1 183 3.40.50.2000
af_P9WMZ1_187_386_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9718 188 383 3.40.50.2000
af_P9WMZ1_1_186_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9498 1 183 3.40.50.2000
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.891 185 367 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A0C5BEH5-F1-model_v4 Glycosyl transferase family 1 0.9917 1 383 GO:0009250
GO:0016757
AF-A0A0C5BEH5-F1-model_v4 Glycosyl transferase family 1 0.984 1 383 GO:0009250
GO:0016757
AF-A0A847H7C0-F1-model_v4 Glycosyltransferase 0.9746 1 162 GO:0016740
AF-A0A847H7C0-F1-model_v4 Glycosyltransferase 0.9629 1 162 GO:0016740
AF-A0A2V6BFS3-F1-model_v4 Glycogen synthase 0.9456 2 384 GO:0009250
GO:0016758

Map