F360054

General Info

Members Datasets Scaffolds Average Seq Length
248 154 496 268

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0072169|Ga0395899_0072169_1565_2452
Length 283
Sequence MAERIDPSVSTGHFRRAKPIIATYSIVACDLEAEQWGVSVQSKFLSVGSVVPWAEPQVGAIATQAYANPRYGPNGLHLLRDGLSAQEVVDKLTGEDEGRDHRQLGIVDAKGNAATYTGEECLDWAGGRTGVNYAAQGNILVNKETVDALAETFESSSGPLASRLIDCLAAAQEAGVVQRDGGYAGMSDVLVELRVEDHERPIEELRRIYTLHDEIFGTTPRDKWLPVDDELAAELRDRLAKLGYEGELEDSFTRWTGKENLEDRVDGIEQIDPVVLDALRSRS

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.89
Rhizosphere 89.11
Stem 0
Stem Tuber 0
Unclassified 12.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0072169 3300037312 Bacteria 2526
2 Ga0070658_10020375 3300005327 Bacteria 5315
3 Ga0070658_10077170 3300005327 Bacteria 2732
4 Ga0070683_100005256 3300005329 Bacteria 10777
5 Ga0070683_100005855 3300005329 Bacteria 10288
6 Ga0070683_100006229 3300005329 Bacteria 10006
7 Ga0070683_100010814 3300005329 Bacteria 7853
8 Ga0070683_100057995 3300005329 Bacteria 3597
9 Ga0070683_100071296 3300005329 Bacteria 3242
10 Ga0070680_100011572 3300005336 Bacteria 6832
11 Ga0070682_100010182 3300005337 Bacteria 5331
12 Ga0068868_100172067 3300005338 Bacteria 1793
13 Ga0070661_100190462 3300005344 Bacteria 1564
14 Ga0070675_100150669 3300005354 Bacteria 1994
15 Ga0070674_100298076 3300005356 Unclassified 1284
16 Ga0070714_100078622 3300005435 Bacteria 2867
17 Ga0070714_100188970 3300005435 Bacteria 1878
18 Ga0070710_10010614 3300005437 Bacteria 4527
19 Ga0070711_100163418 3300005439 Bacteria 1690
20 Ga0070678_100003400 3300005456 Bacteria 8874
21 Ga0070681_10010355 3300005458 Bacteria 9206
22 Ga0070685_10157931 3300005466 Bacteria 1443
23 Ga0070707_100001649 3300005468 Bacteria 21628
24 Ga0070698_100016119 3300005471 Bacteria 7890
25 Ga0070698_100290820 3300005471 Bacteria 1565
26 Ga0070679_100121824 3300005530 Bacteria 2592
27 Ga0070684_100000360 3300005535 Bacteria 31368
28 Ga0070684_100000684 3300005535 Bacteria 23405
29 Ga0070684_100006952 3300005535 Bacteria 8789
30 Ga0070684_100102958 3300005535 Bacteria 2553
31 Ga0070684_100117452 3300005535 Bacteria 2390
32 Ga0070693_100008085 3300005547 Bacteria 5165
33 Ga0070664_100026479 3300005564 Bacteria 4810
34 Ga0068857_100001754 3300005577 Bacteria 17436
35 Ga0068857_100076479 3300005577 Unclassified 2985
36 Ga0068857_100107758 3300005577 Bacteria 2503
37 Ga0068856_100003184 3300005614 Bacteria 16712
38 Ga0068863_100181252 3300005841 Bacteria 2022
39 Ga0081455_10030402 3300005937 Bacteria 4905
40 Ga0081538_10043694 3300005981 Bacteria 2808
41 Ga0081540_1002004 3300005983 Bacteria 16993
42 Ga0070712_100089572 3300006175 Bacteria 2251
43 Ga0068871_100240726 3300006358 Bacteria 1573
44 Ga0075430_100082694 3300006846 Bacteria 2690
45 Ga0075434_100060674 3300006871 Bacteria 3761
46 Ga0075429_100155439 3300006880 Bacteria 2003
47 Ga0111539_10403705 3300009094 Bacteria 1592
48 Ga0105245_10007278 3300009098 Bacteria 9693
49 Ga0105245_10225911 3300009098 Bacteria 1809
50 Ga0105245_10356557 3300009098 Bacteria 1450
51 Ga0114129_10688605 3300009147 Bacteria 1315
52 Ga0105241_10075336 3300009174 Bacteria 2629
53 Ga0105242_10086709 3300009176 Bacteria 2627
54 Ga0105248_10203386 3300009177 Bacteria 2231
55 Ga0105248_10657087 3300009177 Bacteria 1183
56 Ga0105238_10202792 3300009551 Bacteria 1959
57 Ga0105239_10435356 3300010375 Bacteria 1486
58 Ga0105246_10016684 3300011119 Bacteria 4654
59 Ga0105246_10044989 3300011119 Bacteria 3004
60 Ga0157369_10100803 3300013105 Unclassified 3078
61 Ga0157374_10081899 3300013296 Bacteria 3063
62 Ga0157372_10550800 3300013307 Unclassified 1344
63 Ga0157375_10051061 3300013308 Bacteria 4059
64 Ga0163163_10273361 3300014325 Bacteria 1741
65 Ga0157376_10073973 3300014969 Unclassified 2903
66 Ga0206356_10576957 3300020070 Unclassified 2134
67 Ga0207688_10183915 3300025901 Bacteria 1247
68 Ga0207707_10048707 3300025912 Bacteria 3691
69 Ga0207707_10152497 3300025912 Bacteria 2020
70 Ga0207695_10444387 3300025913 Unclassified 1180
71 Ga0207693_10104327 3300025915 Bacteria 2223
72 Ga0207660_10333371 3300025917 Unclassified 1213
73 Ga0207657_10002895 3300025919 Bacteria 18432
74 Ga0207649_10082643 3300025920 Bacteria 2083
75 Ga0207652_10004016 3300025921 Bacteria 12013
76 Ga0207652_10258026 3300025921 Unclassified 1572
77 Ga0207646_10000757 3300025922 Bacteria 41947
78 Ga0207646_10425945 3300025922 Bacteria 1198
79 Ga0207687_10007950 3300025927 Bacteria 6944
80 Ga0207687_10093112 3300025927 Bacteria 2202
81 Ga0207700_10168070 3300025928 Bacteria 1827
82 Ga0207664_10028479 3300025929 Bacteria 4245
83 Ga0207664_10316085 3300025929 Bacteria 1377
84 Ga0207664_10378612 3300025929 Bacteria 1256
85 Ga0207644_10262703 3300025931 Bacteria 1381
86 Ga0207690_10028371 3300025932 Bacteria 3548
87 Ga0207661_10014175 3300025944 Bacteria 5835
88 Ga0207661_10109319 3300025944 Bacteria 2335
89 Ga0207661_10223229 3300025944 Unclassified 1666
90 Ga0207679_10023949 3300025945 Bacteria 4181
91 Ga0207712_10464155 3300025961 Bacteria 1076
92 Ga0207677_10334076 3300026023 Bacteria 1264
93 Ga0207702_10019843 3300026078 Bacteria 5567
94 Ga0207702_10298724 3300026078 Bacteria 1528
95 Ga0207648_10518297 3300026089 Bacteria 1092
96 Ga0207674_10002796 3300026116 Bacteria 21727
97 Ga0207674_10069097 3300026116 Unclassified 3553
98 Ga0207674_10123777 3300026116 Bacteria 2552
99 Ga0207674_10180748 3300026116 Bacteria 2061
100 Ga0207683_10009030 3300026121 Bacteria 8492
101 Ga0265326_10031212 3300028558 Bacteria 1518
102 Ga0265334_10071548 3300028573 Unclassified 1291
103 Ga0265338_10008512 3300028800 Bacteria 12437
104 Ga0265313_10102646 3300031595 Unclassified 1267
105 Ga0307409_100159691 3300031995 Bacteria 1970
106 Ga0307416_100135574 3300032002 Bacteria 2226
107 Ga0307415_100120445 3300032126 Bacteria 1966
108 Ga0373945_0093432 3300035116 Bacteria 1168
109 Ga0373947_0156764 3300035725 Bacteria 1470
110 Ga0373937_0005265 3300036401 Bacteria 11046
111 Ga0395899_0009535 3300037312 Bacteria 7452
112 Ga0395899_0020484 3300037312 Bacteria 5013
113 Ga0395899_0159597 3300037312 Bacteria 1594
114 Ga0395899_0186219 3300037312 Bacteria 1455
115 Ga0395900_0014859 3300037418 Bacteria 7934
116 Ga0395900_0032772 3300037418 Bacteria 5344
117 Ga0395900_0048907 3300037418 Bacteria 4355
118 Ga0395900_0253453 3300037418 Bacteria 1760
119 Ga0395900_0340267 3300037418 Bacteria 1476
120 Ga0395898_0002841 3300037466 Bacteria 19817
121 Ga0395898_0037623 3300037466 Bacteria 4799
122 Ga0395898_0050158 3300037466 Unclassified 4086
123 Ga0395898_0051385 3300037466 Bacteria 4031
124 Ga0395898_0195456 3300037466 Bacteria 1932
125 Ga0395898_0269661 3300037466 Bacteria 1623
126 Ga0395905_0007192 3300037471 Bacteria 11113
127 Ga0395905_0031156 3300037471 Bacteria 5022
128 Ga0395905_0148651 3300037471 Archaea 2204
129 Ga0395905_0187567 3300037471 Unclassified 1941
130 Ga0395905_0499253 3300037471 Bacteria 1117
131 Ga0395901_0001602 3300038443 Bacteria 23437
132 Ga0395901_0020607 3300038443 Bacteria 6748
133 Ga0395901_0049560 3300038443 Unclassified 4364
134 Ga0395901_0103365 3300038443 Bacteria 2989
135 Ga0395901_0147972 3300038443 Bacteria 2468
136 Ga0395901_0243609 3300038443 Bacteria 1874
137 Ga0436360_1338070 3300039438 Bacteria 5449
138 Ga0451807_1944787 3300041486 Unclassified 914
139 Ga0466969_0001293 3300044656 Bacteria 13497
140 Ga0466961_0066409 3300044693 Bacteria 2291
141 Ga0466963_0001120 3300044694 Bacteria 13975
142 Ga0466963_0001904 3300044694 Bacteria 11411
143 Ga0466963_0004193 3300044694 Bacteria 8351
144 Ga0466963_0010328 3300044694 Bacteria 5651
145 Ga0466963_0032909 3300044694 Bacteria 3361
146 Ga0466963_0088177 3300044694 Bacteria 2110
147 Ga0466964_0004166 3300044706 Bacteria 5318
148 Ga0466964_0007046 3300044706 Unclassified 4205
149 Ga0466964_0028047 3300044706 Bacteria 2215
150 Ga0466968_0001126 3300044735 Bacteria 9463
151 Ga0466968_0001331 3300044735 Bacteria 8821
152 Ga0466968_0004668 3300044735 Bacteria 5130
153 Ga0466968_0055133 3300044735 Bacteria 1705
154 Ga0466970_0008785 3300044765 Bacteria 5088
155 Ga0466970_0031978 3300044765 Bacteria 2780
156 Ga0466957_0004455 3300044842 Bacteria 7805
157 Ga0466957_0023613 3300044842 Bacteria 3635
158 Ga0466960_0003873 3300044901 Bacteria 5802
159 Ga0466960_0202887 3300044901 Bacteria 1084
160 Ga0466959_0034294 3300045049 Bacteria 3753
161 Ga0466959_0101483 3300045049 Bacteria 2059
162 Ga0466958_0010973 3300045836 Bacteria 5091
163 Ga0466958_0017987 3300045836 Bacteria 4096
164 Ga0466967_0004269 3300045976 Bacteria 9603
165 Ga0466967_0018311 3300045976 Bacteria 5593
166 Ga0466967_0028872 3300045976 Bacteria 4636
167 Ga0466967_0048132 3300045976 Bacteria 3721
168 Ga0466967_0058798 3300045976 Bacteria 3399
169 Ga0466967_0272375 3300045976 Bacteria 1622
170 Ga0466967_0361653 3300045976 Unclassified 1406
171 Ga0495592_0000198 3300046454 Bacteria 51379
172 Ga0495590_0064416 3300046457 Bacteria 1283
173 Ga0495651_0000064 3300046462 Bacteria 78474
174 Ga0495653_0040575 3300046463 Bacteria 3637
175 Ga0495653_0095334 3300046463 Bacteria 2166
176 Ga0495582_0003878 3300046473 Bacteria 8421
177 Ga0495585_0089997 3300046492 Bacteria 1654
178 Ga0495585_0164258 3300046492 Unclassified 1151
179 Ga0495594_0092342 3300046499 Bacteria 1697
180 Ga0495596_0036687 3300046500 Bacteria 1941
181 Ga0495607_0071155 3300046501 Bacteria 1940
182 Ga0495607_0182568 3300046501 Bacteria 1051
183 Ga0495608_0001603 3300046511 Bacteria 16212
184 Ga0495618_0001975 3300046514 Bacteria 13444
185 Ga0495628_0000069 3300046516 Bacteria 82366
186 Ga0495637_0040860 3300046520 Unclassified 1994
187 Ga0495642_0065874 3300046528 Unclassified 1509
188 Ga0495652_0000356 3300046529 Bacteria 54548
189 Ga0495665_0113540 3300046531 Bacteria 1420
190 Ga0495587_0000217 3300046536 Bacteria 42662
191 Ga0495609_0027624 3300046538 Bacteria 2592
192 Ga0495645_0000085 3300046543 Bacteria 64444
193 Ga0495667_0092123 3300046559 Bacteria 1962
194 Ga0495656_0001988 3300046615 Bacteria 6740
195 Ga0495657_0004017 3300046675 Bacteria 11797
196 Ga0495599_0000146 3300046678 Bacteria 45799
197 Ga0495623_0000030 3300046679 Bacteria 85003
198 Ga0495658_0070285 3300046683 Bacteria 2031
199 Ga0495613_0011388 3300046689 Bacteria 6609
200 Ga0495670_0070977 3300046691 Bacteria 1763
201 Ga0495581_0033138 3300047315 Bacteria 2991
202 Ga0495604_0000103 3300047317 Bacteria 71556
203 Ga0495676_0042812 3300047321 Bacteria 3713
204 Ga0495680_0017382 3300047322 Bacteria 6144
205 Ga0495680_0021076 3300047322 Bacteria 5462
206 Ga0495675_0000282 3300047444 Bacteria 36859
207 Ga0495684_0007571 3300047471 Bacteria 8402
208 Ga0495602_0000080 3300048088 Bacteria 94171
209 Ga0496102_0071542 3300048905 Bacteria 3184
210 Ga0496102_0186276 3300048905 Bacteria 1956
211 Ga0496102_0269353 3300048905 Bacteria 1606
212 Ga0496103_0028937 3300048906 Bacteria 3365
213 Ga0496104_0005373 3300048907 Bacteria 11215
214 Ga0496104_0009071 3300048907 Bacteria 8843
215 Ga0496105_0004248 3300048908 Bacteria 10772
216 Ga0496107_0225904 3300048910 Bacteria 1393
217 Ga0496108_0005667 3300048911 Bacteria 10110
218 Ga0496109_0002480 3300048912 Bacteria 15458
219 Ga0496109_0006052 3300048912 Bacteria 10162
220 Ga0496111_0031211 3300048914 Bacteria 3795
221 Ga0496111_0049441 3300048914 Bacteria 3032
222 Ga0496111_0060117 3300048914 Bacteria 2754
223 Ga0496111_0063002 3300048914 Unclassified 2689
224 Ga0496112_0121769 3300048915 Bacteria 2579
225 Ga0496112_0167734 3300048915 Unclassified 2161
226 Ga0496112_0180207 3300048915 Unclassified 2076
227 Ga0496112_0214596 3300048915 Bacteria 1881
228 Ga0496113_0259090 3300048916 Unclassified 1389
229 Ga0496114_0019601 3300048917 Bacteria 5481
230 Ga0496114_0033375 3300048917 Unclassified 4241
231 Ga0496114_0201350 3300048917 Unclassified 1744
232 Ga0496115_0013463 3300048918 Bacteria 6188
233 Ga0496115_0111805 3300048918 Unclassified 2244
234 Ga0496115_0232073 3300048918 Bacteria 1521
235 Ga0501069_0029940 3300049585 Bacteria 2988
236 Ga0501076_0280973 3300049592 Bacteria 1364
237 nmdc:mga09592_392138_c1 3300050508 Bacteria 1200
238 nmdc:mga0qj67_196303_c1 3300050509 Bacteria 1640
239 nmdc:mga0n895_377782_c1 3300050512 Bacteria 1434
240 nmdc:mga0n895_63899_c1 3300050512 Bacteria 3640
241 nmdc:mga0rr50_476335_c1 3300050513 Bacteria 1060
242 Ga0495601_0000163 3300053077 Bacteria 36562
243 Ga0495595_0014815 3300053084 Bacteria 3315
244 Ga0495619_0000493 3300053085 Bacteria 26439
245 Ga0495619_0200460 3300053085 Unclassified 1381
246 Ga0501084_0260213 3300054114 Unclassified 1465
247 Ga0466962_0023084 3300061719 Bacteria 2990
248 Ga0466962_0036424 3300061719 Unclassified 2355
249 Ga0395899_0072169
250 Ga0070658_10020375
251 Ga0070658_10077170
252 Ga0070683_100005256
253 Ga0070683_100005855
254 Ga0070683_100006229
255 Ga0070683_100010814
256 Ga0070683_100057995
257 Ga0070683_100071296
258 Ga0070680_100011572
259 Ga0070682_100010182
260 Ga0068868_100172067
261 Ga0070661_100190462
262 Ga0070675_100150669
263 Ga0070674_100298076
264 Ga0070714_100078622
265 Ga0070714_100188970
266 Ga0070710_10010614
267 Ga0070711_100163418
268 Ga0070678_100003400
269 Ga0070681_10010355
270 Ga0070685_10157931
271 Ga0070707_100001649
272 Ga0070698_100016119
273 Ga0070698_100290820
274 Ga0070679_100121824
275 Ga0070684_100000360
276 Ga0070684_100000684
277 Ga0070684_100006952
278 Ga0070684_100102958
279 Ga0070684_100117452
280 Ga0070693_100008085
281 Ga0070664_100026479
282 Ga0068857_100001754
283 Ga0068857_100076479
284 Ga0068857_100107758
285 Ga0068856_100003184
286 Ga0068863_100181252
287 Ga0081455_10030402
288 Ga0081538_10043694
289 Ga0081540_1002004
290 Ga0070712_100089572
291 Ga0068871_100240726
292 Ga0075430_100082694
293 Ga0075434_100060674
294 Ga0075429_100155439
295 Ga0111539_10403705
296 Ga0105245_10007278
297 Ga0105245_10225911
298 Ga0105245_10356557
299 Ga0114129_10688605
300 Ga0105241_10075336
301 Ga0105242_10086709
302 Ga0105248_10203386
303 Ga0105248_10657087
304 Ga0105238_10202792
305 Ga0105239_10435356
306 Ga0105246_10016684
307 Ga0105246_10044989
308 Ga0157369_10100803
309 Ga0157374_10081899
310 Ga0157372_10550800
311 Ga0157375_10051061
312 Ga0163163_10273361
313 Ga0157376_10073973
314 Ga0206356_10576957
315 Ga0207688_10183915
316 Ga0207707_10048707
317 Ga0207707_10152497
318 Ga0207695_10444387
319 Ga0207693_10104327
320 Ga0207660_10333371
321 Ga0207657_10002895
322 Ga0207649_10082643
323 Ga0207652_10004016
324 Ga0207652_10258026
325 Ga0207646_10000757
326 Ga0207646_10425945
327 Ga0207687_10007950
328 Ga0207687_10093112
329 Ga0207700_10168070
330 Ga0207664_10028479
331 Ga0207664_10316085
332 Ga0207664_10378612
333 Ga0207644_10262703
334 Ga0207690_10028371
335 Ga0207661_10014175
336 Ga0207661_10109319
337 Ga0207661_10223229
338 Ga0207679_10023949
339 Ga0207712_10464155
340 Ga0207677_10334076
341 Ga0207702_10019843
342 Ga0207702_10298724
343 Ga0207648_10518297
344 Ga0207674_10002796
345 Ga0207674_10069097
346 Ga0207674_10123777
347 Ga0207674_10180748
348 Ga0207683_10009030
349 Ga0265326_10031212
350 Ga0265334_10071548
351 Ga0265338_10008512
352 Ga0265313_10102646
353 Ga0307409_100159691
354 Ga0307416_100135574
355 Ga0307415_100120445
356 Ga0373945_0093432
357 Ga0373947_0156764
358 Ga0373937_0005265
359 Ga0395899_0009535
360 Ga0395899_0020484
361 Ga0395899_0159597
362 Ga0395899_0186219
363 Ga0395900_0014859
364 Ga0395900_0032772
365 Ga0395900_0048907
366 Ga0395900_0253453
367 Ga0395900_0340267
368 Ga0395898_0002841
369 Ga0395898_0037623
370 Ga0395898_0050158
371 Ga0395898_0051385
372 Ga0395898_0195456
373 Ga0395898_0269661
374 Ga0395905_0007192
375 Ga0395905_0031156
376 Ga0395905_0148651
377 Ga0395905_0187567
378 Ga0395905_0499253
379 Ga0395901_0001602
380 Ga0395901_0020607
381 Ga0395901_0049560
382 Ga0395901_0103365
383 Ga0395901_0147972
384 Ga0395901_0243609
385 Ga0436360_1338070
386 Ga0451807_1944787
387 Ga0466969_0001293
388 Ga0466961_0066409
389 Ga0466963_0001120
390 Ga0466963_0001904
391 Ga0466963_0004193
392 Ga0466963_0010328
393 Ga0466963_0032909
394 Ga0466963_0088177
395 Ga0466964_0004166
396 Ga0466964_0007046
397 Ga0466964_0028047
398 Ga0466968_0001126
399 Ga0466968_0001331
400 Ga0466968_0004668
401 Ga0466968_0055133
402 Ga0466970_0008785
403 Ga0466970_0031978
404 Ga0466957_0004455
405 Ga0466957_0023613
406 Ga0466960_0003873
407 Ga0466960_0202887
408 Ga0466959_0034294
409 Ga0466959_0101483
410 Ga0466958_0010973
411 Ga0466958_0017987
412 Ga0466967_0004269
413 Ga0466967_0018311
414 Ga0466967_0028872
415 Ga0466967_0048132
416 Ga0466967_0058798
417 Ga0466967_0272375
418 Ga0466967_0361653
419 Ga0495592_0000198
420 Ga0495590_0064416
421 Ga0495651_0000064
422 Ga0495653_0040575
423 Ga0495653_0095334
424 Ga0495582_0003878
425 Ga0495585_0089997
426 Ga0495585_0164258
427 Ga0495594_0092342
428 Ga0495596_0036687
429 Ga0495607_0071155
430 Ga0495607_0182568
431 Ga0495608_0001603
432 Ga0495618_0001975
433 Ga0495628_0000069
434 Ga0495637_0040860
435 Ga0495642_0065874
436 Ga0495652_0000356
437 Ga0495665_0113540
438 Ga0495587_0000217
439 Ga0495609_0027624
440 Ga0495645_0000085
441 Ga0495667_0092123
442 Ga0495656_0001988
443 Ga0495657_0004017
444 Ga0495599_0000146
445 Ga0495623_0000030
446 Ga0495658_0070285
447 Ga0495613_0011388
448 Ga0495670_0070977
449 Ga0495581_0033138
450 Ga0495604_0000103
451 Ga0495676_0042812
452 Ga0495680_0017382
453 Ga0495680_0021076
454 Ga0495675_0000282
455 Ga0495684_0007571
456 Ga0495602_0000080
457 Ga0496102_0071542
458 Ga0496102_0186276
459 Ga0496102_0269353
460 Ga0496103_0028937
461 Ga0496104_0005373
462 Ga0496104_0009071
463 Ga0496105_0004248
464 Ga0496107_0225904
465 Ga0496108_0005667
466 Ga0496109_0002480
467 Ga0496109_0006052
468 Ga0496111_0031211
469 Ga0496111_0049441
470 Ga0496111_0060117
471 Ga0496111_0063002
472 Ga0496112_0121769
473 Ga0496112_0167734
474 Ga0496112_0180207
475 Ga0496112_0214596
476 Ga0496113_0259090
477 Ga0496114_0019601
478 Ga0496114_0033375
479 Ga0496114_0201350
480 Ga0496115_0013463
481 Ga0496115_0111805
482 Ga0496115_0232073
483 Ga0501069_0029940
484 Ga0501076_0280973
485 nmdc:mga09592_392138_c1
486 nmdc:mga0qj67_196303_c1
487 nmdc:mga0n895_377782_c1
488 nmdc:mga0n895_63899_c1
489 nmdc:mga0rr50_476335_c1
490 Ga0495601_0000163
491 Ga0495595_0014815
492 Ga0495619_0000493
493 Ga0495619_0200460
494 Ga0501084_0260213
495 Ga0466962_0023084
496 Ga0466962_0036424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06267

DUF1028

Family of unknown function (DUF1028)

23

205

0.98

PF08823

PG_binding_2

Putative peptidoglycan binding domain

219

279

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imh-assembly3.cif.gz_A crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.882 4 229
2imh-assembly3.cif.gz_B crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.88 4 229
3tkj-assembly1.cif.gz_B crystal structure of human asparaginase-like protein 1 thr168ala 0.8172 34 101
2imh-assembly3.cif.gz_B crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.8145 4 229
2imh-assembly3.cif.gz_A crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.7892 4 229
ID Description Score Start End Superfamily
2imhB01 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8589 4 232 3.60.20.10
2imhB01 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8236 4 232 3.60.20.10
af_Q7L266_168_305_3.60.20.30 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.6958 34 120 3.60.20.30
1k2xB00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.6659 34 121 3.60.20.30
4pu6B00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;(Glycosyl)asparaginase 0.5827 40 121 3.60.20.30
ID Description Score Start End GO Terms
AF-A0A538DZJ5-F1-model_v4 DUF1028 domain-containing protein 0.9643 107 274
AF-A0A538DZJ5-F1-model_v4 DUF1028 domain-containing protein 0.9586 107 274
AF-A0A538AIF5-F1-model_v4 DUF1028 domain-containing protein 0.9567 2 271
AF-A0A538I9B0-F1-model_v4 DUF1028 domain-containing protein 0.9527 41 274
AF-A0A7W0PHA4-F1-model_v4 DUF1028 domain-containing protein 0.9504 2 211

Map