F360011

General Info

Members Datasets Scaffolds Average Seq Length
248 197 496 206

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100037608|Ga0307409_1000376083
Length 240
Sequence MAQRTDRPERGRGELRGALTGRPSATFTVSTPRGTAEVVLDEPDRRPRGLLVLGHGASGGVNAVDLLAARDAAVAAGLAVARVTQPYRVAGRRVPPAAPILDEAWTTVVAAVRERVGRTVPLVLGGRSSGARVACRTAGDLGAVGVLALAFPLHPPGRPAASRAGELDADVLTLVVNGDRDPFGVPEPVGLVRVLVRPGQGHDLRGDPAGLRQAVTDWLAEVVPSRRARTPRPAGPARRA

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
99 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
114 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
169 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
170 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
171 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
172 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
173 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
174 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
175 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
176 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
177 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
178 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
179 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
180 2858882152 Micromonospora noduli MED15 Isolate Nodule
181 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
182 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
183 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
184 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
185 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
186 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
187 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
188 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
189 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
190 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
191 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
192 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
193 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
194 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
195 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
196 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
197 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.9
Metatranscriptomes 0
Isolates 12.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.02
Rhizoplane 9.68
Rhizosphere 77.42
Stem 0
Stem Tuber 0
Unclassified 6.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100037608 3300031995 Bacteria 3570
2 JGI25406J46586_10047220 3300003203 Bacteria 1469
3 Ga0070676_10804245 3300005328 Bacteria 694
4 Ga0070683_100057008 3300005329 Bacteria 3629
5 Ga0068869_100035699 3300005334 Bacteria 3525
6 Ga0068869_101023936 3300005334 Unclassified 720
7 Ga0070666_10267511 3300005335 Bacteria 1213
8 Ga0068868_100008518 3300005338 Bacteria 7343
9 Ga0068868_101095447 3300005338 Unclassified 733
10 Ga0070660_100038332 3300005339 Bacteria 3638
11 Ga0070691_10122104 3300005341 Bacteria 1312
12 Ga0070687_100120486 3300005343 Bacteria 1500
13 Ga0070668_100006985 3300005347 Bacteria 8363
14 Ga0070669_100652248 3300005353 Bacteria 885
15 Ga0070675_100210438 3300005354 Bacteria 1690
16 Ga0070671_100303862 3300005355 Unclassified 1359
17 Ga0070674_100058131 3300005356 Bacteria 2687
18 Ga0070673_100872268 3300005364 Bacteria 834
19 Ga0070659_100404529 3300005366 Unclassified 1153
20 Ga0070667_100120394 3300005367 Bacteria 2283
21 Ga0070709_10022952 3300005434 Bacteria 3657
22 Ga0070710_10164479 3300005437 Bacteria 1378
23 Ga0070711_100028243 3300005439 Bacteria 3690
24 Ga0070705_100212728 3300005440 Unclassified 1334
25 Ga0070694_100150811 3300005444 Bacteria 1697
26 Ga0070678_100507896 3300005456 Bacteria 1064
27 Ga0070662_100127755 3300005457 Bacteria 1956
28 Ga0068867_100606655 3300005459 Bacteria 955
29 Ga0070698_100586022 3300005471 Bacteria 1055
30 Ga0068853_100142185 3300005539 Bacteria 2155
31 Ga0070695_100267200 3300005545 Bacteria 1252
32 Ga0070696_100059156 3300005546 Bacteria 2677
33 Ga0070693_100004345 3300005547 Bacteria 6687
34 Ga0068855_100399430 3300005563 Bacteria 1506
35 Ga0070664_100661032 3300005564 Unclassified 972
36 Ga0068854_100316755 3300005578 Bacteria 1266
37 Ga0068856_100100051 3300005614 Bacteria 2891
38 Ga0068852_100095671 3300005616 Bacteria 2667
39 Ga0068864_100276049 3300005618 Bacteria 1567
40 Ga0068860_100042892 3300005843 Bacteria 4317
41 Ga0081455_10004489 3300005937 Bacteria 15615
42 Ga0081455_10215114 3300005937 Bacteria 1429
43 Ga0081540_1002204 3300005983 Bacteria 16090
44 Ga0081539_10000657 3300005985 Bacteria 69568
45 Ga0081539_10001605 3300005985 Bacteria 37235
46 Ga0070717_10234907 3300006028 Bacteria 1615
47 Ga0070717_10383580 3300006028 Bacteria 1260
48 Ga0070715_10356284 3300006163 Bacteria 801
49 Ga0070712_100378682 3300006175 Bacteria 1164
50 Ga0097621_100403200 3300006237 Bacteria 1224
51 Ga0068871_100058022 3300006358 Bacteria 3150
52 Ga0075433_10303053 3300006852 Unclassified 1415
53 Ga0075434_100289788 3300006871 Bacteria 1657
54 Ga0075434_100444662 3300006871 Bacteria 1317
55 Ga0068865_100045214 3300006881 Bacteria 3018
56 Ga0105245_10144093 3300009098 Bacteria 2247
57 Ga0105245_10641750 3300009098 Unclassified 1091
58 Ga0105243_10139228 3300009148 Bacteria 2068
59 Ga0105243_10202799 3300009148 Bacteria 1741
60 Ga0105241_10081813 3300009174 Bacteria 2530
61 Ga0105242_10062054 3300009176 Bacteria 3075
62 Ga0105248_10123551 3300009177 Bacteria 2920
63 Ga0105238_10203479 3300009551 Bacteria 1956
64 Ga0105238_10226832 3300009551 Bacteria 1845
65 Ga0105249_10004106 3300009553 Bacteria 12571
66 Ga0105249_10086325 3300009553 Bacteria 2926
67 Ga0157370_10157129 3300013104 Bacteria 2116
68 Ga0157369_10044591 3300013105 Bacteria 4825
69 Ga0163162_10041688 3300013306 Bacteria 4593
70 Ga0157372_10024325 3300013307 Bacteria 6577
71 Ga0157372_11628844 3300013307 Unclassified 743
72 Ga0157375_10089838 3300013308 Bacteria 3129
73 Ga0163163_10058424 3300014325 Bacteria 3814
74 Ga0163163_10401883 3300014325 Bacteria 1428
75 Ga0163163_10798069 3300014325 Unclassified 1007
76 Ga0157380_10208359 3300014326 Bacteria 1740
77 Ga0157379_10006318 3300014968 Bacteria 10205
78 Ga0157376_10072451 3300014969 Bacteria 2931
79 Ga0163161_10034071 3300017792 Bacteria 3641
80 Ga0207642_10126266 3300025899 Bacteria 1328
81 Ga0207688_10000688 3300025901 Bacteria 16687
82 Ga0207685_10259495 3300025905 Bacteria 844
83 Ga0207654_10333054 3300025911 Bacteria 1041
84 Ga0207695_10108920 3300025913 Bacteria 2753
85 Ga0207693_10000849 3300025915 Bacteria 27274
86 Ga0207663_10020920 3300025916 Bacteria 3714
87 Ga0207657_10007841 3300025919 Bacteria 10896
88 Ga0207681_10338769 3300025923 Bacteria 1201
89 Ga0207687_10076522 3300025927 Bacteria 2404
90 Ga0207700_10138124 3300025928 Bacteria 1999
91 Ga0207690_10127868 3300025932 Bacteria 1855
92 Ga0207669_10054622 3300025937 Bacteria 2414
93 Ga0207665_10003858 3300025939 Bacteria 10026
94 Ga0207711_10611175 3300025941 Bacteria 1017
95 Ga0207689_10164595 3300025942 Bacteria 1828
96 Ga0207661_10308713 3300025944 Bacteria 1420
97 Ga0207668_10070548 3300025972 Bacteria 2492
98 Ga0207668_10838016 3300025972 Bacteria 816
99 Ga0207640_10050511 3300025981 Bacteria 2699
100 Ga0207658_10135539 3300025986 Bacteria 1985
101 Ga0207677_10288164 3300026023 Bacteria 1351
102 Ga0207703_10492043 3300026035 Unclassified 1150
103 Ga0207678_10003872 3300026067 Bacteria 13459
104 Ga0207641_10492868 3300026088 Bacteria 1189
105 Ga0207648_10299587 3300026089 Bacteria 1442
106 Ga0207676_10929208 3300026095 Bacteria 854
107 Ga0207683_10014379 3300026121 Bacteria 6741
108 Ga0207683_10521781 3300026121 Unclassified 1098
109 Ga0207698_10273519 3300026142 Bacteria 1558
110 Ga0268265_10500602 3300028380 Bacteria 1145
111 Ga0268264_10193357 3300028381 Bacteria 1856
112 Ga0307515_10000065 3300028794 Bacteria 244497
113 Ga0307515_10192172 3300028794 Bacteria 1947
114 Ga0316181_1079132 3300030744 Bacteria 1885
115 Ga0316182_1244050 3300030745 Bacteria 6540
116 Ga0307513_10009309 3300031456 Bacteria 12439
117 Ga0316576_10006599 3300031727 Bacteria 7243
118 Ga0307516_10007505 3300031730 Bacteria 12543
119 Ga0307516_10181830 3300031730 Bacteria 1835
120 Ga0307405_10003261 3300031731 Bacteria 7405
121 Ga0307410_10033367 3300031852 Bacteria 3323
122 Ga0326468_10000101 3300031889 Bacteria 7564
123 Ga0307406_10043301 3300031901 Bacteria 2814
124 Ga0307407_10015737 3300031903 Bacteria 3749
125 Ga0307412_10090489 3300031911 Bacteria 2139
126 Ga0307412_10106670 3300031911 Bacteria 1992
127 Ga0307409_100000053 3300031995 Bacteria 41097
128 Ga0307409_100069552 3300031995 Bacteria 2790
129 Ga0307409_100228378 3300031995 Bacteria 1685
130 Ga0307409_100398963 3300031995 Bacteria 1313
131 Ga0307416_100016350 3300032002 Bacteria 5154
132 Ga0307416_100356984 3300032002 Bacteria 1482
133 Ga0307416_100465180 3300032002 Bacteria 1321
134 Ga0307416_101840122 3300032002 Bacteria 709
135 Ga0307411_10287090 3300032005 Bacteria 1313
136 Ga0307411_10807104 3300032005 Bacteria 827
137 Ga0307415_100000016 3300032126 Bacteria 78647
138 Ga0307415_100087132 3300032126 Bacteria 2249
139 Ga0373938_0040753 3300034957 Bacteria 1031
140 Ga0373929_0010034 3300035085 Bacteria 1764
141 Ga0373940_0106582 3300035088 Bacteria 856
142 Ga0373932_0014105 3300035112 Bacteria 2003
143 Ga0373941_0019345 3300035115 Bacteria 1894
144 Ga0373953_0018277 3300035117 Bacteria 2592
145 Ga0373960_0055027 3300035121 Bacteria 1191
146 Ga0373946_0321557 3300035171 Bacteria 769
147 Ga0373955_0109920 3300035172 Bacteria 1593
148 Ga0373961_0012746 3300035241 Bacteria 2110
149 Ga0373931_0061831 3300035691 Bacteria 2020
150 Ga0373927_0135667 3300035695 Bacteria 1608
151 Ga0373933_0077033 3300035724 Bacteria 2038
152 Ga0373937_0311403 3300036401 Bacteria 1489
153 Ga0316584_0247106 3300036712 Bacteria 1304
154 Ga0395901_0229769 3300038443 Bacteria 1937
155 Ga0439465_0051167 3300041413 Unclassified 1353
156 Ga0439465_0065879 3300041413 Bacteria 1207
157 Ga0451833_0688545 3300041491 Bacteria 3773
158 Ga0451837_0877452 3300041494 Bacteria 4290
159 Ga0451839_0283745 3300041496 Bacteria 2033
160 Ga0451841_0787852 3300041498 Bacteria 2106
161 Ga0439445_0016793 3300042004 Bacteria 1805
162 Ga0466966_0067254 3300044684 Bacteria 2251
163 Ga0466961_0111487 3300044693 Bacteria 1721
164 Ga0466963_0030155 3300044694 Bacteria 3497
165 Ga0466963_0078895 3300044694 Bacteria 2227
166 Ga0466963_0265900 3300044694 Bacteria 1205
167 Ga0466963_0338557 3300044694 Bacteria 1059
168 Ga0466963_0435119 3300044694 Bacteria 925
169 Ga0466963_0440754 3300044694 Bacteria 919
170 Ga0466963_0531555 3300044694 Bacteria 830
171 Ga0466957_0029097 3300044842 Bacteria 3293
172 Ga0466957_0068006 3300044842 Bacteria 2198
173 Ga0466957_0082353 3300044842 Bacteria 2006
174 Ga0466960_0038664 3300044901 Bacteria 2246
175 Ga0466960_0150004 3300044901 Bacteria 1245
176 Ga0466960_0304223 3300044901 Bacteria 899
177 Ga0466959_0102943 3300045049 Bacteria 2043
178 Ga0466959_0312601 3300045049 Bacteria 1075
179 Ga0466967_0220451 3300045976 Bacteria 1802
180 Ga0466967_0712942 3300045976 Bacteria 994
181 Ga0495629_0519824 3300046459 Bacteria 801
182 Ga0495641_0187335 3300046461 Bacteria 927
183 Ga0495653_0020510 3300046463 Bacteria 5358
184 Ga0495594_0260255 3300046499 Unclassified 988
185 Ga0495635_0008720 3300046663 Bacteria 7081
186 Ga0495674_0113078 3300047319 Bacteria 2300
187 Ga0495614_0335677 3300048089 Bacteria 703
188 Ga0496100_0624637 3300048903 Bacteria 838
189 Ga0496104_0032147 3300048907 Bacteria 4883
190 Ga0496105_0053678 3300048908 Bacteria 3328
191 Ga0496105_0074543 3300048908 Unclassified 2803
192 Ga0496106_0237696 3300048909 Bacteria 1455
193 Ga0496107_0032795 3300048910 Bacteria 3713
194 Ga0496108_0281988 3300048911 Bacteria 1446
195 Ga0496108_0529769 3300048911 Bacteria 1028
196 Ga0496109_0003117 3300048912 Bacteria 13826
197 Ga0496109_0279470 3300048912 Bacteria 1573
198 Ga0496110_0356000 3300048913 Bacteria 1334
199 Ga0496110_0491954 3300048913 Bacteria 1117
200 Ga0496110_0810775 3300048913 Unclassified 841
201 Ga0496111_0017692 3300048914 Bacteria 4929
202 Ga0496112_0018788 3300048915 Bacteria 6514
203 Ga0496112_0093203 3300048915 Bacteria 2982
204 Ga0496112_0277414 3300048915 Bacteria 1624
205 Ga0496113_0012981 3300048916 Bacteria 5621
206 Ga0496113_0042118 3300048916 Bacteria 3372
207 Ga0496114_0023902 3300048917 Bacteria 4987
208 Ga0496114_0082737 3300048917 Bacteria 2714
209 Ga0496114_0172107 3300048917 Bacteria 1888
210 Ga0496114_0913464 3300048917 Bacteria 759
211 Ga0496115_0200990 3300048918 Bacteria 1646
212 Ga0496126_0000026 3300048929 Bacteria 422310
213 Ga0501068_0430984 3300049584 Bacteria 852
214 nmdc:mga08x19_93309_c1 3300050514 Bacteria 1989
215 nmdc:mga0a205_91278_c1 3300050515 Bacteria 2943
216 Ga0495601_0311204 3300053077 Bacteria 1026
217 Ga0495619_0121148 3300053085 Bacteria 1794
218 Ga0530510_0019948 3300061734 Bacteria 4764
219 2515496319 2515154088 Bacteria 5526283
220 2515756522 2515154137 Bacteria 5711575
221 2516089252 2515154203 Bacteria 5458536
222 2623498067 2622736605 Bacteria 4992138
223 2623591568 2622736626 Bacteria 7181580
224 2676481213 2675903059 Bacteria 8644972
225 2772645760 2772190715 Bacteria 6959372
226 2831938455 2831935698 Bacteria 5963223
227 2855670562 2855670206 Bacteria 7120389
228 2855683517 2855676851 Bacteria 7063653
229 2857288908 2857288857 Bacteria 7189066
230 2858854264 2858848962 Bacteria 6963058
231 2858887245 2858882152 Bacteria 7230291
232 2858892095 2858888857 Bacteria 7060307
233 2858897787 2858895516 Bacteria 7378898
234 2858903178 2858902515 Bacteria 7086037
235 2867305455 2867302475 Bacteria 7087181
236 2869052336 2869048445 Bacteria 6875584
237 2869068486 2869061728 Bacteria 7112407
238 2869070546 2869068681 Bacteria 7205615
239 2880495521 2880489317 Bacteria 7096270
240 2880496835 2880495981 Bacteria 7340502
241 2929225457 2929219909 Bacteria 6984360
242 2929231568 2929226422 Bacteria 7248583
243 8003863426 8003856774 Bacteria 7675274
244 8003874987 8003870546 Bacteria 7396674
245 8054704479 8054704163 Bacteria 7247792
246 8054734417 8054727385 Bacteria 7558670
247 8054740180 8054734606 Bacteria 6947278
248 8056064292 8056060235 Bacteria 7259403
249 Ga0307409_100037608
250 JGI25406J46586_10047220
251 Ga0070676_10804245
252 Ga0070683_100057008
253 Ga0068869_100035699
254 Ga0068869_101023936
255 Ga0070666_10267511
256 Ga0068868_100008518
257 Ga0068868_101095447
258 Ga0070660_100038332
259 Ga0070691_10122104
260 Ga0070687_100120486
261 Ga0070668_100006985
262 Ga0070669_100652248
263 Ga0070675_100210438
264 Ga0070671_100303862
265 Ga0070674_100058131
266 Ga0070673_100872268
267 Ga0070659_100404529
268 Ga0070667_100120394
269 Ga0070709_10022952
270 Ga0070710_10164479
271 Ga0070711_100028243
272 Ga0070705_100212728
273 Ga0070694_100150811
274 Ga0070678_100507896
275 Ga0070662_100127755
276 Ga0068867_100606655
277 Ga0070698_100586022
278 Ga0068853_100142185
279 Ga0070695_100267200
280 Ga0070696_100059156
281 Ga0070693_100004345
282 Ga0068855_100399430
283 Ga0070664_100661032
284 Ga0068854_100316755
285 Ga0068856_100100051
286 Ga0068852_100095671
287 Ga0068864_100276049
288 Ga0068860_100042892
289 Ga0081455_10004489
290 Ga0081455_10215114
291 Ga0081540_1002204
292 Ga0081539_10000657
293 Ga0081539_10001605
294 Ga0070717_10234907
295 Ga0070717_10383580
296 Ga0070715_10356284
297 Ga0070712_100378682
298 Ga0097621_100403200
299 Ga0068871_100058022
300 Ga0075433_10303053
301 Ga0075434_100289788
302 Ga0075434_100444662
303 Ga0068865_100045214
304 Ga0105245_10144093
305 Ga0105245_10641750
306 Ga0105243_10139228
307 Ga0105243_10202799
308 Ga0105241_10081813
309 Ga0105242_10062054
310 Ga0105248_10123551
311 Ga0105238_10203479
312 Ga0105238_10226832
313 Ga0105249_10004106
314 Ga0105249_10086325
315 Ga0157370_10157129
316 Ga0157369_10044591
317 Ga0163162_10041688
318 Ga0157372_10024325
319 Ga0157372_11628844
320 Ga0157375_10089838
321 Ga0163163_10058424
322 Ga0163163_10401883
323 Ga0163163_10798069
324 Ga0157380_10208359
325 Ga0157379_10006318
326 Ga0157376_10072451
327 Ga0163161_10034071
328 Ga0207642_10126266
329 Ga0207688_10000688
330 Ga0207685_10259495
331 Ga0207654_10333054
332 Ga0207695_10108920
333 Ga0207693_10000849
334 Ga0207663_10020920
335 Ga0207657_10007841
336 Ga0207681_10338769
337 Ga0207687_10076522
338 Ga0207700_10138124
339 Ga0207690_10127868
340 Ga0207669_10054622
341 Ga0207665_10003858
342 Ga0207711_10611175
343 Ga0207689_10164595
344 Ga0207661_10308713
345 Ga0207668_10070548
346 Ga0207668_10838016
347 Ga0207640_10050511
348 Ga0207658_10135539
349 Ga0207677_10288164
350 Ga0207703_10492043
351 Ga0207678_10003872
352 Ga0207641_10492868
353 Ga0207648_10299587
354 Ga0207676_10929208
355 Ga0207683_10014379
356 Ga0207683_10521781
357 Ga0207698_10273519
358 Ga0268265_10500602
359 Ga0268264_10193357
360 Ga0307515_10000065
361 Ga0307515_10192172
362 Ga0316181_1079132
363 Ga0316182_1244050
364 Ga0307513_10009309
365 Ga0316576_10006599
366 Ga0307516_10007505
367 Ga0307516_10181830
368 Ga0307405_10003261
369 Ga0307410_10033367
370 Ga0326468_10000101
371 Ga0307406_10043301
372 Ga0307407_10015737
373 Ga0307412_10090489
374 Ga0307412_10106670
375 Ga0307409_100000053
376 Ga0307409_100069552
377 Ga0307409_100228378
378 Ga0307409_100398963
379 Ga0307416_100016350
380 Ga0307416_100356984
381 Ga0307416_100465180
382 Ga0307416_101840122
383 Ga0307411_10287090
384 Ga0307411_10807104
385 Ga0307415_100000016
386 Ga0307415_100087132
387 Ga0373938_0040753
388 Ga0373929_0010034
389 Ga0373940_0106582
390 Ga0373932_0014105
391 Ga0373941_0019345
392 Ga0373953_0018277
393 Ga0373960_0055027
394 Ga0373946_0321557
395 Ga0373955_0109920
396 Ga0373961_0012746
397 Ga0373931_0061831
398 Ga0373927_0135667
399 Ga0373933_0077033
400 Ga0373937_0311403
401 Ga0316584_0247106
402 Ga0395901_0229769
403 Ga0439465_0051167
404 Ga0439465_0065879
405 Ga0451833_0688545
406 Ga0451837_0877452
407 Ga0451839_0283745
408 Ga0451841_0787852
409 Ga0439445_0016793
410 Ga0466966_0067254
411 Ga0466961_0111487
412 Ga0466963_0030155
413 Ga0466963_0078895
414 Ga0466963_0265900
415 Ga0466963_0338557
416 Ga0466963_0435119
417 Ga0466963_0440754
418 Ga0466963_0531555
419 Ga0466957_0029097
420 Ga0466957_0068006
421 Ga0466957_0082353
422 Ga0466960_0038664
423 Ga0466960_0150004
424 Ga0466960_0304223
425 Ga0466959_0102943
426 Ga0466959_0312601
427 Ga0466967_0220451
428 Ga0466967_0712942
429 Ga0495629_0519824
430 Ga0495641_0187335
431 Ga0495653_0020510
432 Ga0495594_0260255
433 Ga0495635_0008720
434 Ga0495674_0113078
435 Ga0495614_0335677
436 Ga0496100_0624637
437 Ga0496104_0032147
438 Ga0496105_0053678
439 Ga0496105_0074543
440 Ga0496106_0237696
441 Ga0496107_0032795
442 Ga0496108_0281988
443 Ga0496108_0529769
444 Ga0496109_0003117
445 Ga0496109_0279470
446 Ga0496110_0356000
447 Ga0496110_0491954
448 Ga0496110_0810775
449 Ga0496111_0017692
450 Ga0496112_0018788
451 Ga0496112_0093203
452 Ga0496112_0277414
453 Ga0496113_0012981
454 Ga0496113_0042118
455 Ga0496114_0023902
456 Ga0496114_0082737
457 Ga0496114_0172107
458 Ga0496114_0913464
459 Ga0496115_0200990
460 Ga0496126_0000026
461 Ga0501068_0430984
462 nmdc:mga08x19_93309_c1
463 nmdc:mga0a205_91278_c1
464 Ga0495601_0311204
465 Ga0495619_0121148
466 Ga0530510_0019948
467 2515496319
468 2515756522
469 2516089252
470 2623498067
471 2623591568
472 2676481213
473 2772645760
474 2831938455
475 2855670562
476 2855683517
477 2857288908
478 2858854264
479 2858887245
480 2858892095
481 2858897787
482 2858903178
483 2867305455
484 2869052336
485 2869068486
486 2869070546
487 2880495521
488 2880496835
489 2929225457
490 2929231568
491 8003863426
492 8003874987
493 8054704479
494 8054734417
495 8054740180
496 8056064292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

47

196

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.8176 2 196
3pf9-assembly1.cif.gz_A crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant 0.7944 2 197
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.7904 2 203
2wtm-assembly2.cif.gz_D est1e from butyrivibrio proteoclasticus 0.7874 3 198
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.7839 2 196
ID Description Score Start End Superfamily
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8077 14 191 3.40.50.1820
af_A0A2R8RQ35_2_224_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.806 2 199 3.40.50.1820
af_Q5JUR7_11_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8027 11 181 3.40.50.1820
af_B4FGW5_14_203_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.792 20 182 3.40.50.1820
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7904 2 203 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q7ZGX0-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9849 2 203
AF-A0A1K0FDA9-F1-model_v4 Alpha/beta hydrolase 0.9816 1 203 GO:0016787
AF-A0A1I2J481-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9809 2 203
AF-A0A7R7DS83-F1-model_v4 Alpha/beta hydrolase 0.9784 38 203 GO:0016787
AF-A0A1I2J481-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.976 2 203

Map