F359950

General Info

Members Datasets Scaffolds Average Seq Length
248 156 496 206

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10021977|Ga0207661_100219775
Length 231
Sequence MPLRTECPRCPTPLQSTTPATGVATGNGWSCPEHGPTPALRRPDEASYDEFAEVLATAGEFPTYLPWPMSPGWTVSDFGVVGDPGDGPSEGHSAKATLTCSSGTSALDGPVDVFVVSEESGTGLGSRCAGTLHLDPGPEIGVGPPTVRVRINSQSVPLWSVSTVSPLSSVDDDRELDRSVVAGEAHGRWLWVVLRPASAILLLRDEWILRDVSGIGPPLVEMSFGGPSPSW

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.4
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 12.5
Rhizosphere 82.26
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10021977 3300025944 Bacteria 4793
2 Ga0070658_10023034 3300005327 Bacteria 4999
3 Ga0070658_10092411 3300005327 Bacteria 2495
4 Ga0070683_100016392 3300005329 Bacteria 6535
5 Ga0070683_100020930 3300005329 Bacteria 5832
6 Ga0070683_100077502 3300005329 Bacteria 3108
7 Ga0070683_100085146 3300005329 Bacteria 2963
8 Ga0070683_100721652 3300005329 Bacteria 955
9 Ga0070680_100430395 3300005336 Bacteria 1126
10 Ga0070682_100016917 3300005337 Bacteria 4244
11 Ga0070682_100023371 3300005337 Bacteria 3669
12 Ga0070682_100743714 3300005337 Bacteria 791
13 Ga0068868_100117805 3300005338 Bacteria 2164
14 Ga0070660_100427591 3300005339 Bacteria 1097
15 Ga0070687_100081944 3300005343 Bacteria 1763
16 Ga0070692_10271509 3300005345 Bacteria 1024
17 Ga0070674_100310993 3300005356 Bacteria 1259
18 Ga0070673_100268569 3300005364 Bacteria 1492
19 Ga0070701_10452773 3300005438 Bacteria 824
20 Ga0070663_100091248 3300005455 Bacteria 2257
21 Ga0070681_10056474 3300005458 Bacteria 3907
22 Ga0070679_100004104 3300005530 Bacteria 13426
23 Ga0070684_100002154 3300005535 Bacteria 14537
24 Ga0070684_100223251 3300005535 Bacteria 1719
25 Ga0070684_100308948 3300005535 Bacteria 1452
26 Ga0068853_100433696 3300005539 Bacteria 1234
27 Ga0070672_100534359 3300005543 Bacteria 1017
28 Ga0070665_100000482 3300005548 Bacteria 57252
29 Ga0068855_100278838 3300005563 Bacteria 1857
30 Ga0068857_100310371 3300005577 Bacteria 1455
31 Ga0068856_100118947 3300005614 Bacteria 2643
32 Ga0070702_100238855 3300005615 Bacteria 1225
33 Ga0068852_100577344 3300005616 Unclassified 1127
34 Ga0068859_101050633 3300005617 Bacteria 895
35 Ga0068861_100339788 3300005719 Bacteria 1314
36 Ga0068860_100058167 3300005843 Bacteria 3675
37 Ga0075365_10049200 3300006038 Bacteria 2777
38 Ga0075365_10190732 3300006038 Bacteria 1434
39 Ga0075365_10263053 3300006038 Bacteria 1213
40 Ga0075368_10000780 3300006042 Bacteria 9794
41 Ga0097621_100606117 3300006237 Bacteria 1001
42 Ga0075428_100170336 3300006844 Bacteria 2361
43 Ga0068865_100022333 3300006881 Bacteria 4126
44 Ga0068865_100314801 3300006881 Bacteria 1257
45 Ga0068865_100350296 3300006881 Bacteria 1196
46 Ga0097620_101050896 3300006931 Bacteria 895
47 Ga0111539_10114497 3300009094 Bacteria 3163
48 Ga0105245_10000871 3300009098 Bacteria 27350
49 Ga0105245_10249577 3300009098 Bacteria 1723
50 Ga0105245_10434329 3300009098 Bacteria 1318
51 Ga0105245_10498290 3300009098 Bacteria 1234
52 Ga0105245_11024470 3300009098 Bacteria 870
53 Ga0105245_11042772 3300009098 Bacteria 863
54 Ga0105243_10109630 3300009148 Bacteria 2306
55 Ga0105243_10163062 3300009148 Bacteria 1924
56 Ga0105243_10173411 3300009148 Bacteria 1870
57 Ga0105243_10587330 3300009148 Bacteria 1070
58 Ga0105243_10635093 3300009148 Bacteria 1033
59 Ga0105242_10376293 3300009176 Bacteria 1319
60 Ga0105242_10864744 3300009176 Bacteria 901
61 Ga0105237_10093552 3300009545 Bacteria 2995
62 Ga0105249_11140010 3300009553 Bacteria 850
63 Ga0105246_10016467 3300011119 Bacteria 4682
64 Ga0105246_10104174 3300011119 Bacteria 2072
65 Ga0157342_1005744 3300012507 Bacteria 1150
66 Ga0157369_10768007 3300013105 Bacteria 991
67 Ga0163162_10017275 3300013306 Bacteria 7059
68 Ga0157375_10965601 3300013308 Bacteria 993
69 Ga0163163_10144958 3300014325 Bacteria 2418
70 Ga0163163_10349427 3300014325 Bacteria 1535
71 Ga0157380_10028923 3300014326 Bacteria 4232
72 Ga0182008_10059438 3300014497 Bacteria 1886
73 Ga0182008_10168090 3300014497 Unclassified 1106
74 Ga0163161_10140490 3300017792 Bacteria 1829
75 Ga0206353_10401723 3300020082 Bacteria 2814
76 Ga0213876_10101674 3300021384 Bacteria 1524
77 Ga0207688_10137067 3300025901 Bacteria 1438
78 Ga0207688_10167760 3300025901 Bacteria 1304
79 Ga0207647_10009800 3300025904 Bacteria 6794
80 Ga0207643_10273688 3300025908 Bacteria 1045
81 Ga0207705_10087908 3300025909 Bacteria 2273
82 Ga0207707_10091678 3300025912 Bacteria 2656
83 Ga0207660_10018779 3300025917 Bacteria 4614
84 Ga0207662_10130394 3300025918 Bacteria 1584
85 Ga0207657_10228151 3300025919 Bacteria 1490
86 Ga0207652_10008205 3300025921 Bacteria 8386
87 Ga0207652_10286750 3300025921 Bacteria 1486
88 Ga0207687_10011917 3300025927 Bacteria 5686
89 Ga0207669_10026755 3300025937 Bacteria 3145
90 Ga0207704_10030155 3300025938 Bacteria 3037
91 Ga0207689_10648025 3300025942 Bacteria 890
92 Ga0207661_10006979 3300025944 Bacteria 8010
93 Ga0207661_10116761 3300025944 Bacteria 2266
94 Ga0207661_10164785 3300025944 Bacteria 1925
95 Ga0207661_10475745 3300025944 Bacteria 1140
96 Ga0207661_10640854 3300025944 Bacteria 976
97 Ga0207679_10064945 3300025945 Bacteria 2730
98 Ga0207679_10430459 3300025945 Bacteria 1166
99 Ga0207667_10261718 3300025949 Bacteria 1769
100 Ga0207712_10221039 3300025961 Bacteria 1514
101 Ga0207703_10276473 3300026035 Bacteria 1523
102 Ga0207639_10455855 3300026041 Bacteria 1162
103 Ga0207678_10403065 3300026067 Bacteria 1184
104 Ga0207676_10023181 3300026095 Bacteria 4575
105 Ga0207675_100219464 3300026118 Bacteria 1832
106 Ga0207683_10034304 3300026121 Bacteria 4409
107 Ga0207683_10427372 3300026121 Bacteria 1220
108 Ga0207698_10192362 3300026142 Bacteria 1819
109 Ga0209813_10008370 3300027866 Bacteria 2611
110 Ga0207428_10110966 3300027907 Bacteria 2111
111 Ga0268266_10002733 3300028379 Bacteria 18462
112 Ga0268266_10067187 3300028379 Bacteria 3103
113 Ga0268264_10077049 3300028381 Bacteria 2839
114 Ga0307408_100398653 3300031548 Bacteria 1181
115 Ga0307408_100404773 3300031548 Bacteria 1173
116 Ga0307413_10127827 3300031824 Bacteria 1734
117 Ga0307413_10338332 3300031824 Bacteria 1156
118 Ga0307413_10439116 3300031824 Bacteria 1033
119 Ga0307410_10080605 3300031852 Bacteria 2284
120 Ga0307407_10012585 3300031903 Bacteria 4073
121 Ga0307407_10237320 3300031903 Bacteria 1242
122 Ga0307407_10535671 3300031903 Bacteria 863
123 Ga0307412_10242353 3300031911 Bacteria 1395
124 Ga0307412_10274743 3300031911 Bacteria 1320
125 Ga0307409_100083290 3300031995 Bacteria 2593
126 Ga0307409_100237255 3300031995 Bacteria 1657
127 Ga0307416_100116817 3300032002 Bacteria 2366
128 Ga0307416_100640807 3300032002 Bacteria 1146
129 Ga0307416_100774646 3300032002 Bacteria 1053
130 Ga0307414_10077976 3300032004 Bacteria 2414
131 Ga0307411_10342486 3300032005 Unclassified 1215
132 Ga0307415_100184277 3300032126 Bacteria 1641
133 Ga0307415_100387103 3300032126 Bacteria 1189
134 Ga0373960_0100008 3300035121 Bacteria 939
135 Ga0395899_0064360 3300037312 Bacteria 2696
136 Ga0395900_0326279 3300037418 Bacteria 1514
137 Ga0395898_0190661 3300037466 Bacteria 1958
138 Ga0395901_0085743 3300038443 Bacteria 3292
139 Ga0395901_0106677 3300038443 Bacteria 2940
140 Ga0395901_0891656 3300038443 Bacteria 872
141 Ga0436365_1365569 3300039437 Bacteria 2502
142 Ga0451843_0947304 3300041509 Unclassified 699
143 Ga0451853_0034434 3300041512 Bacteria 1056
144 Ga0466969_0010007 3300044656 Bacteria 5029
145 Ga0466972_0023258 3300044658 Bacteria 3082
146 Ga0466965_0066335 3300044683 Bacteria 1809
147 Ga0466966_0020019 3300044684 Bacteria 4402
148 Ga0466966_0138793 3300044684 Bacteria 1486
149 Ga0466961_0008262 3300044693 Bacteria 6631
150 Ga0466961_0057404 3300044693 Bacteria 2478
151 Ga0466963_0005938 3300044694 Bacteria 7189
152 Ga0466963_0292526 3300044694 Bacteria 1145
153 Ga0466963_0643315 3300044694 Bacteria 749
154 Ga0466964_0046526 3300044706 Bacteria 1769
155 Ga0466971_0080462 3300044719 Bacteria 1485
156 Ga0466968_0042980 3300044735 Bacteria 1912
157 Ga0466970_0152138 3300044765 Bacteria 1277
158 Ga0466957_0111804 3300044842 Unclassified 1733
159 Ga0466957_0136697 3300044842 Bacteria 1576
160 Ga0466960_0007150 3300044901 Bacteria 4516
161 Ga0466960_0145197 3300044901 Bacteria 1263
162 Ga0466959_0016728 3300045049 Bacteria 5365
163 Ga0451576_0757348 3300045051 Bacteria 1020
164 Ga0466958_0023304 3300045836 Bacteria 3632
165 Ga0466967_0035548 3300045976 Bacteria 4243
166 Ga0466967_0036619 3300045976 Bacteria 4190
167 Ga0466967_0039643 3300045976 Bacteria 4051
168 Ga0466967_0217850 3300045976 Bacteria 1813
169 Ga0466967_0222938 3300045976 Bacteria 1792
170 Ga0466967_0583856 3300045976 Bacteria 1102
171 Ga0466967_1021263 3300045976 Bacteria 823
172 Ga0466967_1422828 3300045976 Bacteria 691
173 Ga0495603_0074976 3300046455 Bacteria 1986
174 Ga0495629_0737052 3300046459 Unclassified 653
175 Ga0495582_0237260 3300046473 Bacteria 1045
176 Ga0495635_0319604 3300046663 Bacteria 1039
177 Ga0495657_0130191 3300046675 Bacteria 1577
178 Ga0495658_0044558 3300046683 Bacteria 2487
179 Ga0496100_0284716 3300048903 Bacteria 1233
180 Ga0496100_0344527 3300048903 Unclassified 1124
181 Ga0496100_0818385 3300048903 Bacteria 730
182 Ga0496101_0237914 3300048904 Bacteria 1417
183 Ga0496101_0247122 3300048904 Unclassified 1389
184 Ga0496102_0092304 3300048905 Bacteria 2803
185 Ga0496102_0157247 3300048905 Bacteria 2137
186 Ga0496103_0038972 3300048906 Bacteria 2919
187 Ga0496103_0196042 3300048906 Bacteria 1299
188 Ga0496105_0282197 3300048908 Bacteria 1339
189 Ga0496106_0586258 3300048909 Unclassified 893
190 Ga0496107_0025565 3300048910 Bacteria 4181
191 Ga0496109_0137334 3300048912 Bacteria 2285
192 Ga0496109_0298754 3300048912 Bacteria 1518
193 Ga0496109_0309774 3300048912 Bacteria 1489
194 Ga0496109_0382700 3300048912 Bacteria 1329
195 Ga0496109_0446508 3300048912 Bacteria 1222
196 Ga0496109_0740430 3300048912 Bacteria 921
197 Ga0496110_0023889 3300048913 Bacteria 5204
198 Ga0496110_0159226 3300048913 Bacteria 2046
199 Ga0496110_0341345 3300048913 Bacteria 1364
200 Ga0496110_0372791 3300048913 Bacteria 1301
201 Ga0496110_0401913 3300048913 Bacteria 1249
202 Ga0496110_0700179 3300048913 Unclassified 914
203 Ga0496111_0476506 3300048914 Bacteria 920
204 Ga0496112_0403511 3300048915 Bacteria 1307
205 Ga0496112_0911169 3300048915 Unclassified 801
206 Ga0496113_0168692 3300048916 Bacteria 1733
207 Ga0496114_0220745 3300048917 Bacteria 1664
208 Ga0496114_0557760 3300048917 Bacteria 1012
209 Ga0496114_0999388 3300048917 Bacteria 720
210 Ga0501031_0113947 3300049568 Bacteria 1766
211 Ga0501034_0238398 3300049571 Bacteria 1766
212 Ga0501039_0056267 3300049575 Bacteria 3047
213 Ga0501041_0097300 3300049577 Bacteria 1820
214 Ga0501047_0607617 3300049581 Bacteria 915
215 Ga0501067_0042401 3300049583 Bacteria 2526
216 Ga0501067_0064782 3300049583 Bacteria 2023
217 Ga0501067_0168406 3300049583 Bacteria 1220
218 Ga0501067_0303215 3300049583 Bacteria 889
219 Ga0501067_0417795 3300049583 Bacteria 748
220 Ga0501068_0008941 3300049584 Bacteria 5591
221 Ga0501068_0024384 3300049584 Bacteria 3552
222 Ga0501068_0554800 3300049584 Bacteria 747
223 Ga0501069_0010245 3300049585 Bacteria 4960
224 Ga0501069_0195769 3300049585 Bacteria 1170
225 Ga0501069_0330755 3300049585 Bacteria 896
226 Ga0501069_0427397 3300049585 Bacteria 786
227 Ga0501070_0244906 3300049586 Bacteria 1467
228 Ga0501070_0843301 3300049586 Bacteria 717
229 Ga0501072_0082690 3300049588 Bacteria 2545
230 Ga0501074_0622373 3300049590 Bacteria 763
231 Ga0501076_0060527 3300049592 Bacteria 3013
232 Ga0501225_0136021 3300049705 Bacteria 740
233 Ga0501079_0804430 3300049741 Bacteria 740
234 Ga0501079_1062062 3300049741 Bacteria 638
235 Ga0501271_012225 3300049768 Bacteria 927
236 Ga0501045_0192220 3300049824 Bacteria 1521
237 Ga0501045_0270206 3300049824 Bacteria 1266
238 nmdc:mga03n38_670_c1 3300050490 Bacteria 8867
239 nmdc:mga0yw44_23900_c1 3300050492 Bacteria 3450
240 nmdc:mga06z11_3667_c1 3300050494 Bacteria 5963
241 nmdc:mga0n895_369368_c1 3300050512 Bacteria 1452
242 Ga0495619_0351782 3300053085 Bacteria 1019
243 Ga0501084_0694773 3300054114 Bacteria 858
244 Ga0501082_0597002 3300060353 Bacteria 966
245 Ga0466962_0006751 3300061719 Bacteria 5504
246 Ga0466962_0026074 3300061719 Bacteria 2807
247 Ga0530510_0151835 3300061734 Bacteria 1711
248 2857484970 2857481737 Bacteria 4761446
249 Ga0207661_10021977
250 Ga0070658_10023034
251 Ga0070658_10092411
252 Ga0070683_100016392
253 Ga0070683_100020930
254 Ga0070683_100077502
255 Ga0070683_100085146
256 Ga0070683_100721652
257 Ga0070680_100430395
258 Ga0070682_100016917
259 Ga0070682_100023371
260 Ga0070682_100743714
261 Ga0068868_100117805
262 Ga0070660_100427591
263 Ga0070687_100081944
264 Ga0070692_10271509
265 Ga0070674_100310993
266 Ga0070673_100268569
267 Ga0070701_10452773
268 Ga0070663_100091248
269 Ga0070681_10056474
270 Ga0070679_100004104
271 Ga0070684_100002154
272 Ga0070684_100223251
273 Ga0070684_100308948
274 Ga0068853_100433696
275 Ga0070672_100534359
276 Ga0070665_100000482
277 Ga0068855_100278838
278 Ga0068857_100310371
279 Ga0068856_100118947
280 Ga0070702_100238855
281 Ga0068852_100577344
282 Ga0068859_101050633
283 Ga0068861_100339788
284 Ga0068860_100058167
285 Ga0075365_10049200
286 Ga0075365_10190732
287 Ga0075365_10263053
288 Ga0075368_10000780
289 Ga0097621_100606117
290 Ga0075428_100170336
291 Ga0068865_100022333
292 Ga0068865_100314801
293 Ga0068865_100350296
294 Ga0097620_101050896
295 Ga0111539_10114497
296 Ga0105245_10000871
297 Ga0105245_10249577
298 Ga0105245_10434329
299 Ga0105245_10498290
300 Ga0105245_11024470
301 Ga0105245_11042772
302 Ga0105243_10109630
303 Ga0105243_10163062
304 Ga0105243_10173411
305 Ga0105243_10587330
306 Ga0105243_10635093
307 Ga0105242_10376293
308 Ga0105242_10864744
309 Ga0105237_10093552
310 Ga0105249_11140010
311 Ga0105246_10016467
312 Ga0105246_10104174
313 Ga0157342_1005744
314 Ga0157369_10768007
315 Ga0163162_10017275
316 Ga0157375_10965601
317 Ga0163163_10144958
318 Ga0163163_10349427
319 Ga0157380_10028923
320 Ga0182008_10059438
321 Ga0182008_10168090
322 Ga0163161_10140490
323 Ga0206353_10401723
324 Ga0213876_10101674
325 Ga0207688_10137067
326 Ga0207688_10167760
327 Ga0207647_10009800
328 Ga0207643_10273688
329 Ga0207705_10087908
330 Ga0207707_10091678
331 Ga0207660_10018779
332 Ga0207662_10130394
333 Ga0207657_10228151
334 Ga0207652_10008205
335 Ga0207652_10286750
336 Ga0207687_10011917
337 Ga0207669_10026755
338 Ga0207704_10030155
339 Ga0207689_10648025
340 Ga0207661_10006979
341 Ga0207661_10116761
342 Ga0207661_10164785
343 Ga0207661_10475745
344 Ga0207661_10640854
345 Ga0207679_10064945
346 Ga0207679_10430459
347 Ga0207667_10261718
348 Ga0207712_10221039
349 Ga0207703_10276473
350 Ga0207639_10455855
351 Ga0207678_10403065
352 Ga0207676_10023181
353 Ga0207675_100219464
354 Ga0207683_10034304
355 Ga0207683_10427372
356 Ga0207698_10192362
357 Ga0209813_10008370
358 Ga0207428_10110966
359 Ga0268266_10002733
360 Ga0268266_10067187
361 Ga0268264_10077049
362 Ga0307408_100398653
363 Ga0307408_100404773
364 Ga0307413_10127827
365 Ga0307413_10338332
366 Ga0307413_10439116
367 Ga0307410_10080605
368 Ga0307407_10012585
369 Ga0307407_10237320
370 Ga0307407_10535671
371 Ga0307412_10242353
372 Ga0307412_10274743
373 Ga0307409_100083290
374 Ga0307409_100237255
375 Ga0307416_100116817
376 Ga0307416_100640807
377 Ga0307416_100774646
378 Ga0307414_10077976
379 Ga0307411_10342486
380 Ga0307415_100184277
381 Ga0307415_100387103
382 Ga0373960_0100008
383 Ga0395899_0064360
384 Ga0395900_0326279
385 Ga0395898_0190661
386 Ga0395901_0085743
387 Ga0395901_0106677
388 Ga0395901_0891656
389 Ga0436365_1365569
390 Ga0451843_0947304
391 Ga0451853_0034434
392 Ga0466969_0010007
393 Ga0466972_0023258
394 Ga0466965_0066335
395 Ga0466966_0020019
396 Ga0466966_0138793
397 Ga0466961_0008262
398 Ga0466961_0057404
399 Ga0466963_0005938
400 Ga0466963_0292526
401 Ga0466963_0643315
402 Ga0466964_0046526
403 Ga0466971_0080462
404 Ga0466968_0042980
405 Ga0466970_0152138
406 Ga0466957_0111804
407 Ga0466957_0136697
408 Ga0466960_0007150
409 Ga0466960_0145197
410 Ga0466959_0016728
411 Ga0451576_0757348
412 Ga0466958_0023304
413 Ga0466967_0035548
414 Ga0466967_0036619
415 Ga0466967_0039643
416 Ga0466967_0217850
417 Ga0466967_0222938
418 Ga0466967_0583856
419 Ga0466967_1021263
420 Ga0466967_1422828
421 Ga0495603_0074976
422 Ga0495629_0737052
423 Ga0495582_0237260
424 Ga0495635_0319604
425 Ga0495657_0130191
426 Ga0495658_0044558
427 Ga0496100_0284716
428 Ga0496100_0344527
429 Ga0496100_0818385
430 Ga0496101_0237914
431 Ga0496101_0247122
432 Ga0496102_0092304
433 Ga0496102_0157247
434 Ga0496103_0038972
435 Ga0496103_0196042
436 Ga0496105_0282197
437 Ga0496106_0586258
438 Ga0496107_0025565
439 Ga0496109_0137334
440 Ga0496109_0298754
441 Ga0496109_0309774
442 Ga0496109_0382700
443 Ga0496109_0446508
444 Ga0496109_0740430
445 Ga0496110_0023889
446 Ga0496110_0159226
447 Ga0496110_0341345
448 Ga0496110_0372791
449 Ga0496110_0401913
450 Ga0496110_0700179
451 Ga0496111_0476506
452 Ga0496112_0403511
453 Ga0496112_0911169
454 Ga0496113_0168692
455 Ga0496114_0220745
456 Ga0496114_0557760
457 Ga0496114_0999388
458 Ga0501031_0113947
459 Ga0501034_0238398
460 Ga0501039_0056267
461 Ga0501041_0097300
462 Ga0501047_0607617
463 Ga0501067_0042401
464 Ga0501067_0064782
465 Ga0501067_0168406
466 Ga0501067_0303215
467 Ga0501067_0417795
468 Ga0501068_0008941
469 Ga0501068_0024384
470 Ga0501068_0554800
471 Ga0501069_0010245
472 Ga0501069_0195769
473 Ga0501069_0330755
474 Ga0501069_0427397
475 Ga0501070_0244906
476 Ga0501070_0843301
477 Ga0501072_0082690
478 Ga0501074_0622373
479 Ga0501076_0060527
480 Ga0501225_0136021
481 Ga0501079_0804430
482 Ga0501079_1062062
483 Ga0501271_012225
484 Ga0501045_0192220
485 Ga0501045_0270206
486 nmdc:mga03n38_670_c1
487 nmdc:mga0yw44_23900_c1
488 nmdc:mga06z11_3667_c1
489 nmdc:mga0n895_369368_c1
490 Ga0495619_0351782
491 Ga0501084_0694773
492 Ga0501082_0597002
493 Ga0466962_0006751
494 Ga0466962_0026074
495 Ga0530510_0151835
496 2857484970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20544

DUF6758

Family of unknown function (DUF6758)

1

231

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5evh-assembly1.cif.gz_A-2 crystal structure of known function protein from kribbella flavida dsm 17836 0.6693 68 107
7d8c-assembly1.cif.gz_A crystal structure of the cas12i1-crrna binary complex 0.5711 160 178
2p4b-assembly1.cif.gz_A crystal structure of e.coli rseb 0.5709 61 194
4fcz-assembly2.cif.gz_B crystal structure of toluene-tolerance protein from pseudomonas putida (strain kt2440), northeast structural genomics consortium (nesg) target ppr99 0.564 64 111
3m4w-assembly2.cif.gz_B structural basis for the negative regulation of bacterial stress response by rseb 0.5529 59 190
ID Description Score Start End Superfamily
af_Q58FW4_193_288_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.711 69 107 3.30.390.80
af_Q9N5H3_1_133_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7075 68 107 3.10.450.50
af_A0A0R0IXN8_164_279_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.7023 69 107 3.30.390.80
af_Q4CS17_13_234_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6604 147 179 3.50.50.60
af_I1MCG5_8_142_3.30.450.60 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.6589 147 187 3.30.450.60
ID Description Score Start End GO Terms
AF-A0A2P2CG84-F1-model_v4 Uncharacterized protein 0.9416 1 214
AF-A0A2P2CG84-F1-model_v4 Uncharacterized protein 0.9372 1 214
AF-A0A4Q5J923-F1-model_v4 Uncharacterized protein 0.9272 39 214
AF-A0A6G7XW88-F1-model_v4 Uncharacterized protein 0.9186 39 214
AF-A0A1J4MWT9-F1-model_v4 Uncharacterized protein 0.9142 1 214

Map