F359784

General Info

Members Datasets Scaffolds Average Seq Length
248 172 496 457

Family's Representative Sequence

Representative Sequence 3300006194|Ga0075427_10000265|Ga0075427_100002652
Length 488
Sequence MPKTQTRFVCQECGRVAVSYMGKCPQCGSFNSMVEEIIHDEPVAKGTAVRGLTGRSSPRSIGDVLSDAEDRINLPIGEFARVLGGGIVPGSIVLVGGDPGIGKSTLMLQMAMEMAAQKRVLYVSGEESERQIKMRAVRLNNNVGVQRDGRSSKSPNGSAVPLPSNLLLVTETNLEIIFNHINEVKPELLIVDSIQTVYLSEMDSSAGSVSQVRECSSQLRELAKTSGISVFVIGHVTKEGNIAGPRVLEHIVDTVLYLEGDRFQAYRLLRSVKNRFGATSEVGVFEMREGGLAEVTNPSEAFLAERMINAAGSAIAVTMEGTRPILVEIQGLTSPTQFGNARRTANGVDFNRLLLTTAVLTRRVGLKLSEQDIFVNVVGGLQIDEPAADLAVAAAIASSWRDTPVKADAVLIAEIGLAGELRMPGQMQARLREAQKLGFKSAIVPKALRKGEPYPKGIEVIEVRSLDQALSSAFASTTNVPKAPPHMA

Samples

Sample ID Description Type Environment
1 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
54 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
78 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
115 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
116 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
117 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
118 2643221731 Bacillus sp. Root147 Isolate Unclassified
119 2643221732 Bacillus sp. Root239 Isolate Unclassified
120 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
121 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
122 2738541295 Bacillus sp. OK085 Isolate Unclassified
123 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
124 2738543017 Bacillus sp. OV186 Isolate Unclassified
125 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
126 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
127 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
128 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
129 2802429420 Priestia filamentosa HL2HP6 Isolate Unclassified
130 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
131 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
132 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
133 2818991441 Niallia circulans 3243 Isolate Rhizosphere
134 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
135 2842682962 Bacillus sp. R-72492 Isolate Unclassified
136 2842882022 Bacillus sp. R-71893 Isolate Unclassified
137 2849139964 Bacillus sp. R-71875 Isolate Unclassified
138 2857581216 Bacillus sp. R-71922 Isolate Unclassified
139 2857586860 Bacillus sp. R-71935 Isolate Unclassified
140 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
141 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
142 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
143 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
144 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
145 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
146 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
147 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
148 2919720352 Priestia megaterium 4340 Isolate Unclassified
149 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
150 2929004312 Priestia megaterium 1104 Isolate Unclassified
151 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
152 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
153 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
154 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
155 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
156 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
157 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
158 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
159 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
160 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
161 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
162 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
163 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
164 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
165 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
166 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
167 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
168 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
169 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
170 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
171 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
172 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75
Metatranscriptomes 1.21
Isolates 23.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.05
Nodule 0
Rhizoplane 8.47
Rhizosphere 66.94
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075427_10000265 3300006194 Bacteria 5641
2 SwRhRL2b_contig_1590914 2162886007 Bacteria 6064
3 JGI25151J46595_10001592 3300003187 Bacteria 15072
4 JGI25151J46595_10002393 3300003187 Bacteria 11356
5 JGI25151J46595_10013280 3300003187 Bacteria 3712
6 rootH1_10000848 3300003316 Bacteria 58943
7 rootL2_10052955 3300003322 Bacteria 32035
8 rootH1_10060533 3300003323 Bacteria 3704
9 Ga0006562J51391_1000046 3300003578 Bacteria 48312
10 Ga0055532_1000461 3300003758 Bacteria 18688
11 Ga0055532_1004206 3300003758 Bacteria 2229
12 Ga0055528_1002713 3300003790 Bacteria 9309
13 Ga0065704_10071051 3300005289 Bacteria 13492
14 Ga0065707_10002281 3300005295 Bacteria 5286
15 Ga0065707_10008929 3300005295 Bacteria 3769
16 Ga0065707_10081753 3300005295 Bacteria 50128
17 Ga0070676_10012740 3300005328 Bacteria 4599
18 Ga0070675_100029478 3300005354 Bacteria 4427
19 Ga0070671_100041405 3300005355 Bacteria 3828
20 Ga0070711_100081936 3300005439 Bacteria 2301
21 Ga0070698_100066617 3300005471 Bacteria 3624
22 Ga0070699_100069423 3300005518 Bacteria 3062
23 Ga0070699_100239924 3300005518 Bacteria 1618
24 Ga0070665_100174393 3300005548 Bacteria 2151
25 Ga0068859_100045737 3300005617 Bacteria 4397
26 Ga0081539_10021286 3300005985 Bacteria 4339
27 Ga0075428_100045447 3300006844 Bacteria 4825
28 Ga0075431_100042053 3300006847 Bacteria 4713
29 Ga0075431_100150274 3300006847 Bacteria 2399
30 Ga0075433_10197985 3300006852 Bacteria 1787
31 Ga0075429_100017611 3300006880 Bacteria 6177
32 Ga0075429_100038482 3300006880 Bacteria 4163
33 Ga0097620_100045737 3300006931 Bacteria 4397
34 Ga0105244_10021721 3300009036 Bacteria 3544
35 Ga0105244_10025478 3300009036 Bacteria 3215
36 Ga0105245_10008274 3300009098 Bacteria 9090
37 Ga0105247_10003810 3300009101 Bacteria 9763
38 Ga0114129_10017084 3300009147 Bacteria 10332
39 Ga0114129_10048346 3300009147 Bacteria 5977
40 Ga0114129_10163477 3300009147 Bacteria 3039
41 Ga0114129_10236824 3300009147 Bacteria 2455
42 Ga0105243_10000301 3300009148 Bacteria 54622
43 Ga0105242_10003077 3300009176 Bacteria 13015
44 Ga0105239_10274608 3300010375 Bacteria 1896
45 Ga0105246_10003834 3300011119 Bacteria 9117
46 Ga0157371_10003365 3300013102 Bacteria 14546
47 Ga0157374_10023001 3300013296 Bacteria 5566
48 Ga0157378_10000237 3300013297 Bacteria 53846
49 Ga0157377_10002645 3300014745 Bacteria 7950
50 Ga0157376_10010301 3300014969 Bacteria 6828
51 Ga0209147_100198 3300025229 Bacteria 67714
52 Ga0209147_102599 3300025229 Bacteria 4279
53 Ga0209673_1002278 3300025273 Bacteria 13748
54 Ga0209676_1004720 3300025292 Bacteria 7462
55 Ga0209025_1001468 3300025294 Bacteria 30750
56 Ga0209025_1003436 3300025294 Bacteria 15004
57 Ga0209025_1003442 3300025294 Bacteria 14984
58 Ga0209025_1013286 3300025294 Bacteria 5190
59 Ga0207426_1010953 3300025302 Bacteria 3486
60 Ga0207696_1002129 3300025711 Bacteria 9942
61 Ga0207655_1004964 3300025728 Bacteria 9222
62 Ga0207713_1002717 3300025735 Bacteria 12617
63 Ga0207646_10114766 3300025922 Unclassified 2419
64 Ga0207709_10002077 3300025935 Bacteria 12914
65 Ga0207674_10207907 3300026116 Bacteria 1906
66 Ga0207675_100079270 3300026118 Bacteria 3077
67 Ga0209371_1004537 3300027312 Bacteria 5964
68 Ga0268266_10102655 3300028379 Bacteria 2523
69 Ga0265323_10009852 3300028653 Bacteria 3887
70 Ga0265322_10005393 3300028654 Bacteria 3786
71 Ga0265338_10032599 3300028800 Bacteria 5075
72 Ga0265324_10000017 3300029957 Bacteria 186448
73 Ga0237817_10220 3300030083 Bacteria 14618
74 Ga0268256_1003827 3300030500 Bacteria 6565
75 Ga0265340_10005035 3300031247 Bacteria 7349
76 Ga0265331_10002140 3300031250 Bacteria 13583
77 Ga0265327_10013537 3300031251 Bacteria 5412
78 Ga0307408_100042069 3300031548 Bacteria 3242
79 Ga0307408_100072217 3300031548 Bacteria 2554
80 Ga0316579_10011119 3300031691 Bacteria 3820
81 Ga0307405_10021891 3300031731 Bacteria 3603
82 Ga0316577_10015287 3300031733 Bacteria 4221
83 Ga0316577_10084059 3300031733 Bacteria 1780
84 Ga0307407_10013336 3300031903 Bacteria 3986
85 Ga0307409_100097222 3300031995 Bacteria 2431
86 Ga0307416_100020974 3300032002 Bacteria 4678
87 Ga0307416_100121851 3300032002 Bacteria 2326
88 Ga0316582_0001392 3300036647 Bacteria 10544
89 Ga0316582_0085137 3300036647 Bacteria 2071
90 Ga0316582_0112631 3300036647 Bacteria 1813
91 Ga0316584_0001181 3300036712 Bacteria 15427
92 Ga0316584_0158194 3300036712 Bacteria 1684
93 Ga0316584_0160416 3300036712 Unclassified 1671
94 Ga0316584_0163598 3300036712 Bacteria 1652
95 Ga0316584_0215545 3300036712 Bacteria 1412
96 Ga0316581_0018334 3300037588 Bacteria 2032
97 Ga0451577_0001318 3300042876 Bacteria 33871
98 Ga0451577_0003664 3300042876 Bacteria 16833
99 Ga0451577_0012125 3300042876 Bacteria 8108
100 Ga0451577_0027759 3300042876 Bacteria 5123
101 Ga0451577_0102665 3300042876 Bacteria 2555
102 Ga0451577_0111559 3300042876 Bacteria 2447
103 Ga0451577_0214455 3300042876 Bacteria 1739
104 Ga0466972_0032210 3300044658 Bacteria 2575
105 Ga0453683_0000596 3300044673 Bacteria 39938
106 Ga0453683_0003633 3300044673 Bacteria 11306
107 Ga0453683_0033864 3300044673 Bacteria 3221
108 Ga0453683_0033961 3300044673 Bacteria 3216
109 Ga0453684_0000012 3300044712 Bacteria 1062512
110 Ga0453684_0000074 3300044712 Bacteria 438364
111 Ga0453684_0000232 3300044712 Bacteria 240951
112 Ga0453684_0000520 3300044712 Bacteria 147265
113 Ga0453684_0001538 3300044712 Bacteria 64426
114 Ga0453684_0004019 3300044712 Bacteria 32024
115 Ga0453684_0005815 3300044712 Bacteria 24027
116 Ga0453684_0008147 3300044712 Bacteria 18913
117 Ga0453684_0012477 3300044712 Bacteria 14000
118 Ga0453684_0012883 3300044712 Bacteria 13700
119 Ga0453684_0014000 3300044712 Bacteria 12917
120 Ga0453684_0026930 3300044712 Bacteria 8280
121 Ga0453684_0044209 3300044712 Bacteria 5967
122 Ga0453684_0045864 3300044712 Bacteria 5824
123 Ga0453684_0064459 3300044712 Bacteria 4680
124 Ga0453684_0105977 3300044712 Bacteria 3427
125 Ga0453684_0145604 3300044712 Bacteria 2823
126 Ga0453684_0146751 3300044712 Bacteria 2809
127 Ga0453684_0164914 3300044712 Bacteria 2616
128 Ga0453684_0204081 3300044712 Bacteria 2302
129 Ga0453684_0250459 3300044712 Bacteria 2034
130 Ga0453684_0292804 3300044712 Bacteria 1853
131 Ga0451576_0000152 3300045051 Bacteria 176305
132 Ga0451576_0006535 3300045051 Bacteria 14268
133 Ga0451576_0016191 3300045051 Bacteria 8238
134 Ga0451576_0039606 3300045051 Bacteria 4988
135 Ga0451576_0047417 3300045051 Bacteria 4517
136 Ga0451576_0069283 3300045051 Bacteria 3670
137 Ga0451576_0111497 3300045051 Bacteria 2847
138 Ga0451576_0123612 3300045051 Bacteria 2695
139 Ga0451576_0139775 3300045051 Bacteria 2526
140 Ga0451576_0196830 3300045051 Bacteria 2105
141 Ga0451576_0252785 3300045051 Bacteria 1842
142 Ga0451576_0337802 3300045051 Bacteria 1577
143 Ga0495660_0038072 3300046810 Bacteria 2675
144 Ga0496100_0002768 3300048903 Bacteria 8964
145 Ga0496100_0041201 3300048903 Bacteria 2943
146 Ga0496101_0001878 3300048904 Bacteria 12687
147 Ga0496102_0006685 3300048905 Bacteria 9849
148 Ga0496102_0007824 3300048905 Bacteria 9137
149 Ga0496104_0001186 3300048907 Bacteria 22389
150 Ga0496104_0115385 3300048907 Bacteria 2577
151 Ga0496105_0000964 3300048908 Bacteria 19760
152 Ga0496106_0000361 3300048909 Bacteria 32313
153 Ga0496106_0033317 3300048909 Bacteria 3844
154 Ga0496107_0000282 3300048910 Bacteria 26883
155 Ga0496108_0002791 3300048911 Bacteria 13997
156 Ga0496110_0010351 3300048913 Bacteria 7580
157 Ga0496111_0025878 3300048914 Bacteria 4140
158 Ga0496112_0008872 3300048915 Bacteria 9022
159 Ga0496112_0017123 3300048915 Bacteria 6804
160 Ga0496113_0053023 3300048916 Bacteria 3031
161 Ga0496113_0059598 3300048916 Bacteria 2876
162 Ga0496116_0001671 3300048919 Bacteria 24360
163 Ga0496117_0051364 3300048920 Bacteria 2915
164 Ga0496119_0005344 3300048922 Bacteria 12354
165 Ga0496120_0023631 3300048923 Bacteria 3845
166 Ga0496122_0007350 3300048925 Bacteria 12285
167 Ga0496123_0026529 3300048926 Bacteria 4336
168 Ga0496124_0064814 3300048927 Bacteria 3049
169 Ga0496125_0008450 3300048928 Bacteria 10775
170 Ga0496126_0023501 3300048929 Bacteria 5973
171 Ga0501312_000015 3300049528 Bacteria 9271
172 Ga0501315_000246 3300049531 Bacteria 3394
173 Ga0501034_0068684 3300049571 Bacteria 3554
174 Ga0501046_0000006 3300049580 Bacteria 368565
175 Ga0501071_0086632 3300049587 Bacteria 2298
176 Ga0501073_0046776 3300049589 Bacteria 3042
177 Ga0501075_0072564 3300049591 Bacteria 2602
178 Ga0501076_0067728 3300049592 Bacteria 2851
179 Ga0501217_008311 3300049661 Bacteria 2239
180 Ga0501080_0000862 3300049742 Bacteria 24859
181 nmdc:mga05p37_37854_c1 3300050507 Bacteria 5916
182 nmdc:mga05p37_44641_c1 3300050507 Bacteria 5453
183 nmdc:mga05p37_6350_c1 3300050507 Bacteria 13926
184 nmdc:mga09592_25051_c1 3300050508 Bacteria 4936
185 nmdc:mga09592_8637_c1 3300050508 Bacteria 8287
186 nmdc:mga06r32_105296_c1 3300050510 Bacteria 2771
187 nmdc:mga06r32_71833_c1 3300050510 Bacteria 3349
188 Ga0501084_0007058 3300054114 Bacteria 9258
189 Ga0501082_0103387 3300060353 Bacteria 2464
190 2556065824 2554235469 Bacteria 3590176
191 2595092240 2593339131 Bacteria 5116855
192 2600199845 2599185353 Bacteria 2219443
193 2600402901 2600254943 Bacteria 2613887
194 2644721373 2643221731 Bacteria 5623886
195 2644723358 2643221732 Bacteria 5756404
196 2672333556 2671180330 Bacteria 5521719
197 2712198838 2711768088 Bacteria 3195027
198 2738817071 2738541295 Bacteria 5730091
199 2738838964 2738541299 Bacteria 4020721
200 2739271661 2738543017 Bacteria 4271950
201 2745170139 2744054657 Bacteria 5016802
202 2757568875 2757320391 Bacteria 4746095
203 2777764240 2775507177 Bacteria 4384303
204 2777837315 2775507192 Bacteria 4622234
205 2805348299 2802429420 Bacteria 845479
206 2808871146 2808606364 Bacteria 4465927
207 2816866413 2816332186 Bacteria 5331395
208 2817616421 2816332336 Bacteria 5207640
209 2819570999 2818991441 Bacteria 5062707
210 2819711966 2818991465 Bacteria 5388835
211 2842688241 2842682962 Bacteria 5589973
212 2842887757 2842882022 Bacteria 6158489
213 2849144935 2849139964 Bacteria 5613304
214 2857586516 2857581216 Bacteria 5522813
215 2857590988 2857586860 Bacteria 4354574
216 2857608901 2857604169 Bacteria 5111450
217 2857613386 2857609550 Bacteria 3753890
218 2881646603 2881644220 Bacteria 5302661
219 2904530133 2904524088 Bacteria 5887454
220 2916972046 2916971899 Bacteria 4250608
221 2919149602 2919143609 Bacteria 6219228
222 2919419321 2919414237 Bacteria 5429133
223 2919523225 2919517244 Bacteria 5858162
224 2919726446 2919720352 Bacteria 5986006
225 2928099881 2928093941 Bacteria 5965005
226 2929009936 2929004312 Bacteria 5678476
227 2929298408 2929297113 Bacteria 3141306
228 2936343027 2936340661 Bacteria 5139038
229 2936363660 2936361878 Bacteria 5632809
230 2956900766 2956897341 Bacteria 5447711
231 2960324317 2960319331 Bacteria 5502575
232 2960378860 2960375949 Bacteria 5361395
233 2964375253 2964375228 Bacteria 4909004
234 2977254727 2977254563 Bacteria 4828420
235 2990275729 2990275345 Bacteria 4887158
236 3001271837 3001267043 Bacteria 4823521
237 3001275924 3001272096 Bacteria 4729684
238 3001898828 3001892409 Bacteria 6328293
239 3006831023 3006826541 Bacteria 4678913
240 3006973782 3006969106 Bacteria 4739423
241 3006978388 3006973921 Bacteria 4423788
242 3006980061 3006978542 Bacteria 5328100
243 3006988383 3006984091 Bacteria 4207523
244 3006993245 3006988479 Bacteria 4767936
245 8022893401 8022893055 Bacteria 5300455
246 8022917949 8022914991 Bacteria 5584517
247 8022950803 8022948649 Bacteria 5366783
248 8057632250 8057632132 Bacteria 4726859
249 Ga0075427_10000265
250 SwRhRL2b_contig_1590914
251 JGI25151J46595_10001592
252 JGI25151J46595_10002393
253 JGI25151J46595_10013280
254 rootH1_10000848
255 rootL2_10052955
256 rootH1_10060533
257 Ga0006562J51391_1000046
258 Ga0055532_1000461
259 Ga0055532_1004206
260 Ga0055528_1002713
261 Ga0065704_10071051
262 Ga0065707_10002281
263 Ga0065707_10008929
264 Ga0065707_10081753
265 Ga0070676_10012740
266 Ga0070675_100029478
267 Ga0070671_100041405
268 Ga0070711_100081936
269 Ga0070698_100066617
270 Ga0070699_100069423
271 Ga0070699_100239924
272 Ga0070665_100174393
273 Ga0068859_100045737
274 Ga0081539_10021286
275 Ga0075428_100045447
276 Ga0075431_100042053
277 Ga0075431_100150274
278 Ga0075433_10197985
279 Ga0075429_100017611
280 Ga0075429_100038482
281 Ga0097620_100045737
282 Ga0105244_10021721
283 Ga0105244_10025478
284 Ga0105245_10008274
285 Ga0105247_10003810
286 Ga0114129_10017084
287 Ga0114129_10048346
288 Ga0114129_10163477
289 Ga0114129_10236824
290 Ga0105243_10000301
291 Ga0105242_10003077
292 Ga0105239_10274608
293 Ga0105246_10003834
294 Ga0157371_10003365
295 Ga0157374_10023001
296 Ga0157378_10000237
297 Ga0157377_10002645
298 Ga0157376_10010301
299 Ga0209147_100198
300 Ga0209147_102599
301 Ga0209673_1002278
302 Ga0209676_1004720
303 Ga0209025_1001468
304 Ga0209025_1003436
305 Ga0209025_1003442
306 Ga0209025_1013286
307 Ga0207426_1010953
308 Ga0207696_1002129
309 Ga0207655_1004964
310 Ga0207713_1002717
311 Ga0207646_10114766
312 Ga0207709_10002077
313 Ga0207674_10207907
314 Ga0207675_100079270
315 Ga0209371_1004537
316 Ga0268266_10102655
317 Ga0265323_10009852
318 Ga0265322_10005393
319 Ga0265338_10032599
320 Ga0265324_10000017
321 Ga0237817_10220
322 Ga0268256_1003827
323 Ga0265340_10005035
324 Ga0265331_10002140
325 Ga0265327_10013537
326 Ga0307408_100042069
327 Ga0307408_100072217
328 Ga0316579_10011119
329 Ga0307405_10021891
330 Ga0316577_10015287
331 Ga0316577_10084059
332 Ga0307407_10013336
333 Ga0307409_100097222
334 Ga0307416_100020974
335 Ga0307416_100121851
336 Ga0316582_0001392
337 Ga0316582_0085137
338 Ga0316582_0112631
339 Ga0316584_0001181
340 Ga0316584_0158194
341 Ga0316584_0160416
342 Ga0316584_0163598
343 Ga0316584_0215545
344 Ga0316581_0018334
345 Ga0451577_0001318
346 Ga0451577_0003664
347 Ga0451577_0012125
348 Ga0451577_0027759
349 Ga0451577_0102665
350 Ga0451577_0111559
351 Ga0451577_0214455
352 Ga0466972_0032210
353 Ga0453683_0000596
354 Ga0453683_0003633
355 Ga0453683_0033864
356 Ga0453683_0033961
357 Ga0453684_0000012
358 Ga0453684_0000074
359 Ga0453684_0000232
360 Ga0453684_0000520
361 Ga0453684_0001538
362 Ga0453684_0004019
363 Ga0453684_0005815
364 Ga0453684_0008147
365 Ga0453684_0012477
366 Ga0453684_0012883
367 Ga0453684_0014000
368 Ga0453684_0026930
369 Ga0453684_0044209
370 Ga0453684_0045864
371 Ga0453684_0064459
372 Ga0453684_0105977
373 Ga0453684_0145604
374 Ga0453684_0146751
375 Ga0453684_0164914
376 Ga0453684_0204081
377 Ga0453684_0250459
378 Ga0453684_0292804
379 Ga0451576_0000152
380 Ga0451576_0006535
381 Ga0451576_0016191
382 Ga0451576_0039606
383 Ga0451576_0047417
384 Ga0451576_0069283
385 Ga0451576_0111497
386 Ga0451576_0123612
387 Ga0451576_0139775
388 Ga0451576_0196830
389 Ga0451576_0252785
390 Ga0451576_0337802
391 Ga0495660_0038072
392 Ga0496100_0002768
393 Ga0496100_0041201
394 Ga0496101_0001878
395 Ga0496102_0006685
396 Ga0496102_0007824
397 Ga0496104_0001186
398 Ga0496104_0115385
399 Ga0496105_0000964
400 Ga0496106_0000361
401 Ga0496106_0033317
402 Ga0496107_0000282
403 Ga0496108_0002791
404 Ga0496110_0010351
405 Ga0496111_0025878
406 Ga0496112_0008872
407 Ga0496112_0017123
408 Ga0496113_0053023
409 Ga0496113_0059598
410 Ga0496116_0001671
411 Ga0496117_0051364
412 Ga0496119_0005344
413 Ga0496120_0023631
414 Ga0496122_0007350
415 Ga0496123_0026529
416 Ga0496124_0064814
417 Ga0496125_0008450
418 Ga0496126_0023501
419 Ga0501312_000015
420 Ga0501315_000246
421 Ga0501034_0068684
422 Ga0501046_0000006
423 Ga0501071_0086632
424 Ga0501073_0046776
425 Ga0501075_0072564
426 Ga0501076_0067728
427 Ga0501217_008311
428 Ga0501080_0000862
429 nmdc:mga05p37_37854_c1
430 nmdc:mga05p37_44641_c1
431 nmdc:mga05p37_6350_c1
432 nmdc:mga09592_25051_c1
433 nmdc:mga09592_8637_c1
434 nmdc:mga06r32_105296_c1
435 nmdc:mga06r32_71833_c1
436 Ga0501084_0007058
437 Ga0501082_0103387
438 2556065824
439 2595092240
440 2600199845
441 2600402901
442 2644721373
443 2644723358
444 2672333556
445 2712198838
446 2738817071
447 2738838964
448 2739271661
449 2745170139
450 2757568875
451 2777764240
452 2777837315
453 2805348299
454 2808871146
455 2816866413
456 2817616421
457 2819570999
458 2819711966
459 2842688241
460 2842887757
461 2849144935
462 2857586516
463 2857590988
464 2857608901
465 2857613386
466 2881646603
467 2904530133
468 2916972046
469 2919149602
470 2919419321
471 2919523225
472 2919726446
473 2928099881
474 2929009936
475 2929298408
476 2936343027
477 2936363660
478 2956900766
479 2960324317
480 2960378860
481 2964375253
482 2977254727
483 2990275729
484 3001271837
485 3001275924
486 3001898828
487 3006831023
488 3006973782
489 3006978388
490 3006980061
491 3006988383
492 3006993245
493 8022893401
494 8022917949
495 8022950803
496 8057632250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18073

Rubredoxin_2

Rubredoxin metal binding domain

8

35

0.98

PF13541

ChlI

Subunit ChlI of Mg-chelatase

347

448

0.93

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

93

258

0.88

PF05362

Lon_C

Lon protease (S16) C-terminal proteolytic domain

361

476

0.83

PF06745

ATPase

KaiC

73

299

0.8

PF13481

AAA_25

AAA domain

61

241

0.79

PF03796

DnaB_C

DnaB-like helicase C terminal domain

78

241

0.76

PF07088

GvpD_P-loop

GvpD gas vesicle protein, P-loop domain

86

273

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lkq-assembly1.cif.gz_B protease domain of rada 0.9479 250 424
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.9435 256 426
5lkq-assembly1.cif.gz_B protease domain of rada 0.9324 250 424
5h45-assembly1.cif.gz_B crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms 0.9318 256 426
8dvh-assembly1.cif.gz_B crystal structure of atp-dependent lon protease from bacillus subtillis (bslonba) 0.9067 258 426
ID Description Score Start End Superfamily
af_Q2G243_272_444_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9801 256 425 3.30.230.10
af_P9WHJ9_288_461_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9682 258 423 3.30.230.10
af_Q2G243_272_444_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9579 256 425 3.30.230.10
af_F4K8X8_240_443_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9539 47 246 3.40.50.300
af_P24554_64_278_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 27 244 3.40.50.300
ID Description Score Start End GO Terms
AF-T1A795-F1-model_v4 DNA repair protein RadA 0.9918 276 367 GO:0000725
GO:0005829
AF-K1S9P6-F1-model_v4 DNA repair protein RadA 0.9897 290 397 GO:0000725
GO:0005829
AF-W1XIA3-F1-model_v4 DNA repair protein RadA 0.9892 265 373 GO:0000725
GO:0005829
AF-A0A3L7X5B4-F1-model_v4 DNA repair protein RadA 0.9767 199 426 GO:0000725
GO:0005829
AF-A0A433CRC7-F1-model_v4 deleted 0.9737 294 425

Map