F359778

General Info

Members Datasets Scaffolds Average Seq Length
248 165 496 297

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100035693|Ga0070716_1000356934
Length 327
Sequence MSAASLPGERRHGAPPEPPAGRLRLVLITGLSGSGKSVVAKCFEDLGYYTVDNLPLPLLREFLVRPGELVFGYERIAVVADVRAPGFAEEFPRLIAEIDRDCQGQPHRQAGPREEGQPGACGQPRPTLLFLEASDEVLMRRFSETRRPHPLAPDQPAIAGIRRERQLLAGLRPRADLVFDTSHWSIHETRAQVYRAFATAGEQPEMVVSLVSFGFKHGVPVGTDLLFDVRFLANPHFVPGLREQTGQDAEVLEYLEQQPDFEELIGRLADLLGFLLPRYRRENRSYLSVAVGCTGGRHRSVAICERLQKRLDAAGWPVRLVHRDIAR

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
95 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
114 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.42
Rhizosphere 97.58
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100035693 3300006173 Bacteria 2735
2 JGI25406J46586_10000183 3300003203 Bacteria 28210
3 JGI25406J46586_10003387 3300003203 Bacteria 7502
4 Ga0065704_10001321 3300005289 Bacteria 9766
5 Ga0065707_10082526 3300005295 Bacteria 14174
6 Ga0065707_10098708 3300005295 Bacteria 3064
7 Ga0070658_10044139 3300005327 Bacteria 3601
8 Ga0070666_10005526 3300005335 Bacteria 7754
9 Ga0070680_100014248 3300005336 Bacteria 6208
10 Ga0070689_100191332 3300005340 Bacteria 1666
11 Ga0070668_100151661 3300005347 Bacteria 1875
12 Ga0070669_100000003 3300005353 Bacteria 338807
13 Ga0070669_100222573 3300005353 Bacteria 1492
14 Ga0070675_100015281 3300005354 Bacteria 6065
15 Ga0070673_100134417 3300005364 Bacteria 2080
16 Ga0070688_100219309 3300005365 Bacteria 1340
17 Ga0070659_100161789 3300005366 Bacteria 1831
18 Ga0070709_10000059 3300005434 Bacteria 85054
19 Ga0070709_10262319 3300005434 Bacteria 1249
20 Ga0070713_100196752 3300005436 Bacteria 1818
21 Ga0070711_100000002 3300005439 Bacteria 263148
22 Ga0070694_100002002 3300005444 Bacteria 12109
23 Ga0070694_100152819 3300005444 Bacteria 1687
24 Ga0070708_100001820 3300005445 Bacteria 16372
25 Ga0070708_100005980 3300005445 Bacteria 9672
26 Ga0070708_100091973 3300005445 Bacteria 2763
27 Ga0070685_10066300 3300005466 Bacteria 2127
28 Ga0070706_100001632 3300005467 Bacteria 23391
29 Ga0070707_100220588 3300005468 Bacteria 1847
30 Ga0070698_100007934 3300005471 Bacteria 11488
31 Ga0070698_100186571 3300005471 Bacteria 2012
32 Ga0070699_100001626 3300005518 Bacteria 20492
33 Ga0070699_100004065 3300005518 Bacteria 12934
34 Ga0070699_100008397 3300005518 Bacteria 8944
35 Ga0070699_100331138 3300005518 Bacteria 1370
36 Ga0070697_100029207 3300005536 Bacteria 4419
37 Ga0070697_100090690 3300005536 Bacteria 2526
38 Ga0070697_100106465 3300005536 Bacteria 2333
39 Ga0070672_100135970 3300005543 Bacteria 2024
40 Ga0070686_100047051 3300005544 Bacteria 2726
41 Ga0070686_100278338 3300005544 Bacteria 1233
42 Ga0070696_100020949 3300005546 Bacteria 4431
43 Ga0070696_100038118 3300005546 Bacteria 3316
44 Ga0070665_100000426 3300005548 Bacteria 61588
45 Ga0070704_100000783 3300005549 Bacteria 15710
46 Ga0070704_100021263 3300005549 Bacteria 4204
47 Ga0070704_100069592 3300005549 Bacteria 2550
48 Ga0070664_100049682 3300005564 Bacteria 3547
49 Ga0068866_10203585 3300005718 Bacteria 1184
50 Ga0068860_100001299 3300005843 Bacteria 27137
51 Ga0068862_100009869 3300005844 Bacteria 7886
52 Ga0081539_10000056 3300005985 Bacteria 256522
53 Ga0081539_10000460 3300005985 Bacteria 86291
54 Ga0081539_10003695 3300005985 Bacteria 18270
55 Ga0081539_10011601 3300005985 Bacteria 6940
56 Ga0068871_100457090 3300006358 Bacteria 1145
57 Ga0075428_100008110 3300006844 Bacteria 11660
58 Ga0075428_100016267 3300006844 Bacteria 8223
59 Ga0075428_100043147 3300006844 Bacteria 4959
60 Ga0075430_100015026 3300006846 Bacteria 6591
61 Ga0075430_100025026 3300006846 Bacteria 5079
62 Ga0075430_100025122 3300006846 Bacteria 5067
63 Ga0075430_100187516 3300006846 Bacteria 1720
64 Ga0075430_100295065 3300006846 Bacteria 1341
65 Ga0075431_100033539 3300006847 Bacteria 5291
66 Ga0075431_100042856 3300006847 Bacteria 4669
67 Ga0075431_100143534 3300006847 Bacteria 2460
68 Ga0075433_10000667 3300006852 Bacteria 23236
69 Ga0075433_10012636 3300006852 Bacteria 6831
70 Ga0075434_100001720 3300006871 Bacteria 18764
71 Ga0075434_100003659 3300006871 Bacteria 13732
72 Ga0075434_100006043 3300006871 Bacteria 11073
73 Ga0075434_100152692 3300006871 Unclassified 2329
74 Ga0075436_100011138 3300006914 Bacteria 6167
75 Ga0075435_100136276 3300007076 Bacteria 2057
76 Ga0099794_10112600 3300007265 Bacteria 1364
77 Ga0099795_10033881 3300007788 Bacteria 1776
78 Ga0105240_10218803 3300009093 Bacteria 2220
79 Ga0111539_10040158 3300009094 Bacteria 5635
80 Ga0114129_10119201 3300009147 Bacteria 3635
81 Ga0114129_10286376 3300009147 Bacteria 2200
82 Ga0114129_10634640 3300009147 Bacteria 1380
83 Ga0114129_10793430 3300009147 Bacteria 1209
84 Ga0105242_10162734 3300009176 Bacteria 1955
85 Ga0105242_10406035 3300009176 Bacteria 1273
86 Ga0099796_10001900 3300010159 Bacteria 4416
87 Ga0157370_10327965 3300013104 Bacteria 1411
88 Ga0157374_10038700 3300013296 Bacteria 4385
89 Ga0157375_10261044 3300013308 Bacteria 1894
90 Ga0157377_10058898 3300014745 Bacteria 2187
91 Ga0157376_10130210 3300014969 Bacteria 2244
92 Ga0228598_1001556 3300024227 Bacteria 5029
93 Ga0207699_10000021 3300025906 Bacteria 178512
94 Ga0207699_10139330 3300025906 Unclassified 1593
95 Ga0207705_10263819 3300025909 Bacteria 1316
96 Ga0207684_10000137 3300025910 Bacteria 132561
97 Ga0207695_10051506 3300025913 Bacteria 4323
98 Ga0207663_10000003 3300025916 Bacteria 458807
99 Ga0207663_10137856 3300025916 Unclassified 1696
100 Ga0207646_10000054 3300025922 Bacteria 160414
101 Ga0207646_10187045 3300025922 Bacteria 1870
102 Ga0207681_10000155 3300025923 Bacteria 56754
103 Ga0207681_10170762 3300025923 Bacteria 1648
104 Ga0207670_10123819 3300025936 Bacteria 1884
105 Ga0207704_10469012 3300025938 Bacteria 1008
106 Ga0207665_10048459 3300025939 Bacteria 2852
107 Ga0207711_10307575 3300025941 Bacteria 1463
108 Ga0207679_10524657 3300025945 Bacteria 1060
109 Ga0207651_10108211 3300025960 Bacteria 2080
110 Ga0209179_1011465 3300027512 Bacteria 1571
111 Ga0207428_10039571 3300027907 Bacteria 3829
112 Ga0207428_10178686 3300027907 Bacteria 1604
113 Ga0268266_10000741 3300028379 Bacteria 43685
114 Ga0268265_10006211 3300028380 Bacteria 8096
115 Ga0268264_10034231 3300028381 Bacteria 4177
116 Ga0268264_10236758 3300028381 Bacteria 1689
117 Ga0265337_1006669 3300028556 Bacteria 4411
118 Ga0265323_10056049 3300028653 Bacteria 1383
119 Ga0265338_10015946 3300028800 Bacteria 8216
120 Ga0265762_1014947 3300030760 Bacteria 1404
121 Ga0265760_10009770 3300031090 Bacteria 2740
122 Ga0265332_10006473 3300031238 Bacteria 5312
123 Ga0265328_10050246 3300031239 Bacteria 1531
124 Ga0265320_10000418 3300031240 Bacteria 33718
125 Ga0265325_10002401 3300031241 Bacteria 12666
126 Ga0265329_10000270 3300031242 Bacteria 27402
127 Ga0265329_10025504 3300031242 Bacteria 1956
128 Ga0265340_10000405 3300031247 Bacteria 23104
129 Ga0265331_10000317 3300031250 Bacteria 52403
130 Ga0265316_10013099 3300031344 Bacteria 7393
131 Ga0265316_10085171 3300031344 Bacteria 2419
132 Ga0265316_10267075 3300031344 Bacteria 1253
133 Ga0307408_100261113 3300031548 Bacteria 1433
134 Ga0265313_10005917 3300031595 Bacteria 8851
135 Ga0265313_10006304 3300031595 Bacteria 8447
136 Ga0265314_10003056 3300031711 Bacteria 16494
137 Ga0265342_10001199 3300031712 Bacteria 24635
138 Ga0307413_10389546 3300031824 Bacteria 1088
139 Ga0307416_100049307 3300032002 Bacteria 3347
140 Ga0307416_100251354 3300032002 Bacteria 1721
141 Ga0307416_100571831 3300032002 Bacteria 1206
142 Ga0316583_10058292 3300032133 Bacteria 1355
143 Ga0373929_0000029 3300035085 Bacteria 50792
144 Ga0373956_0002710 3300035119 Bacteria 7169
145 Ga0373961_0000811 3300035241 Bacteria 10650
146 Ga0316574_0006809 3300035398 Bacteria 6210
147 Ga0373933_0000970 3300035724 Bacteria 17506
148 Ga0373937_0000134 3300036401 Bacteria 71481
149 Ga0373937_0026726 3300036401 Bacteria 5216
150 Ga0451795_1235511 3300041456 Unclassified 2312
151 Ga0451807_2583095 3300041486 Bacteria 1809
152 Ga0451577_0132836 3300042876 Unclassified 2234
153 Ga0451577_0151814 3300042876 Unclassified 2084
154 Ga0451577_0280965 3300042876 Bacteria 1508
155 Ga0466963_0097770 3300044694 Bacteria 2006
156 Ga0453684_0253007 3300044712 Bacteria 2022
157 Ga0495629_0004210 3300046459 Bacteria 10796
158 Ga0495651_0004201 3300046462 Bacteria 11033
159 Ga0495582_0060831 3300046473 Unclassified 2084
160 Ga0495594_0109184 3300046499 Bacteria 1559
161 Ga0495643_0005354 3300046522 Bacteria 8691
162 Ga0495652_0036370 3300046529 Bacteria 4283
163 Ga0495587_0000160 3300046536 Bacteria 49495
164 Ga0495598_0025210 3300046537 Bacteria 1620
165 Ga0495621_0020396 3300046539 Bacteria 2175
166 Ga0495656_0022159 3300046615 Bacteria 2484
167 Ga0495623_0020223 3300046679 Bacteria 4302
168 Ga0495658_0080465 3300046683 Bacteria 1911
169 Ga0495613_0245276 3300046689 Bacteria 1251
170 Ga0495581_0183949 3300047315 Bacteria 1222
171 Ga0495604_0139311 3300047317 Bacteria 1735
172 Ga0495676_0048978 3300047321 Bacteria 3402
173 Ga0495680_0331468 3300047322 Bacteria 1063
174 Ga0495675_0002007 3300047444 Bacteria 12159
175 Ga0495602_0000111 3300048088 Bacteria 78057
176 Ga0496104_0485577 3300048907 Bacteria 1147
177 Ga0496111_0173837 3300048914 Bacteria 1601
178 Ga0496112_0587569 3300048915 Bacteria 1046
179 Ga0496114_0146971 3300048917 Bacteria 2044
180 Ga0501031_0158958 3300049568 Bacteria 1477
181 Ga0501032_0143844 3300049569 Bacteria 1570
182 Ga0501033_0121739 3300049570 Bacteria 1893
183 Ga0501036_0085856 3300049572 Bacteria 2660
184 Ga0501040_0003976 3300049576 Bacteria 9606
185 Ga0501040_0005043 3300049576 Bacteria 8532
186 Ga0501041_0055345 3300049577 Bacteria 2421
187 Ga0501043_0147486 3300049579 Bacteria 1842
188 Ga0501046_0027085 3300049580 Bacteria 4680
189 Ga0501048_0055215 3300049582 Bacteria 2820
190 Ga0501067_0003235 3300049583 Bacteria 8968
191 Ga0501068_0013166 3300049584 Bacteria 4703
192 Ga0501071_0208513 3300049587 Bacteria 1469
193 Ga0501072_0009928 3300049588 Bacteria 7238
194 Ga0501074_0081666 3300049590 Bacteria 2318
195 Ga0501074_0227867 3300049590 Bacteria 1327
196 Ga0501075_0001709 3300049591 Bacteria 14423
197 Ga0501075_0007826 3300049591 Bacteria 7421
198 Ga0501076_0006776 3300049592 Bacteria 8313
199 Ga0501077_0000027 3300049593 Bacteria 75456
200 Ga0501077_0014980 3300049593 Bacteria 4875
201 Ga0501079_0004686 3300049741 Bacteria 10130
202 Ga0501080_0004080 3300049742 Bacteria 12938
203 Ga0501081_0002459 3300049743 Bacteria 11694
204 Ga0501081_0070877 3300049743 Bacteria 2429
205 Ga0501083_0000707 3300049744 Bacteria 21744
206 Ga0501045_0036612 3300049824 Bacteria 3564
207 Ga0501045_0143857 3300049824 Bacteria 1773
208 nmdc:mga05p37_208877_c1 3300050507 Bacteria 2361
209 nmdc:mga05p37_386899_c1 3300050507 Bacteria 1637
210 nmdc:mga05p37_531291_c1 3300050507 Bacteria 1343
211 nmdc:mga05p37_626954_c1 3300050507 Bacteria 1209
212 nmdc:mga05p37_82871_c1 3300050507 Bacteria 3952
213 nmdc:mga0qj67_134836_c1 3300050509 Bacteria 2000
214 nmdc:mga0qj67_18401_c1 3300050509 Bacteria 5324
215 nmdc:mga0qj67_265066_c1 3300050509 Bacteria 1393
216 nmdc:mga0qj67_46617_c1 3300050509 Bacteria 3422
217 nmdc:mga06r32_215261_c1 3300050510 Bacteria 1909
218 nmdc:mga06r32_9901_c1 3300050510 Bacteria 8602
219 nmdc:mga08y16_4800_c1 3300050511 Bacteria 14102
220 nmdc:mga08y16_554633_c1 3300050511 Bacteria 1162
221 nmdc:mga08y16_684981_c1 3300050511 Bacteria 1026
222 nmdc:mga0n895_1057_c1 3300050512 Bacteria 20048
223 nmdc:mga0n895_118398_c1 3300050512 Unclassified 2669
224 nmdc:mga0n895_1401_c1 3300050512 Bacteria 17974
225 nmdc:mga0n895_17590_c2 3300050512 Bacteria 5289
226 nmdc:mga0n895_212888_c1 3300050512 Bacteria 1963
227 nmdc:mga0rr50_119893_c1 3300050513 Bacteria 2092
228 nmdc:mga0rr50_53736_c1 3300050513 Bacteria 2997
229 nmdc:mga08x19_186_c1 3300050514 Bacteria 49520
230 nmdc:mga08x19_46_c1 3300050514 Bacteria 145818
231 nmdc:mga08x19_5414_c1 3300050514 Bacteria 7550
232 nmdc:mga0a205_310_c1 3300050515 Bacteria 36161
233 nmdc:mga0a205_5389_c1 3300050515 Bacteria 11539
234 Ga0501084_0016888 3300054114 Bacteria 6065
235 Ga0501084_0021588 3300054114 Bacteria 5368
236 Ga0501084_0083454 3300054114 Bacteria 2682
237 Ga0501084_0341082 3300054114 Bacteria 1266
238 Ga0590071_000812 3300059421 Bacteria 8714
239 Ga0590074_000904 3300059423 Bacteria 4630
240 Ga0590075_000662 3300059424 Bacteria 9161
241 Ga0590075_031286 3300059424 Bacteria 1349
242 Ga0590077_003618 3300059426 Bacteria 3192
243 Ga0590077_009477 3300059426 Bacteria 1997
244 Ga0590077_011269 3300059426 Bacteria 1845
245 Ga0501082_0001428 3300060353 Bacteria 20984
246 Ga0501082_0156271 3300060353 Bacteria 1981
247 Ga0530510_0014032 3300061734 Bacteria 5648
248 Ga0530510_0225268 3300061734 Bacteria 1394
249 Ga0070716_100035693
250 JGI25406J46586_10000183
251 JGI25406J46586_10003387
252 Ga0065704_10001321
253 Ga0065707_10082526
254 Ga0065707_10098708
255 Ga0070658_10044139
256 Ga0070666_10005526
257 Ga0070680_100014248
258 Ga0070689_100191332
259 Ga0070668_100151661
260 Ga0070669_100000003
261 Ga0070669_100222573
262 Ga0070675_100015281
263 Ga0070673_100134417
264 Ga0070688_100219309
265 Ga0070659_100161789
266 Ga0070709_10000059
267 Ga0070709_10262319
268 Ga0070713_100196752
269 Ga0070711_100000002
270 Ga0070694_100002002
271 Ga0070694_100152819
272 Ga0070708_100001820
273 Ga0070708_100005980
274 Ga0070708_100091973
275 Ga0070685_10066300
276 Ga0070706_100001632
277 Ga0070707_100220588
278 Ga0070698_100007934
279 Ga0070698_100186571
280 Ga0070699_100001626
281 Ga0070699_100004065
282 Ga0070699_100008397
283 Ga0070699_100331138
284 Ga0070697_100029207
285 Ga0070697_100090690
286 Ga0070697_100106465
287 Ga0070672_100135970
288 Ga0070686_100047051
289 Ga0070686_100278338
290 Ga0070696_100020949
291 Ga0070696_100038118
292 Ga0070665_100000426
293 Ga0070704_100000783
294 Ga0070704_100021263
295 Ga0070704_100069592
296 Ga0070664_100049682
297 Ga0068866_10203585
298 Ga0068860_100001299
299 Ga0068862_100009869
300 Ga0081539_10000056
301 Ga0081539_10000460
302 Ga0081539_10003695
303 Ga0081539_10011601
304 Ga0068871_100457090
305 Ga0075428_100008110
306 Ga0075428_100016267
307 Ga0075428_100043147
308 Ga0075430_100015026
309 Ga0075430_100025026
310 Ga0075430_100025122
311 Ga0075430_100187516
312 Ga0075430_100295065
313 Ga0075431_100033539
314 Ga0075431_100042856
315 Ga0075431_100143534
316 Ga0075433_10000667
317 Ga0075433_10012636
318 Ga0075434_100001720
319 Ga0075434_100003659
320 Ga0075434_100006043
321 Ga0075434_100152692
322 Ga0075436_100011138
323 Ga0075435_100136276
324 Ga0099794_10112600
325 Ga0099795_10033881
326 Ga0105240_10218803
327 Ga0111539_10040158
328 Ga0114129_10119201
329 Ga0114129_10286376
330 Ga0114129_10634640
331 Ga0114129_10793430
332 Ga0105242_10162734
333 Ga0105242_10406035
334 Ga0099796_10001900
335 Ga0157370_10327965
336 Ga0157374_10038700
337 Ga0157375_10261044
338 Ga0157377_10058898
339 Ga0157376_10130210
340 Ga0228598_1001556
341 Ga0207699_10000021
342 Ga0207699_10139330
343 Ga0207705_10263819
344 Ga0207684_10000137
345 Ga0207695_10051506
346 Ga0207663_10000003
347 Ga0207663_10137856
348 Ga0207646_10000054
349 Ga0207646_10187045
350 Ga0207681_10000155
351 Ga0207681_10170762
352 Ga0207670_10123819
353 Ga0207704_10469012
354 Ga0207665_10048459
355 Ga0207711_10307575
356 Ga0207679_10524657
357 Ga0207651_10108211
358 Ga0209179_1011465
359 Ga0207428_10039571
360 Ga0207428_10178686
361 Ga0268266_10000741
362 Ga0268265_10006211
363 Ga0268264_10034231
364 Ga0268264_10236758
365 Ga0265337_1006669
366 Ga0265323_10056049
367 Ga0265338_10015946
368 Ga0265762_1014947
369 Ga0265760_10009770
370 Ga0265332_10006473
371 Ga0265328_10050246
372 Ga0265320_10000418
373 Ga0265325_10002401
374 Ga0265329_10000270
375 Ga0265329_10025504
376 Ga0265340_10000405
377 Ga0265331_10000317
378 Ga0265316_10013099
379 Ga0265316_10085171
380 Ga0265316_10267075
381 Ga0307408_100261113
382 Ga0265313_10005917
383 Ga0265313_10006304
384 Ga0265314_10003056
385 Ga0265342_10001199
386 Ga0307413_10389546
387 Ga0307416_100049307
388 Ga0307416_100251354
389 Ga0307416_100571831
390 Ga0316583_10058292
391 Ga0373929_0000029
392 Ga0373956_0002710
393 Ga0373961_0000811
394 Ga0316574_0006809
395 Ga0373933_0000970
396 Ga0373937_0000134
397 Ga0373937_0026726
398 Ga0451795_1235511
399 Ga0451807_2583095
400 Ga0451577_0132836
401 Ga0451577_0151814
402 Ga0451577_0280965
403 Ga0466963_0097770
404 Ga0453684_0253007
405 Ga0495629_0004210
406 Ga0495651_0004201
407 Ga0495582_0060831
408 Ga0495594_0109184
409 Ga0495643_0005354
410 Ga0495652_0036370
411 Ga0495587_0000160
412 Ga0495598_0025210
413 Ga0495621_0020396
414 Ga0495656_0022159
415 Ga0495623_0020223
416 Ga0495658_0080465
417 Ga0495613_0245276
418 Ga0495581_0183949
419 Ga0495604_0139311
420 Ga0495676_0048978
421 Ga0495680_0331468
422 Ga0495675_0002007
423 Ga0495602_0000111
424 Ga0496104_0485577
425 Ga0496111_0173837
426 Ga0496112_0587569
427 Ga0496114_0146971
428 Ga0501031_0158958
429 Ga0501032_0143844
430 Ga0501033_0121739
431 Ga0501036_0085856
432 Ga0501040_0003976
433 Ga0501040_0005043
434 Ga0501041_0055345
435 Ga0501043_0147486
436 Ga0501046_0027085
437 Ga0501048_0055215
438 Ga0501067_0003235
439 Ga0501068_0013166
440 Ga0501071_0208513
441 Ga0501072_0009928
442 Ga0501074_0081666
443 Ga0501074_0227867
444 Ga0501075_0001709
445 Ga0501075_0007826
446 Ga0501076_0006776
447 Ga0501077_0000027
448 Ga0501077_0014980
449 Ga0501079_0004686
450 Ga0501080_0004080
451 Ga0501081_0002459
452 Ga0501081_0070877
453 Ga0501083_0000707
454 Ga0501045_0036612
455 Ga0501045_0143857
456 nmdc:mga05p37_208877_c1
457 nmdc:mga05p37_386899_c1
458 nmdc:mga05p37_531291_c1
459 nmdc:mga05p37_626954_c1
460 nmdc:mga05p37_82871_c1
461 nmdc:mga0qj67_134836_c1
462 nmdc:mga0qj67_18401_c1
463 nmdc:mga0qj67_265066_c1
464 nmdc:mga0qj67_46617_c1
465 nmdc:mga06r32_215261_c1
466 nmdc:mga06r32_9901_c1
467 nmdc:mga08y16_4800_c1
468 nmdc:mga08y16_554633_c1
469 nmdc:mga08y16_684981_c1
470 nmdc:mga0n895_1057_c1
471 nmdc:mga0n895_118398_c1
472 nmdc:mga0n895_1401_c1
473 nmdc:mga0n895_17590_c2
474 nmdc:mga0n895_212888_c1
475 nmdc:mga0rr50_119893_c1
476 nmdc:mga0rr50_53736_c1
477 nmdc:mga08x19_186_c1
478 nmdc:mga08x19_46_c1
479 nmdc:mga08x19_5414_c1
480 nmdc:mga0a205_310_c1
481 nmdc:mga0a205_5389_c1
482 Ga0501084_0016888
483 Ga0501084_0021588
484 Ga0501084_0083454
485 Ga0501084_0341082
486 Ga0590071_000812
487 Ga0590074_000904
488 Ga0590075_000662
489 Ga0590075_031286
490 Ga0590077_003618
491 Ga0590077_009477
492 Ga0590077_011269
493 Ga0501082_0001428
494 Ga0501082_0156271
495 Ga0530510_0014032
496 Ga0530510_0225268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22740

PapZ_C

RapZ C-terminal domain

206

326

0.98

PF03668

RapZ-like_N

RapZ-like N-terminal domain

117

201

0.96

PF03668

RapZ-like_N

RapZ-like N-terminal domain

23

106

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9538 189 309
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.924 189 309
2vli-assembly2.cif.gz_B-2 structure of deinococcus radiodurans tunicamycin resistance protein 0.6824 27 182
3kb2-assembly2.cif.gz_A crystal structure of yorr protein in complex with phosphorylated gdp from bacillus subtilis, northeast structural genomics consortium target sr256 0.6681 29 180
3lw7-assembly1.cif.gz_A the crystal structure of an adenylate kinase-related protein bound to amp from sulfolobus solfataricus to 2.3a 0.6629 29 180
ID Description Score Start End Superfamily
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9666 197 309 3.40.50.720
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8898 197 309 3.40.50.720
af_P9WFQ3_17_301_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6977 28 309 3.40.50.300
af_P9WFQ3_17_301_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6862 28 309 3.40.50.300
af_O43012_3_162_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.681 30 179 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A350J5F3-F1-model_v4 RNase adaptor protein RapZ 0.9806 211 309 GO:0005524
AF-A0A6A7RP68-F1-model_v4 RNase adaptor protein RapZ 0.9786 203 310 GO:0005524
AF-A0A2V8RJM9-F1-model_v4 RapZ C-terminal domain-containing protein 0.9779 196 309 GO:0005524
AF-A0A3B0VBF3-F1-model_v4 RNase adapter protein RapZ 0.9773 190 309 GO:0005524
AF-A0A496P952-F1-model_v4 RNase adapter RapZ 0.9757 189 309 GO:0005524

Map