F359575

General Info

Members Datasets Scaffolds Average Seq Length
248 115 496 142

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10009164|Ga0070658_100091648
Length 162
Sequence LQALFVWVELGVAAVVEAQTMLNQSTHNIQVRAPKPGLHEITSEVSRWLDSQRIGTGLLTIFCAHTSASLVIQENAARAARHDLEAFFGRIAPEEPALYTHNDEGPDDMPAHIRSALTQTQLSIPVEDGEMVLGRWQGIFLFEHRRDTPARRIALHLIGEAS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
96 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
97 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 1.61
Rhizosphere 97.58
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10009164 3300005327 Bacteria 7956
2 JGI24737J22298_10077420 3300001990 Bacteria 991
3 rootH1_10271051 3300003323 Bacteria 1109
4 Ga0065715_10134891 3300005293 Bacteria 1942
5 Ga0070658_11019261 3300005327 Bacteria 720
6 Ga0070683_100150143 3300005329 Bacteria 2209
7 Ga0070670_100046327 3300005331 Bacteria 3739
8 Ga0070670_100241461 3300005331 Bacteria 1573
9 Ga0070670_100572278 3300005331 Bacteria 1009
10 Ga0070677_10079973 3300005333 Bacteria 1396
11 Ga0070680_100083113 3300005336 Bacteria 2644
12 Ga0070680_101209581 3300005336 Bacteria 654
13 Ga0070660_100004387 3300005339 Bacteria 9746
14 Ga0070660_100045712 3300005339 Bacteria 3353
15 Ga0070660_100064043 3300005339 Bacteria 2859
16 Ga0070660_100434956 3300005339 Bacteria 1087
17 Ga0070660_100599073 3300005339 Bacteria 921
18 Ga0070661_100066866 3300005344 Bacteria 2641
19 Ga0070692_10372341 3300005345 Bacteria 894
20 Ga0070675_100033863 3300005354 Bacteria 4143
21 Ga0070675_100620560 3300005354 Bacteria 981
22 Ga0070671_100023701 3300005355 Bacteria 5024
23 Ga0070671_100048268 3300005355 Bacteria 3540
24 Ga0070673_100205581 3300005364 Unclassified 1698
25 Ga0070659_100010033 3300005366 Bacteria 6971
26 Ga0070659_100020958 3300005366 Bacteria 4971
27 Ga0070659_100281742 3300005366 Bacteria 1383
28 Ga0070659_100484899 3300005366 Bacteria 1052
29 Ga0070659_100710324 3300005366 Bacteria 870
30 Ga0070663_100001855 3300005455 Bacteria 11781
31 Ga0070663_100003756 3300005455 Bacteria 8815
32 Ga0070662_100003067 3300005457 Bacteria 10373
33 Ga0070662_100070085 3300005457 Bacteria 2582
34 Ga0070662_101300882 3300005457 Unclassified 626
35 Ga0070681_10811957 3300005458 Bacteria 853
36 Ga0070681_11427324 3300005458 Bacteria 616
37 Ga0070679_100044335 3300005530 Bacteria 4431
38 Ga0070679_101134905 3300005530 Bacteria 726
39 Ga0070672_101677501 3300005543 Bacteria 571
40 Ga0070665_100043258 3300005548 Bacteria 4527
41 Ga0070664_100642945 3300005564 Bacteria 985
42 Ga0070664_100667745 3300005564 Bacteria 966
43 Ga0070664_100953363 3300005564 Bacteria 805
44 Ga0068854_100000126 3300005578 Bacteria 52604
45 Ga0068852_100016832 3300005616 Bacteria 5716
46 Ga0068852_101055474 3300005616 Bacteria 832
47 Ga0068859_102162693 3300005617 Bacteria 614
48 Ga0068864_100801895 3300005618 Bacteria 925
49 Ga0097620_102162088 3300006931 Bacteria 614
50 Ga0105240_10031543 3300009093 Bacteria 6872
51 Ga0105242_11003592 3300009176 Bacteria 842
52 Ga0105030_115021 3300009987 Bacteria 684
53 Ga0157373_10002471 3300013100 Bacteria 14078
54 Ga0157373_10028565 3300013100 Bacteria 4023
55 Ga0157373_10164574 3300013100 Bacteria 1561
56 Ga0157373_10273293 3300013100 Bacteria 1196
57 Ga0157373_10551749 3300013100 Bacteria 836
58 Ga0157371_10007335 3300013102 Bacteria 8941
59 Ga0157371_10343114 3300013102 Bacteria 1086
60 Ga0157371_11030449 3300013102 Bacteria 629
61 Ga0157370_10107820 3300013104 Bacteria 2605
62 Ga0157370_10285060 3300013104 Bacteria 1526
63 Ga0157370_10856479 3300013104 Bacteria 826
64 Ga0157370_11809967 3300013104 Bacteria 548
65 Ga0157369_10042337 3300013105 Bacteria 4968
66 Ga0157369_10098693 3300013105 Bacteria 3114
67 Ga0157369_10580687 3300013105 Bacteria 1157
68 Ga0157374_10046259 3300013296 Bacteria 4029
69 Ga0157372_10554861 3300013307 Bacteria 1339
70 Ga0207697_10018782 3300025315 Bacteria 2833
71 Ga0207682_10086646 3300025893 Bacteria 1351
72 Ga0207682_10160268 3300025893 Bacteria 1019
73 Ga0207647_10057962 3300025904 Bacteria 2373
74 Ga0207645_10114590 3300025907 Bacteria 1747
75 Ga0207705_10022296 3300025909 Bacteria 4516
76 Ga0207705_10036173 3300025909 Bacteria 3533
77 Ga0207705_10242683 3300025909 Bacteria 1373
78 Ga0207705_10558486 3300025909 Bacteria 890
79 Ga0207707_10811010 3300025912 Bacteria 779
80 Ga0207695_10013053 3300025913 Bacteria 9920
81 Ga0207657_10000020 3300025919 Bacteria 157826
82 Ga0207657_10004414 3300025919 Bacteria 14882
83 Ga0207657_10034734 3300025919 Bacteria 4530
84 Ga0207657_10805240 3300025919 Bacteria 726
85 Ga0207649_10235018 3300025920 Bacteria 1313
86 Ga0207652_10028437 3300025921 Bacteria 4664
87 Ga0207652_10040625 3300025921 Bacteria 3950
88 Ga0207652_10683858 3300025921 Bacteria 916
89 Ga0207681_10491389 3300025923 Bacteria 1004
90 Ga0207650_10285819 3300025925 Bacteria 1344
91 Ga0207650_10968498 3300025925 Bacteria 723
92 Ga0207659_10012743 3300025926 Bacteria 5366
93 Ga0207659_10192544 3300025926 Bacteria 1624
94 Ga0207659_10357147 3300025926 Bacteria 1213
95 Ga0207659_10480121 3300025926 Bacteria 1050
96 Ga0207644_10348290 3300025931 Bacteria 1202
97 Ga0207690_10005100 3300025932 Bacteria 7755
98 Ga0207690_10024334 3300025932 Bacteria 3793
99 Ga0207690_10233742 3300025932 Bacteria 1413
100 Ga0207690_10965338 3300025932 Bacteria 708
101 Ga0207690_10986399 3300025932 Bacteria 700
102 Ga0207690_11417484 3300025932 Bacteria 581
103 Ga0207706_10000227 3300025933 Bacteria 61528
104 Ga0207706_10045827 3300025933 Bacteria 3873
105 Ga0207706_10098553 3300025933 Bacteria 2571
106 Ga0207691_10031388 3300025940 Bacteria 4959
107 Ga0207691_10321332 3300025940 Bacteria 1327
108 Ga0207691_10447472 3300025940 Bacteria 1099
109 Ga0207661_10115590 3300025944 Bacteria 2276
110 Ga0207679_10114215 3300025945 Bacteria 2138
111 Ga0207679_10174308 3300025945 Bacteria 1774
112 Ga0207679_11333299 3300025945 Bacteria 658
113 Ga0207667_10019610 3300025949 Bacteria 7543
114 Ga0207651_10495882 3300025960 Bacteria 1055
115 Ga0207668_10265155 3300025972 Bacteria 1402
116 Ga0207640_10000150 3300025981 Bacteria 50663
117 Ga0207658_11394891 3300025986 Bacteria 641
118 Ga0207678_10000908 3300026067 Bacteria 27102
119 Ga0207678_10017256 3300026067 Bacteria 6337
120 Ga0207678_10092410 3300026067 Bacteria 2586
121 Ga0207702_11416510 3300026078 Bacteria 689
122 Ga0207676_10487366 3300026095 Bacteria 1169
123 Ga0207676_11014502 3300026095 Bacteria 818
124 Ga0207676_11264436 3300026095 Unclassified 732
125 Ga0207675_100908773 3300026118 Bacteria 897
126 Ga0207698_10127114 3300026142 Bacteria 2170
127 Ga0210002_1085428 3300027617 Bacteria 564
128 Ga0209998_10098539 3300027717 Bacteria 722
129 Ga0209974_10170495 3300027876 Bacteria 793
130 Ga0268266_10038245 3300028379 Bacteria 4086
131 Ga0268265_10339856 3300028380 Bacteria 1367
132 Ga0265338_10009118 3300028800 Bacteria 11920
133 Ga0265327_10001225 3300031251 Bacteria 34433
134 Ga0307408_100029165 3300031548 Bacteria 3819
135 Ga0307408_100080804 3300031548 Bacteria 2429
136 Ga0307408_100130939 3300031548 Bacteria 1957
137 Ga0307405_10006160 3300031731 Bacteria 5876
138 Ga0307405_10650129 3300031731 Bacteria 867
139 Ga0307405_11143159 3300031731 Bacteria 671
140 Ga0307413_10158566 3300031824 Bacteria 1587
141 Ga0307413_10279789 3300031824 Bacteria 1254
142 Ga0307413_10310130 3300031824 Bacteria 1201
143 Ga0307413_11206138 3300031824 Bacteria 658
144 Ga0307410_10048689 3300031852 Bacteria 2840
145 Ga0307410_10709617 3300031852 Bacteria 848
146 Ga0307410_10775904 3300031852 Bacteria 813
147 Ga0307410_11081611 3300031852 Bacteria 694
148 Ga0307406_10099659 3300031901 Bacteria 1976
149 Ga0307406_10125117 3300031901 Bacteria 1795
150 Ga0307406_10246135 3300031901 Bacteria 1344
151 Ga0307407_10034982 3300031903 Bacteria 2755
152 Ga0307407_10488585 3300031903 Bacteria 900
153 Ga0307412_10046781 3300031911 Bacteria 2837
154 Ga0307412_10220901 3300031911 Bacteria 1452
155 Ga0307412_10406398 3300031911 Bacteria 1110
156 Ga0307412_10645773 3300031911 Bacteria 902
157 Ga0307409_100008316 3300031995 Bacteria 6290
158 Ga0307409_100050792 3300031995 Bacteria 3169
159 Ga0307409_100910552 3300031995 Bacteria 893
160 Ga0307409_101723769 3300031995 Bacteria 655
161 Ga0307416_100103173 3300032002 Bacteria 2489
162 Ga0307416_100107635 3300032002 Bacteria 2447
163 Ga0307416_100136276 3300032002 Bacteria 2221
164 Ga0307416_100194706 3300032002 Bacteria 1916
165 Ga0307416_102247514 3300032002 Bacteria 646
166 Ga0307416_102737418 3300032002 Bacteria 589
167 Ga0307414_10050117 3300032004 Bacteria 2891
168 Ga0307414_10097629 3300032004 Bacteria 2201
169 Ga0307414_10265560 3300032004 Bacteria 1434
170 Ga0307414_10328799 3300032004 Bacteria 1304
171 Ga0307414_10543520 3300032004 Bacteria 1034
172 Ga0307414_11599417 3300032004 Bacteria 607
173 Ga0307411_10053391 3300032005 Bacteria 2647
174 Ga0307411_10539249 3300032005 Bacteria 993
175 Ga0307411_10944052 3300032005 Bacteria 769
176 Ga0307411_11003965 3300032005 Bacteria 747
177 Ga0307411_11142412 3300032005 Bacteria 704
178 Ga0307411_11703710 3300032005 Bacteria 583
179 Ga0307415_100010125 3300032126 Bacteria 5324
180 Ga0307415_100029361 3300032126 Bacteria 3513
181 Ga0307415_100116949 3300032126 Bacteria 1990
182 Ga0307415_100236918 3300032126 Bacteria 1473
183 Ga0307415_100288065 3300032126 Bacteria 1354
184 Ga0307415_100448175 3300032126 Bacteria 1115
185 Ga0307415_101190276 3300032126 Bacteria 717
186 Ga0373955_0884790 3300035172 Bacteria 549
187 Ga0316582_0766370 3300036647 Bacteria 662
188 Ga0395899_0000781 3300037312 Bacteria 31286
189 Ga0395899_0014537 3300037312 Bacteria 6010
190 Ga0395899_0016669 3300037312 Bacteria 5602
191 Ga0395899_0030711 3300037312 Bacteria 4040
192 Ga0395899_0030761 3300037312 Bacteria 4036
193 Ga0395899_0234788 3300037312 Bacteria 1265
194 Ga0395899_0365609 3300037312 Bacteria 962
195 Ga0395900_0000136 3300037418 Bacteria 123664
196 Ga0395900_0008670 3300037418 Bacteria 10445
197 Ga0395900_0015166 3300037418 Bacteria 7858
198 Ga0395900_0062671 3300037418 Bacteria 3822
199 Ga0395900_0066087 3300037418 Bacteria 3716
200 Ga0395900_0195750 3300037418 Bacteria 2048
201 Ga0395900_0210086 3300037418 Bacteria 1965
202 Ga0395900_0294909 3300037418 Bacteria 1609
203 Ga0395900_0416388 3300037418 Bacteria 1305
204 Ga0395900_1635719 3300037418 Bacteria 555
205 Ga0395898_0003226 3300037466 Bacteria 18333
206 Ga0395898_0013729 3300037466 Bacteria 8330
207 Ga0395898_0058682 3300037466 Bacteria 3745
208 Ga0395898_0066086 3300037466 Bacteria 3505
209 Ga0395898_0316018 3300037466 Bacteria 1490
210 Ga0395905_0008403 3300037471 Bacteria 10179
211 Ga0395905_0052978 3300037471 Bacteria 3798
212 Ga0395905_0315236 3300037471 Bacteria 1453
213 Ga0395905_0640805 3300037471 Bacteria 964
214 Ga0395901_0000030 3300038443 Bacteria 241916
215 Ga0395901_0067092 3300038443 Bacteria 3736
216 Ga0395901_0093698 3300038443 Bacteria 3145
217 Ga0395901_0251863 3300038443 Bacteria 1839
218 Ga0395901_0401399 3300038443 Bacteria 1408
219 Ga0395901_0808969 3300038443 Unclassified 925
220 Ga0395901_0925707 3300038443 Bacteria 852
221 Ga0439461_0150814 3300041410 Bacteria 600
222 Ga0439445_0147551 3300042004 Bacteria 684
223 Ga0439449_0048516 3300042007 Bacteria 1572
224 Ga0439452_091610 3300042010 Bacteria 657
225 Ga0450914_051283 3300042118 Bacteria 544
226 Ga0450889_021536 3300042144 Bacteria 719
227 Ga0466972_0011177 3300044658 Bacteria 4505
228 Ga0466966_0017810 3300044684 Bacteria 4690
229 Ga0466966_0331504 3300044684 Bacteria 914
230 Ga0466966_0492873 3300044684 Unclassified 737
231 Ga0466961_0023749 3300044693 Bacteria 3945
232 Ga0466964_0009194 3300044706 Bacteria 3717
233 Ga0466964_0123337 3300044706 Bacteria 1171
234 Ga0466971_0002319 3300044719 Bacteria 8056
235 Ga0466968_0451755 3300044735 Bacteria 635
236 Ga0466970_0079070 3300044765 Bacteria 1775
237 Ga0466957_0010227 3300044842 Bacteria 5374
238 Ga0466960_0018300 3300044901 Bacteria 3067
239 Ga0466959_0089261 3300045049 Bacteria 2214
240 Ga0466958_0004546 3300045836 Bacteria 7334
241 Ga0495613_0000954 3300046689 Bacteria 22106
242 Ga0496103_0177660 3300048906 Bacteria 1368
243 Ga0496107_0144761 3300048910 Bacteria 1757
244 Ga0496110_1082560 3300048913 Bacteria 710
245 Ga0496110_1571275 3300048913 Bacteria 568
246 nmdc:mga0qj67_498249_c1 3300050509 Bacteria 979
247 Ga0500572_313196 3300053111 Bacteria 503
248 Ga0466962_0004355 3300061719 Bacteria 6791
249 Ga0070658_10009164
250 JGI24737J22298_10077420
251 rootH1_10271051
252 Ga0065715_10134891
253 Ga0070658_11019261
254 Ga0070683_100150143
255 Ga0070670_100046327
256 Ga0070670_100241461
257 Ga0070670_100572278
258 Ga0070677_10079973
259 Ga0070680_100083113
260 Ga0070680_101209581
261 Ga0070660_100004387
262 Ga0070660_100045712
263 Ga0070660_100064043
264 Ga0070660_100434956
265 Ga0070660_100599073
266 Ga0070661_100066866
267 Ga0070692_10372341
268 Ga0070675_100033863
269 Ga0070675_100620560
270 Ga0070671_100023701
271 Ga0070671_100048268
272 Ga0070673_100205581
273 Ga0070659_100010033
274 Ga0070659_100020958
275 Ga0070659_100281742
276 Ga0070659_100484899
277 Ga0070659_100710324
278 Ga0070663_100001855
279 Ga0070663_100003756
280 Ga0070662_100003067
281 Ga0070662_100070085
282 Ga0070662_101300882
283 Ga0070681_10811957
284 Ga0070681_11427324
285 Ga0070679_100044335
286 Ga0070679_101134905
287 Ga0070672_101677501
288 Ga0070665_100043258
289 Ga0070664_100642945
290 Ga0070664_100667745
291 Ga0070664_100953363
292 Ga0068854_100000126
293 Ga0068852_100016832
294 Ga0068852_101055474
295 Ga0068859_102162693
296 Ga0068864_100801895
297 Ga0097620_102162088
298 Ga0105240_10031543
299 Ga0105242_11003592
300 Ga0105030_115021
301 Ga0157373_10002471
302 Ga0157373_10028565
303 Ga0157373_10164574
304 Ga0157373_10273293
305 Ga0157373_10551749
306 Ga0157371_10007335
307 Ga0157371_10343114
308 Ga0157371_11030449
309 Ga0157370_10107820
310 Ga0157370_10285060
311 Ga0157370_10856479
312 Ga0157370_11809967
313 Ga0157369_10042337
314 Ga0157369_10098693
315 Ga0157369_10580687
316 Ga0157374_10046259
317 Ga0157372_10554861
318 Ga0207697_10018782
319 Ga0207682_10086646
320 Ga0207682_10160268
321 Ga0207647_10057962
322 Ga0207645_10114590
323 Ga0207705_10022296
324 Ga0207705_10036173
325 Ga0207705_10242683
326 Ga0207705_10558486
327 Ga0207707_10811010
328 Ga0207695_10013053
329 Ga0207657_10000020
330 Ga0207657_10004414
331 Ga0207657_10034734
332 Ga0207657_10805240
333 Ga0207649_10235018
334 Ga0207652_10028437
335 Ga0207652_10040625
336 Ga0207652_10683858
337 Ga0207681_10491389
338 Ga0207650_10285819
339 Ga0207650_10968498
340 Ga0207659_10012743
341 Ga0207659_10192544
342 Ga0207659_10357147
343 Ga0207659_10480121
344 Ga0207644_10348290
345 Ga0207690_10005100
346 Ga0207690_10024334
347 Ga0207690_10233742
348 Ga0207690_10965338
349 Ga0207690_10986399
350 Ga0207690_11417484
351 Ga0207706_10000227
352 Ga0207706_10045827
353 Ga0207706_10098553
354 Ga0207691_10031388
355 Ga0207691_10321332
356 Ga0207691_10447472
357 Ga0207661_10115590
358 Ga0207679_10114215
359 Ga0207679_10174308
360 Ga0207679_11333299
361 Ga0207667_10019610
362 Ga0207651_10495882
363 Ga0207668_10265155
364 Ga0207640_10000150
365 Ga0207658_11394891
366 Ga0207678_10000908
367 Ga0207678_10017256
368 Ga0207678_10092410
369 Ga0207702_11416510
370 Ga0207676_10487366
371 Ga0207676_11014502
372 Ga0207676_11264436
373 Ga0207675_100908773
374 Ga0207698_10127114
375 Ga0210002_1085428
376 Ga0209998_10098539
377 Ga0209974_10170495
378 Ga0268266_10038245
379 Ga0268265_10339856
380 Ga0265338_10009118
381 Ga0265327_10001225
382 Ga0307408_100029165
383 Ga0307408_100080804
384 Ga0307408_100130939
385 Ga0307405_10006160
386 Ga0307405_10650129
387 Ga0307405_11143159
388 Ga0307413_10158566
389 Ga0307413_10279789
390 Ga0307413_10310130
391 Ga0307413_11206138
392 Ga0307410_10048689
393 Ga0307410_10709617
394 Ga0307410_10775904
395 Ga0307410_11081611
396 Ga0307406_10099659
397 Ga0307406_10125117
398 Ga0307406_10246135
399 Ga0307407_10034982
400 Ga0307407_10488585
401 Ga0307412_10046781
402 Ga0307412_10220901
403 Ga0307412_10406398
404 Ga0307412_10645773
405 Ga0307409_100008316
406 Ga0307409_100050792
407 Ga0307409_100910552
408 Ga0307409_101723769
409 Ga0307416_100103173
410 Ga0307416_100107635
411 Ga0307416_100136276
412 Ga0307416_100194706
413 Ga0307416_102247514
414 Ga0307416_102737418
415 Ga0307414_10050117
416 Ga0307414_10097629
417 Ga0307414_10265560
418 Ga0307414_10328799
419 Ga0307414_10543520
420 Ga0307414_11599417
421 Ga0307411_10053391
422 Ga0307411_10539249
423 Ga0307411_10944052
424 Ga0307411_11003965
425 Ga0307411_11142412
426 Ga0307411_11703710
427 Ga0307415_100010125
428 Ga0307415_100029361
429 Ga0307415_100116949
430 Ga0307415_100236918
431 Ga0307415_100288065
432 Ga0307415_100448175
433 Ga0307415_101190276
434 Ga0373955_0884790
435 Ga0316582_0766370
436 Ga0395899_0000781
437 Ga0395899_0014537
438 Ga0395899_0016669
439 Ga0395899_0030711
440 Ga0395899_0030761
441 Ga0395899_0234788
442 Ga0395899_0365609
443 Ga0395900_0000136
444 Ga0395900_0008670
445 Ga0395900_0015166
446 Ga0395900_0062671
447 Ga0395900_0066087
448 Ga0395900_0195750
449 Ga0395900_0210086
450 Ga0395900_0294909
451 Ga0395900_0416388
452 Ga0395900_1635719
453 Ga0395898_0003226
454 Ga0395898_0013729
455 Ga0395898_0058682
456 Ga0395898_0066086
457 Ga0395898_0316018
458 Ga0395905_0008403
459 Ga0395905_0052978
460 Ga0395905_0315236
461 Ga0395905_0640805
462 Ga0395901_0000030
463 Ga0395901_0067092
464 Ga0395901_0093698
465 Ga0395901_0251863
466 Ga0395901_0401399
467 Ga0395901_0808969
468 Ga0395901_0925707
469 Ga0439461_0150814
470 Ga0439445_0147551
471 Ga0439449_0048516
472 Ga0439452_091610
473 Ga0450914_051283
474 Ga0450889_021536
475 Ga0466972_0011177
476 Ga0466966_0017810
477 Ga0466966_0331504
478 Ga0466966_0492873
479 Ga0466961_0023749
480 Ga0466964_0009194
481 Ga0466964_0123337
482 Ga0466971_0002319
483 Ga0466968_0451755
484 Ga0466970_0079070
485 Ga0466957_0010227
486 Ga0466960_0018300
487 Ga0466959_0089261
488 Ga0466958_0004546
489 Ga0495613_0000954
490 Ga0496103_0177660
491 Ga0496107_0144761
492 Ga0496110_1082560
493 Ga0496110_1571275
494 nmdc:mga0qj67_498249_c1
495 Ga0500572_313196
496 Ga0466962_0004355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

40

157

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.9253 5 140
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9234 3 140
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9227 1 140
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9163 1 140
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9124 3 140
ID Description Score Start End Superfamily
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9344 3 139 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9331 3 140 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9266 3 140 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.925 5 140 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9237 3 140 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A558RAN1-F1-model_v4 YjbQ family protein 0.9922 19 140
AF-A0A2E1VLH1-F1-model_v4 YjbQ family protein 0.9916 19 139
AF-A0A097EE18-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9892 3 139
AF-A0A2M9G5L7-F1-model_v4 Secondary thiamine-phosphate synthase 0.9891 2 140
AF-A0A147I223-F1-model_v4 Secondary thiamine-phosphate synthase 0.9888 3 140

Map