F359557

General Info

Members Datasets Scaffolds Average Seq Length
248 182 496 129

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1001361|Ga0055536_100136118
Length 129
Sequence MHIAKDAVDVKMEIPGALIRQRLNFGDATGYSKISGEYFTLSAGVDTTPLFQGLNNHNSCQCPHWGFVLKGQITTTDDAGEQETVKTNDLFYWPPGHNVKVDADAEIVMFSPQHEHTHVIDHMIEKVKS

Samples

Sample ID Description Type Environment
1 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
100 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
107 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
108 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
150 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
151 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
166 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
167 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
168 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
169 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
170 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
175 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
176 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
177 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
178 2643221683 Variovorax sp. Root473 Isolate Unclassified
179 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
180 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
181 2928070936 Variovorax gossypii 1167 Isolate Unclassified
182 3004167301 Mesorhizobium loti 582 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 2.82
Isolates 3.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.1
Nodule 0
Rhizoplane 1.21
Rhizosphere 84.68
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1001361 3300003781 Bacteria 14867
2 Ga0055540_1000393 3300003792 Bacteria 35911
3 Ga0070690_100194509 3300005330 Bacteria 1408
4 Ga0070670_100060441 3300005331 Bacteria 3253
5 Ga0070670_100618102 3300005331 Bacteria 970
6 Ga0070677_10002698 3300005333 Bacteria 5674
7 Ga0070666_10344340 3300005335 Bacteria 1066
8 Ga0070680_100426565 3300005336 Bacteria 1131
9 Ga0070689_100357990 3300005340 Bacteria 1225
10 Ga0070675_100511774 3300005354 Bacteria 1082
11 Ga0070674_100257357 3300005356 Bacteria 1374
12 Ga0070688_100536315 3300005365 Bacteria 888
13 Ga0070688_101599749 3300005365 Bacteria 532
14 Ga0070700_100966583 3300005441 Bacteria 698
15 Ga0070663_100284327 3300005455 Bacteria 1319
16 Ga0070678_100181459 3300005456 Bacteria 1723
17 Ga0070681_11073429 3300005458 Bacteria 726
18 Ga0068867_100306708 3300005459 Bacteria 1311
19 Ga0070685_10111190 3300005466 Bacteria 1688
20 Ga0070672_100171192 3300005543 Bacteria 1806
21 Ga0070686_100256150 3300005544 Bacteria 1280
22 Ga0070686_100777845 3300005544 Bacteria 770
23 Ga0070665_100016572 3300005548 Bacteria 7387
24 Ga0070664_100804460 3300005564 Bacteria 879
25 Ga0068859_100105497 3300005617 Bacteria 2877
26 Ga0068864_100119318 3300005618 Bacteria 2356
27 Ga0068864_100898373 3300005618 Bacteria 875
28 Ga0068861_101770882 3300005719 Bacteria 612
29 Ga0068870_10363302 3300005840 Bacteria 932
30 Ga0068870_10824415 3300005840 Bacteria 650
31 Ga0075363_100017480 3300006048 Bacteria 3558
32 Ga0075364_10089556 3300006051 Bacteria 2040
33 Ga0075364_10244843 3300006051 Unclassified 1218
34 Ga0075362_10070813 3300006177 Bacteria 1592
35 Ga0075369_10225515 3300006186 Bacteria 868
36 Ga0075366_10048387 3300006195 Bacteria 2521
37 Ga0075366_10476342 3300006195 Bacteria 771
38 Ga0097621_100773825 3300006237 Bacteria 888
39 Ga0075370_10179455 3300006353 Bacteria 1246
40 Ga0075428_101752058 3300006844 Unclassified 647
41 Ga0075431_100226246 3300006847 Bacteria 1907
42 Ga0068865_100518886 3300006881 Bacteria 996
43 Ga0097620_100105498 3300006931 Bacteria 2877
44 Ga0097620_101433958 3300006931 Bacteria 762
45 Ga0099794_10079425 3300007265 Bacteria 1616
46 Ga0099794_10676729 3300007265 Bacteria 549
47 Ga0099795_10364631 3300007788 Unclassified 649
48 Ga0111539_10006919 3300009094 Bacteria 14564
49 Ga0105245_10231122 3300009098 Bacteria 1789
50 Ga0105247_10217832 3300009101 Bacteria 1291
51 Ga0105247_10265547 3300009101 Bacteria 1178
52 Ga0114129_10174680 3300009147 Bacteria 2926
53 Ga0105243_10001150 3300009148 Bacteria 23986
54 Ga0105243_10411387 3300009148 Bacteria 1259
55 Ga0105243_10748882 3300009148 Bacteria 957
56 Ga0105241_10068205 3300009174 Bacteria 2755
57 Ga0105237_10795885 3300009545 Bacteria 952
58 Ga0105238_10605788 3300009551 Bacteria 1103
59 Ga0105249_10905585 3300009553 Bacteria 949
60 Ga0105246_10070996 3300011119 Bacteria 2451
61 Ga0105246_12203500 3300011119 Bacteria 536
62 Ga0157378_10070060 3300013297 Bacteria 3147
63 Ga0163162_10952272 3300013306 Bacteria 970
64 Ga0157375_10037236 3300013308 Bacteria 4659
65 Ga0157380_10017779 3300014326 Bacteria 5267
66 Ga0157380_10174254 3300014326 Bacteria 1883
67 Ga0182008_10335026 3300014497 Bacteria 799
68 Ga0163161_10055960 3300017792 Bacteria 2864
69 Ga0209676_1000780 3300025292 Bacteria 42574
70 Ga0209051_1000531 3300025303 Bacteria 47271
71 Ga0209257_1021347 3300025304 Bacteria 2355
72 Ga0207697_10027353 3300025315 Bacteria 2332
73 Ga0207682_10002486 3300025893 Bacteria 8246
74 Ga0207710_10016842 3300025900 Bacteria 3095
75 Ga0207680_10022523 3300025903 Bacteria 3428
76 Ga0207645_10062254 3300025907 Bacteria 2384
77 Ga0207643_10430173 3300025908 Bacteria 837
78 Ga0207643_10613986 3300025908 Bacteria 700
79 Ga0207654_10027128 3300025911 Bacteria 3110
80 Ga0207660_11144930 3300025917 Bacteria 634
81 Ga0207662_10014638 3300025918 Bacteria 4404
82 Ga0207694_11004270 3300025924 Bacteria 706
83 Ga0207650_10178654 3300025925 Bacteria 1690
84 Ga0207650_10207268 3300025925 Bacteria 1573
85 Ga0207659_10545368 3300025926 Bacteria 985
86 Ga0207709_10000211 3300025935 Bacteria 75562
87 Ga0207709_10180299 3300025935 Bacteria 1491
88 Ga0207709_10343514 3300025935 Bacteria 1124
89 Ga0207670_10217234 3300025936 Bacteria 1461
90 Ga0207669_10168897 3300025937 Bacteria 1554
91 Ga0207704_10351765 3300025938 Bacteria 1147
92 Ga0207691_10257215 3300025940 Bacteria 1506
93 Ga0207679_10152394 3300025945 Bacteria 1883
94 Ga0207651_10298595 3300025960 Bacteria 1338
95 Ga0207668_10206906 3300025972 Bacteria 1567
96 Ga0207668_11983742 3300025972 Bacteria 524
97 Ga0207708_10265831 3300026075 Bacteria 1385
98 Ga0207641_11192979 3300026088 Bacteria 761
99 Ga0207641_12260246 3300026088 Bacteria 544
100 Ga0207676_10022795 3300026095 Bacteria 4609
101 Ga0207674_10041386 3300026116 Bacteria 4766
102 Ga0207675_101729745 3300026118 Bacteria 645
103 Ga0207683_10013364 3300026121 Bacteria 7001
104 Ga0209967_1073862 3300027364 Archaea 533
105 Ga0207428_10096101 3300027907 Bacteria 2294
106 Ga0268266_10030307 3300028379 Bacteria 4597
107 Ga0268266_10784751 3300028379 Bacteria 920
108 Ga0268265_10298312 3300028380 Bacteria 1450
109 Ga0307515_10547310 3300028794 Bacteria 767
110 Ga0307512_10156125 3300030522 Bacteria 1350
111 Ga0307408_100348032 3300031548 Bacteria 1257
112 Ga0316576_10142735 3300031727 Bacteria 1803
113 Ga0316576_10173622 3300031727 Unclassified 1627
114 Ga0316576_10219380 3300031727 Bacteria 1431
115 Ga0316576_11287074 3300031727 Bacteria 515
116 Ga0316578_10190914 3300031728 Bacteria 1234
117 Ga0307405_10005375 3300031731 Bacteria 6173
118 Ga0307405_11954386 3300031731 Unclassified 524
119 Ga0316577_10061902 3300031733 Bacteria 2089
120 Ga0307412_11453025 3300031911 Bacteria 622
121 Ga0307412_11503659 3300031911 Bacteria 612
122 Ga0307412_11661421 3300031911 Bacteria 585
123 Ga0307409_100117559 3300031995 Bacteria 2244
124 Ga0307409_101319044 3300031995 Unclassified 747
125 Ga0307416_100680445 3300032002 Bacteria 1116
126 Ga0307416_101642407 3300032002 Bacteria 748
127 Ga0307411_10270896 3300032005 Bacteria 1346
128 Ga0307411_12020035 3300032005 Unclassified 538
129 Ga0316585_10131712 3300032137 Bacteria 824
130 Ga0316593_10018273 3300032168 Bacteria 2153
131 Ga0316593_10056696 3300032168 Unclassified 1333
132 Ga0316593_10120462 3300032168 Unclassified 942
133 Ga0316593_10259748 3300032168 Bacteria 651
134 Ga0316588_1202497 3300033528 Bacteria 519
135 Ga0316596_1194937 3300033541 Unclassified 563
136 Ga0316596_1245314 3300033541 Unclassified 504
137 Ga0316574_0978884 3300035398 Bacteria 510
138 Ga0316582_0227064 3300036647 Unclassified 1278
139 Ga0316582_0778036 3300036647 Bacteria 656
140 Ga0316582_0982823 3300036647 Bacteria 576
141 Ga0316584_0103411 3300036712 Bacteria 2132
142 Ga0316584_0556929 3300036712 Bacteria 800
143 Ga0316584_0599857 3300036712 Bacteria 764
144 Ga0316584_0672614 3300036712 Unclassified 712
145 Ga0316584_1141522 3300036712 Unclassified 516
146 Ga0439447_145307 3300041407 Unclassified 545
147 Ga0439443_079157 3300042003 Bacteria 609
148 Ga0450893_0066868 3300042532 Bacteria 693
149 Ga0451577_0333670 3300042876 Bacteria 1375
150 Ga0451577_0955732 3300042876 Bacteria 770
151 Ga0451577_1033703 3300042876 Bacteria 737
152 Ga0466969_0001123 3300044656 Bacteria 14433
153 Ga0453683_0065431 3300044673 Bacteria 2272
154 Ga0453683_0074703 3300044673 Bacteria 2122
155 Ga0466965_0013582 3300044683 Bacteria 3845
156 Ga0466966_0002092 3300044684 Bacteria 12957
157 Ga0466966_0059897 3300044684 Unclassified 2404
158 Ga0466961_0002461 3300044693 Bacteria 11488
159 Ga0466961_0397528 3300044693 Bacteria 836
160 Ga0466963_0001428 3300044694 Bacteria 12874
161 Ga0466963_0049950 3300044694 Bacteria 2768
162 Ga0466964_0008481 3300044706 Bacteria 3863
163 Ga0453684_0065796 3300044712 Bacteria 4620
164 Ga0453684_0181016 3300044712 Bacteria 2474
165 Ga0453684_0226549 3300044712 Bacteria 2161
166 Ga0453684_0326995 3300044712 Bacteria 1735
167 Ga0453684_1320990 3300044712 Bacteria 751
168 Ga0453684_1356352 3300044712 Bacteria 739
169 Ga0466971_0540450 3300044719 Bacteria 578
170 Ga0466968_0002195 3300044735 Bacteria 7128
171 Ga0466968_0089171 3300044735 Bacteria 1364
172 Ga0466970_0118105 3300044765 Bacteria 1451
173 Ga0466957_0333309 3300044842 Unclassified 1026
174 Ga0466959_0000361 3300045049 Bacteria 26898
175 Ga0466959_0016070 3300045049 Bacteria 5464
176 Ga0466959_0024849 3300045049 Bacteria 4437
177 Ga0451576_0112820 3300045051 Bacteria 2829
178 Ga0451576_0185976 3300045051 Bacteria 2169
179 Ga0451576_0261336 3300045051 Bacteria 1809
180 Ga0451576_0968740 3300045051 Bacteria 892
181 Ga0451576_1274776 3300045051 Bacteria 766
182 Ga0466958_0071554 3300045836 Unclassified 2123
183 Ga0466958_0189418 3300045836 Bacteria 1307
184 Ga0466958_0272347 3300045836 Bacteria 1084
185 Ga0466967_0101945 3300045976 Bacteria 2624
186 Ga0466967_1459668 3300045976 Bacteria 681
187 Ga0495627_004129 3300046453 Bacteria 6163
188 Ga0495610_0075483 3300046512 Bacteria 1561
189 Ga0495620_0122585 3300046515 Bacteria 1023
190 Ga0495637_0014047 3300046520 Bacteria 3786
191 Ga0495598_0230709 3300046537 Bacteria 679
192 Ga0495668_0017471 3300046616 Bacteria 4159
193 Ga0495625_0054021 3300046660 Bacteria 2870
194 Ga0495625_0125163 3300046660 Bacteria 1746
195 Ga0495661_0057543 3300046665 Bacteria 2321
196 Ga0495670_0173057 3300046691 Bacteria 1137
197 Ga0495671_0042813 3300046692 Bacteria 2274
198 Ga0495681_0084993 3300047470 Bacteria 1406
199 Ga0495615_0056576 3300048090 Bacteria 1024
200 Ga0501039_0489998 3300049575 Bacteria 965
201 Ga0501040_0206310 3300049576 Bacteria 1396
202 Ga0501041_0383768 3300049577 Bacteria 889
203 Ga0501042_0641498 3300049578 Bacteria 772
204 Ga0501043_0887662 3300049579 Bacteria 640
205 Ga0501075_0226798 3300049591 Bacteria 1425
206 Ga0501075_0584447 3300049591 Bacteria 852
207 Ga0501217_069173 3300049661 Bacteria 958
208 Ga0501249_002792 3300049679 Bacteria 3517
209 Ga0501259_092394 3300049688 Bacteria 682
210 Ga0501225_0263980 3300049705 Bacteria 571
211 Ga0501081_0474439 3300049743 Bacteria 931
212 Ga0501267_036336 3300049764 Bacteria 599
213 Ga0501268_013441 3300049765 Bacteria 1322
214 Ga0501269_065269 3300049766 Bacteria 521
215 Ga0501035_0116752 3300049822 Bacteria 2335
216 Ga0501035_0932986 3300049822 Bacteria 686
217 Ga0501044_0121921 3300049823 Bacteria 2607
218 Ga0501045_0114663 3300049824 Bacteria 1999
219 nmdc:mga03683_18879_c1 3300050489 Bacteria 2627
220 nmdc:mga03n38_99757_c1 3300050490 Bacteria 1399
221 nmdc:mga00v17_358324_c1 3300050491 Unclassified 948
222 nmdc:mga00v17_63476_c1 3300050491 Bacteria 2275
223 nmdc:mga0k408_40084_c1 3300050493 Bacteria 2694
224 nmdc:mga07m45_175795_c1 3300050496 Bacteria 1245
225 nmdc:mga05p37_576982_c1 3300050507 Bacteria 1274
226 nmdc:mga06r32_173619_c1 3300050510 Bacteria 2139
227 nmdc:mga08y16_54773_c1 3300050511 Bacteria 4168
228 Ga0500610_0002147 3300053079 Bacteria 7117
229 Ga0500610_0016726 3300053079 Bacteria 3505
230 Ga0500644_0021623 3300053088 Bacteria 1930
231 Ga0500569_003638 3300053109 Bacteria 3174
232 Ga0500593_000312 3300053117 Bacteria 19544
233 Ga0500607_007969 3300053121 Bacteria 6480
234 Ga0500627_0001691 3300053158 Bacteria 6246
235 Ga0500633_0224697 3300053160 Bacteria 700
236 Ga0500634_0033396 3300053161 Bacteria 2805
237 Ga0500645_038182 3300053730 Bacteria 1426
238 Ga0501082_1285626 3300060353 Bacteria 639
239 Ga0466962_0148232 3300061719 Unclassified 1138
240 2599626473 2599185214 Bacteria 8209958
241 2599677074 2599185226 Bacteria 8233575
242 2599682174 2599185227 Bacteria 8246414
243 2599695825 2599185229 Bacteria 8216126
244 2644464899 2643221683 Bacteria 5749203
245 2881101351 2881101125 Bacteria 4590519
246 2883296223 2883291878 Bacteria 5894118
247 2928075444 2928070936 Bacteria 8062541
248 3004169873 3004167301 Bacteria 8330599
249 Ga0055536_1001361
250 Ga0055540_1000393
251 Ga0070690_100194509
252 Ga0070670_100060441
253 Ga0070670_100618102
254 Ga0070677_10002698
255 Ga0070666_10344340
256 Ga0070680_100426565
257 Ga0070689_100357990
258 Ga0070675_100511774
259 Ga0070674_100257357
260 Ga0070688_100536315
261 Ga0070688_101599749
262 Ga0070700_100966583
263 Ga0070663_100284327
264 Ga0070678_100181459
265 Ga0070681_11073429
266 Ga0068867_100306708
267 Ga0070685_10111190
268 Ga0070672_100171192
269 Ga0070686_100256150
270 Ga0070686_100777845
271 Ga0070665_100016572
272 Ga0070664_100804460
273 Ga0068859_100105497
274 Ga0068864_100119318
275 Ga0068864_100898373
276 Ga0068861_101770882
277 Ga0068870_10363302
278 Ga0068870_10824415
279 Ga0075363_100017480
280 Ga0075364_10089556
281 Ga0075364_10244843
282 Ga0075362_10070813
283 Ga0075369_10225515
284 Ga0075366_10048387
285 Ga0075366_10476342
286 Ga0097621_100773825
287 Ga0075370_10179455
288 Ga0075428_101752058
289 Ga0075431_100226246
290 Ga0068865_100518886
291 Ga0097620_100105498
292 Ga0097620_101433958
293 Ga0099794_10079425
294 Ga0099794_10676729
295 Ga0099795_10364631
296 Ga0111539_10006919
297 Ga0105245_10231122
298 Ga0105247_10217832
299 Ga0105247_10265547
300 Ga0114129_10174680
301 Ga0105243_10001150
302 Ga0105243_10411387
303 Ga0105243_10748882
304 Ga0105241_10068205
305 Ga0105237_10795885
306 Ga0105238_10605788
307 Ga0105249_10905585
308 Ga0105246_10070996
309 Ga0105246_12203500
310 Ga0157378_10070060
311 Ga0163162_10952272
312 Ga0157375_10037236
313 Ga0157380_10017779
314 Ga0157380_10174254
315 Ga0182008_10335026
316 Ga0163161_10055960
317 Ga0209676_1000780
318 Ga0209051_1000531
319 Ga0209257_1021347
320 Ga0207697_10027353
321 Ga0207682_10002486
322 Ga0207710_10016842
323 Ga0207680_10022523
324 Ga0207645_10062254
325 Ga0207643_10430173
326 Ga0207643_10613986
327 Ga0207654_10027128
328 Ga0207660_11144930
329 Ga0207662_10014638
330 Ga0207694_11004270
331 Ga0207650_10178654
332 Ga0207650_10207268
333 Ga0207659_10545368
334 Ga0207709_10000211
335 Ga0207709_10180299
336 Ga0207709_10343514
337 Ga0207670_10217234
338 Ga0207669_10168897
339 Ga0207704_10351765
340 Ga0207691_10257215
341 Ga0207679_10152394
342 Ga0207651_10298595
343 Ga0207668_10206906
344 Ga0207668_11983742
345 Ga0207708_10265831
346 Ga0207641_11192979
347 Ga0207641_12260246
348 Ga0207676_10022795
349 Ga0207674_10041386
350 Ga0207675_101729745
351 Ga0207683_10013364
352 Ga0209967_1073862
353 Ga0207428_10096101
354 Ga0268266_10030307
355 Ga0268266_10784751
356 Ga0268265_10298312
357 Ga0307515_10547310
358 Ga0307512_10156125
359 Ga0307408_100348032
360 Ga0316576_10142735
361 Ga0316576_10173622
362 Ga0316576_10219380
363 Ga0316576_11287074
364 Ga0316578_10190914
365 Ga0307405_10005375
366 Ga0307405_11954386
367 Ga0316577_10061902
368 Ga0307412_11453025
369 Ga0307412_11503659
370 Ga0307412_11661421
371 Ga0307409_100117559
372 Ga0307409_101319044
373 Ga0307416_100680445
374 Ga0307416_101642407
375 Ga0307411_10270896
376 Ga0307411_12020035
377 Ga0316585_10131712
378 Ga0316593_10018273
379 Ga0316593_10056696
380 Ga0316593_10120462
381 Ga0316593_10259748
382 Ga0316588_1202497
383 Ga0316596_1194937
384 Ga0316596_1245314
385 Ga0316574_0978884
386 Ga0316582_0227064
387 Ga0316582_0778036
388 Ga0316582_0982823
389 Ga0316584_0103411
390 Ga0316584_0556929
391 Ga0316584_0599857
392 Ga0316584_0672614
393 Ga0316584_1141522
394 Ga0439447_145307
395 Ga0439443_079157
396 Ga0450893_0066868
397 Ga0451577_0333670
398 Ga0451577_0955732
399 Ga0451577_1033703
400 Ga0466969_0001123
401 Ga0453683_0065431
402 Ga0453683_0074703
403 Ga0466965_0013582
404 Ga0466966_0002092
405 Ga0466966_0059897
406 Ga0466961_0002461
407 Ga0466961_0397528
408 Ga0466963_0001428
409 Ga0466963_0049950
410 Ga0466964_0008481
411 Ga0453684_0065796
412 Ga0453684_0181016
413 Ga0453684_0226549
414 Ga0453684_0326995
415 Ga0453684_1320990
416 Ga0453684_1356352
417 Ga0466971_0540450
418 Ga0466968_0002195
419 Ga0466968_0089171
420 Ga0466970_0118105
421 Ga0466957_0333309
422 Ga0466959_0000361
423 Ga0466959_0016070
424 Ga0466959_0024849
425 Ga0451576_0112820
426 Ga0451576_0185976
427 Ga0451576_0261336
428 Ga0451576_0968740
429 Ga0451576_1274776
430 Ga0466958_0071554
431 Ga0466958_0189418
432 Ga0466958_0272347
433 Ga0466967_0101945
434 Ga0466967_1459668
435 Ga0495627_004129
436 Ga0495610_0075483
437 Ga0495620_0122585
438 Ga0495637_0014047
439 Ga0495598_0230709
440 Ga0495668_0017471
441 Ga0495625_0054021
442 Ga0495625_0125163
443 Ga0495661_0057543
444 Ga0495670_0173057
445 Ga0495671_0042813
446 Ga0495681_0084993
447 Ga0495615_0056576
448 Ga0501039_0489998
449 Ga0501040_0206310
450 Ga0501041_0383768
451 Ga0501042_0641498
452 Ga0501043_0887662
453 Ga0501075_0226798
454 Ga0501075_0584447
455 Ga0501217_069173
456 Ga0501249_002792
457 Ga0501259_092394
458 Ga0501225_0263980
459 Ga0501081_0474439
460 Ga0501267_036336
461 Ga0501268_013441
462 Ga0501269_065269
463 Ga0501035_0116752
464 Ga0501035_0932986
465 Ga0501044_0121921
466 Ga0501045_0114663
467 nmdc:mga03683_18879_c1
468 nmdc:mga03n38_99757_c1
469 nmdc:mga00v17_358324_c1
470 nmdc:mga00v17_63476_c1
471 nmdc:mga0k408_40084_c1
472 nmdc:mga07m45_175795_c1
473 nmdc:mga05p37_576982_c1
474 nmdc:mga06r32_173619_c1
475 nmdc:mga08y16_54773_c1
476 Ga0500610_0002147
477 Ga0500610_0016726
478 Ga0500644_0021623
479 Ga0500569_003638
480 Ga0500593_000312
481 Ga0500607_007969
482 Ga0500627_0001691
483 Ga0500633_0224697
484 Ga0500634_0033396
485 Ga0500645_038182
486 Ga0501082_1285626
487 Ga0466962_0148232
488 2599626473
489 2599677074
490 2599682174
491 2599695825
492 2644464899
493 2881101351
494 2883296223
495 2928075444
496 3004169873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o5u-assembly2.cif.gz_B crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution 0.8389 59 109
3bb6-assembly3.cif.gz_D crystal structure of the p64488 protein from e.coli (strain k12). northeast structural genomics consortium target er596 0.7993 62 111
1yhf-assembly1.cif.gz_A crystal structure of conserved spy1581 protein of unknown function from streptococcus pyogenes 0.7977 13 112
1zx5-assembly1.cif.gz_A the structure of a putative mannosephosphate isomerase from archaeoglobus fulgidus 0.7641 34 110
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.7586 8 112
ID Description Score Start End Superfamily
af_P31449_50_169_2.60.120.280 Mainly Beta;Sandwich;Jelly Rolls;Regulatory protein AraC 0.849 61 111 2.60.120.280
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8389 59 109 2.60.120.10
af_A0A0P0XVS2_79_143_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8005 59 107 2.60.120.10
af_Q20340_1_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7963 59 110 2.60.120.10
af_P96245_1_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7842 38 111 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1M5GXY0-F1-model_v4 Cupin domain-containing protein 0.9856 2 129
AF-A0A852RAY6-F1-model_v4 Cupin domain-containing protein 0.9832 1 129
AF-T0Z7A3-F1-model_v4 Cupin domain-containing protein 0.9815 1 101
AF-A0A7V1M7T7-F1-model_v4 Cupin domain-containing protein 0.9807 54 127
AF-A0A7C1ATA4-F1-model_v4 Cupin domain-containing protein 0.9761 36 126

Map