F359555
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 248 | 199 | 211 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300003762|Ga0055542_1002722|Ga0055542_10027225 |
| Length | 353 |
| Sequence | MGIWTKKHPSSTANPGKDAGMSDDSNQAKPTSERHVPVLKDRCINLLAPGFDAARRRGETPVVVDATLGMGGHSEAMLQRFPDLHLIGXDRDEEALALAGERLAPFADRTDLVHAVYDEXAEVIEDLGFSEVHGILMDLGVSSLQLDERDRGFAYSFDAPLDMRMDTSRGITAADVVNTYSEEDLVRIIRKWGEEKFAGRIANRIVAARAERPFTTTAQLVDTIRAVVPAGAAKSGGHPAKRTFQALRIEVNEELDVLERAIPAAVXSIALGGRVVVMSYHSLEDKIVKSVFQAGSKSSAPLGFPVELEEHKPELKTLTKGTEVPTAAEIAENPRAASARLRAVERIKARRDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 3 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 4 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 5 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 6 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 7 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 8 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 9 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 10 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 11 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 12 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 13 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 14 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 15 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 16 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 17 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 18 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 19 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 20 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 21 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 22 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 23 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 24 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 25 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 26 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 27 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 28 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 29 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 30 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 31 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 32 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 33 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 34 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 35 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 105 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 106 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 114 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 117 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 122 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 129 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 130 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 131 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 132 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 134 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 135 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 136 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 137 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 138 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 139 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 140 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 141 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 142 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 143 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 144 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 145 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 146 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 147 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 148 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 188 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 189 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 195 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 197 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 198 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 199 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.08 |
| Metatranscriptomes | 0 |
| Isolates | 14.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.03 |
| Nodule | 0 |
| Rhizoplane | 7.26 |
| Rhizosphere | 83.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1001723 | 3300002773 | Bacteria | 8957 |
| 2 | Ga0055542_1002722 | 3300003762 | Bacteria | 5401 |
| 3 | Ga0070676_10022078 | 3300005328 | Bacteria | 3567 |
| 4 | Ga0070677_10034026 | 3300005333 | Bacteria | 1966 |
| 5 | Ga0070660_100182617 | 3300005339 | Bacteria | 1698 |
| 6 | Ga0070692_10064798 | 3300005345 | Unclassified | 1933 |
| 7 | Ga0070668_100319957 | 3300005347 | Bacteria | 1306 |
| 8 | Ga0070669_100007140 | 3300005353 | Bacteria | 8026 |
| 9 | Ga0070675_100045633 | 3300005354 | Bacteria | 3586 |
| 10 | Ga0070673_100246939 | 3300005364 | Bacteria | 1554 |
| 11 | Ga0070688_100015627 | 3300005365 | Bacteria | 4324 |
| 12 | Ga0070667_100000228 | 3300005367 | Bacteria | 64501 |
| 13 | Ga0070710_10165650 | 3300005437 | Bacteria | 1374 |
| 14 | Ga0070678_100004024 | 3300005456 | Bacteria | 8272 |
| 15 | Ga0070698_100013292 | 3300005471 | Bacteria | 8713 |
| 16 | Ga0070699_100075745 | 3300005518 | Bacteria | 2929 |
| 17 | Ga0070697_100000075 | 3300005536 | Bacteria | 79532 |
| 18 | Ga0070696_100009580 | 3300005546 | Bacteria | 6478 |
| 19 | Ga0070704_100008258 | 3300005549 | Bacteria | 6233 |
| 20 | Ga0070704_100089567 | 3300005549 | Bacteria | 2289 |
| 21 | Ga0068857_100363195 | 3300005577 | Unclassified | 1342 |
| 22 | Ga0068864_100281901 | 3300005618 | Bacteria | 1551 |
| 23 | Ga0068861_100003894 | 3300005719 | Bacteria | 9981 |
| 24 | Ga0068870_10067964 | 3300005840 | Bacteria | 1935 |
| 25 | Ga0068858_100599680 | 3300005842 | Unclassified | 1068 |
| 26 | Ga0075364_10202260 | 3300006051 | Bacteria | 1346 |
| 27 | Ga0075428_100013746 | 3300006844 | Bacteria | 9015 |
| 28 | Ga0075428_100083378 | 3300006844 | Unclassified | 3488 |
| 29 | Ga0075431_100005416 | 3300006847 | Bacteria | 12608 |
| 30 | Ga0075429_100006233 | 3300006880 | Bacteria | 10323 |
| 31 | Ga0105251_10037379 | 3300009011 | Bacteria | 2383 |
| 32 | Ga0105244_10004700 | 3300009036 | Bacteria | 9303 |
| 33 | Ga0105244_10008715 | 3300009036 | Bacteria | 6311 |
| 34 | Ga0111539_10003359 | 3300009094 | Bacteria | 21129 |
| 35 | Ga0114129_10003259 | 3300009147 | Bacteria | 22784 |
| 36 | Ga0105243_10019175 | 3300009148 | Bacteria | 5186 |
| 37 | Ga0105238_10093785 | 3300009551 | Unclassified | 2990 |
| 38 | Ga0105249_10355372 | 3300009553 | Bacteria | 1485 |
| 39 | Ga0105246_10001217 | 3300011119 | Bacteria | 15078 |
| 40 | Ga0105246_10020780 | 3300011119 | Bacteria | 4216 |
| 41 | Ga0157373_10017811 | 3300013100 | Bacteria | 5173 |
| 42 | Ga0157371_10017570 | 3300013102 | Bacteria | 5310 |
| 43 | Ga0157371_10072839 | 3300013102 | Bacteria | 2433 |
| 44 | Ga0157370_10002619 | 3300013104 | Bacteria | 21643 |
| 45 | Ga0157369_10046589 | 3300013105 | Bacteria | 4711 |
| 46 | Ga0157369_10069714 | 3300013105 | Bacteria | 3777 |
| 47 | Ga0163162_10048432 | 3300013306 | Bacteria | 4258 |
| 48 | Ga0209148_1002215 | 3300025254 | Bacteria | 7146 |
| 49 | Ga0209129_1000142 | 3300025258 | Bacteria | 116806 |
| 50 | Ga0209025_1002705 | 3300025294 | Bacteria | 18045 |
| 51 | Ga0209051_1003007 | 3300025303 | Bacteria | 11437 |
| 52 | Ga0207697_10011135 | 3300025315 | Bacteria | 3812 |
| 53 | Ga0207655_1001340 | 3300025728 | Bacteria | 23144 |
| 54 | Ga0207655_1006100 | 3300025728 | Bacteria | 8044 |
| 55 | Ga0207713_1041826 | 3300025735 | Bacteria | 1908 |
| 56 | Ga0207692_10204431 | 3300025898 | Bacteria | 1163 |
| 57 | Ga0207680_10073076 | 3300025903 | Bacteria | 2131 |
| 58 | Ga0207645_10011801 | 3300025907 | Bacteria | 5950 |
| 59 | Ga0207681_10080141 | 3300025923 | Bacteria | 2302 |
| 60 | Ga0207694_10141666 | 3300025924 | Bacteria | 1934 |
| 61 | Ga0207650_10041806 | 3300025925 | Bacteria | 3361 |
| 62 | Ga0207644_10204897 | 3300025931 | Bacteria | 1557 |
| 63 | Ga0207669_10139387 | 3300025937 | Bacteria | 1681 |
| 64 | Ga0207691_10003148 | 3300025940 | Bacteria | 16133 |
| 65 | Ga0207668_10121724 | 3300025972 | Bacteria | 1977 |
| 66 | Ga0207658_10000024 | 3300025986 | Bacteria | 188273 |
| 67 | Ga0207658_10256165 | 3300025986 | Bacteria | 1489 |
| 68 | Ga0207675_100003814 | 3300026118 | Bacteria | 14671 |
| 69 | Ga0207428_10011142 | 3300027907 | Bacteria | 7978 |
| 70 | Ga0268264_10660835 | 3300028381 | Bacteria | 1035 |
| 71 | Ga0265326_10007991 | 3300028558 | Bacteria | 3213 |
| 72 | Ga0265334_10013767 | 3300028573 | Bacteria | 3381 |
| 73 | Ga0265334_10019984 | 3300028573 | Bacteria | 2746 |
| 74 | Ga0265318_10000858 | 3300028577 | Bacteria | 20003 |
| 75 | Ga0265318_10003381 | 3300028577 | Bacteria | 8039 |
| 76 | Ga0265322_10023109 | 3300028654 | Bacteria | 1778 |
| 77 | Ga0265338_10069021 | 3300028800 | Bacteria | 3040 |
| 78 | Ga0265330_10000745 | 3300031235 | Bacteria | 20548 |
| 79 | Ga0265332_10009117 | 3300031238 | Bacteria | 4436 |
| 80 | Ga0265320_10003505 | 3300031240 | Bacteria | 10519 |
| 81 | Ga0265320_10012973 | 3300031240 | Bacteria | 4813 |
| 82 | Ga0265325_10000817 | 3300031241 | Bacteria | 22571 |
| 83 | Ga0265329_10010039 | 3300031242 | Bacteria | 3498 |
| 84 | Ga0265340_10049885 | 3300031247 | Bacteria | 2031 |
| 85 | Ga0265331_10056313 | 3300031250 | Bacteria | 1867 |
| 86 | Ga0265327_10000021 | 3300031251 | Bacteria | 417788 |
| 87 | Ga0265327_10020079 | 3300031251 | Bacteria | 4085 |
| 88 | Ga0265316_10132827 | 3300031344 | Bacteria | 1874 |
| 89 | Ga0307408_100001449 | 3300031548 | Bacteria | 17645 |
| 90 | Ga0307408_100268949 | 3300031548 | Bacteria | 1414 |
| 91 | Ga0265313_10004865 | 3300031595 | Bacteria | 10085 |
| 92 | Ga0265313_10043676 | 3300031595 | Bacteria | 2193 |
| 93 | Ga0265314_10034872 | 3300031711 | Bacteria | 3671 |
| 94 | Ga0307405_10068881 | 3300031731 | Bacteria | 2266 |
| 95 | Ga0307405_10120972 | 3300031731 | Bacteria | 1791 |
| 96 | Ga0307405_10144379 | 3300031731 | Bacteria | 1664 |
| 97 | Ga0307413_10037788 | 3300031824 | Bacteria | 2791 |
| 98 | Ga0307413_10081800 | 3300031824 | Bacteria | 2072 |
| 99 | Ga0307410_10026232 | 3300031852 | Bacteria | 3665 |
| 100 | Ga0307410_10034553 | 3300031852 | Bacteria | 3275 |
| 101 | Ga0307410_10067777 | 3300031852 | Bacteria | 2462 |
| 102 | Ga0307410_10099796 | 3300031852 | Bacteria | 2079 |
| 103 | Ga0307406_10123845 | 3300031901 | Bacteria | 1802 |
| 104 | Ga0307407_10036231 | 3300031903 | Bacteria | 2717 |
| 105 | Ga0307407_10114894 | 3300031903 | Bacteria | 1696 |
| 106 | Ga0307412_10000868 | 3300031911 | Bacteria | 17366 |
| 107 | Ga0307412_10088137 | 3300031911 | Bacteria | 2164 |
| 108 | Ga0307412_10153235 | 3300031911 | Bacteria | 1703 |
| 109 | Ga0307412_10260955 | 3300031911 | Bacteria | 1350 |
| 110 | Ga0307409_100011897 | 3300031995 | Bacteria | 5514 |
| 111 | Ga0307409_100015925 | 3300031995 | Bacteria | 4954 |
| 112 | Ga0307409_100089454 | 3300031995 | Bacteria | 2517 |
| 113 | Ga0307416_100134338 | 3300032002 | Bacteria | 2234 |
| 114 | Ga0307416_100509700 | 3300032002 | Bacteria | 1269 |
| 115 | Ga0307414_10002425 | 3300032004 | Bacteria | 9750 |
| 116 | Ga0307414_10003653 | 3300032004 | Bacteria | 8243 |
| 117 | Ga0307414_10040897 | 3300032004 | Bacteria | 3135 |
| 118 | Ga0307411_10088238 | 3300032005 | Bacteria | 2156 |
| 119 | Ga0307415_100130583 | 3300032126 | Bacteria | 1901 |
| 120 | Ga0307415_100236837 | 3300032126 | Bacteria | 1474 |
| 121 | Ga0395899_0121215 | 3300037312 | Bacteria | 1873 |
| 122 | Ga0395899_0187019 | 3300037312 | Bacteria | 1451 |
| 123 | Ga0395900_0030470 | 3300037418 | Bacteria | 5540 |
| 124 | Ga0395900_0278830 | 3300037418 | Bacteria | 1664 |
| 125 | Ga0395900_0280518 | 3300037418 | Bacteria | 1658 |
| 126 | Ga0395898_0028565 | 3300037466 | Bacteria | 5589 |
| 127 | Ga0395898_0317069 | 3300037466 | Bacteria | 1487 |
| 128 | Ga0395901_0003390 | 3300038443 | Bacteria | 16045 |
| 129 | Ga0395901_0025499 | 3300038443 | Bacteria | 6069 |
| 130 | Ga0395901_0065402 | 3300038443 | Bacteria | 3786 |
| 131 | Ga0395901_0178552 | 3300038443 | Bacteria | 2227 |
| 132 | Ga0395901_0218110 | 3300038443 | Bacteria | 1994 |
| 133 | Ga0439439_0000145 | 3300041406 | Bacteria | 10216 |
| 134 | Ga0439461_0007661 | 3300041410 | Bacteria | 1919 |
| 135 | Ga0439466_0000680 | 3300041411 | Bacteria | 12823 |
| 136 | Ga0451791_0239299 | 3300041451 | Bacteria | 2204 |
| 137 | Ga0451797_1159383 | 3300041453 | Bacteria | 1428 |
| 138 | Ga0439433_0019675 | 3300041999 | Bacteria | 1505 |
| 139 | Ga0439442_001528 | 3300042002 | Bacteria | 4537 |
| 140 | Ga0439432_002221 | 3300042006 | Bacteria | 7325 |
| 141 | Ga0439449_0002930 | 3300042007 | Bacteria | 6639 |
| 142 | Ga0439452_001946 | 3300042010 | Bacteria | 7901 |
| 143 | Ga0439462_0002957 | 3300042015 | Bacteria | 4025 |
| 144 | Ga0450919_000060 | 3300042121 | Bacteria | 9866 |
| 145 | Ga0450920_000737 | 3300042122 | Bacteria | 5269 |
| 146 | Ga0450906_021433 | 3300042145 | Bacteria | 1155 |
| 147 | Ga0450908_000874 | 3300042184 | Bacteria | 5819 |
| 148 | Ga0450909_000012 | 3300042185 | Bacteria | 15117 |
| 149 | Ga0439434_0003017 | 3300042435 | Bacteria | 4932 |
| 150 | Ga0450918_000374 | 3300042531 | Bacteria | 9743 |
| 151 | Ga0466972_0087893 | 3300044658 | Bacteria | 1476 |
| 152 | Ga0466963_0137348 | 3300044694 | Bacteria | 1692 |
| 153 | Ga0453684_0004209 | 3300044712 | Bacteria | 30919 |
| 154 | Ga0451576_0379256 | 3300045051 | Unclassified | 1482 |
| 155 | Ga0466967_0021242 | 3300045976 | Bacteria | 5266 |
| 156 | Ga0466967_0221011 | 3300045976 | Bacteria | 1800 |
| 157 | Ga0466967_0225911 | 3300045976 | Bacteria | 1781 |
| 158 | Ga0495653_0112187 | 3300046463 | Bacteria | 1957 |
| 159 | Ga0495580_0188272 | 3300046472 | Bacteria | 1424 |
| 160 | Ga0495628_0004398 | 3300046516 | Bacteria | 12500 |
| 161 | Ga0495631_0021082 | 3300046518 | Bacteria | 3037 |
| 162 | Ga0495643_0038445 | 3300046522 | Bacteria | 2621 |
| 163 | Ga0495642_0013307 | 3300046528 | Bacteria | 3181 |
| 164 | Ga0495656_0001558 | 3300046615 | Bacteria | 7498 |
| 165 | Ga0495634_0023402 | 3300046642 | Bacteria | 4343 |
| 166 | Ga0495588_0036267 | 3300046674 | Bacteria | 2501 |
| 167 | Ga0495647_0068870 | 3300046681 | Bacteria | 1412 |
| 168 | Ga0495658_0077829 | 3300046683 | Bacteria | 1940 |
| 169 | Ga0495613_0262096 | 3300046689 | Bacteria | 1204 |
| 170 | Ga0495670_0004847 | 3300046691 | Bacteria | 6603 |
| 171 | Ga0495581_0176103 | 3300047315 | Bacteria | 1250 |
| 172 | Ga0495676_0091768 | 3300047321 | Bacteria | 2268 |
| 173 | Ga0495677_0056314 | 3300047445 | Bacteria | 1452 |
| 174 | Ga0495684_0002020 | 3300047471 | Bacteria | 16316 |
| 175 | Ga0496100_0218495 | 3300048903 | Bacteria | 1397 |
| 176 | Ga0496102_0262281 | 3300048905 | Bacteria | 1629 |
| 177 | Ga0496103_0034583 | 3300048906 | Bacteria | 3090 |
| 178 | Ga0496104_0497174 | 3300048907 | Bacteria | 1131 |
| 179 | Ga0496105_0032275 | 3300048908 | Bacteria | 4296 |
| 180 | Ga0496105_0062221 | 3300048908 | Bacteria | 3080 |
| 181 | Ga0496107_0001017 | 3300048910 | Bacteria | 16749 |
| 182 | Ga0496107_0290501 | 3300048910 | Bacteria | 1217 |
| 183 | Ga0496108_0155359 | 3300048911 | Bacteria | 1975 |
| 184 | Ga0496109_0178896 | 3300048912 | Bacteria | 1991 |
| 185 | Ga0496109_0256130 | 3300048912 | Bacteria | 1648 |
| 186 | Ga0496109_0321375 | 3300048912 | Bacteria | 1460 |
| 187 | Ga0496110_0057639 | 3300048913 | Bacteria | 3419 |
| 188 | Ga0496111_0083198 | 3300048914 | Bacteria | 2338 |
| 189 | Ga0496111_0158188 | 3300048914 | Bacteria | 1681 |
| 190 | Ga0496115_0368457 | 3300048918 | Bacteria | 1170 |
| 191 | Ga0496124_0026527 | 3300048927 | Bacteria | 5221 |
| 192 | Ga0496124_0059153 | 3300048927 | Bacteria | 3220 |
| 193 | Ga0501032_0001192 | 3300049569 | Bacteria | 20813 |
| 194 | Ga0501034_0000080 | 3300049571 | Bacteria | 170742 |
| 195 | Ga0501038_0135209 | 3300049574 | Bacteria | 2021 |
| 196 | Ga0501038_0264186 | 3300049574 | Bacteria | 1359 |
| 197 | Ga0501040_0108445 | 3300049576 | Bacteria | 1941 |
| 198 | Ga0501046_0225207 | 3300049580 | Bacteria | 1387 |
| 199 | Ga0501074_0149057 | 3300049590 | Bacteria | 1673 |
| 200 | Ga0501079_0245523 | 3300049741 | Bacteria | 1399 |
| 201 | nmdc:mga00v17_229317_c1 | 3300050491 | Bacteria | 1203 |
| 202 | nmdc:mga0yw44_128487_c1 | 3300050492 | Bacteria | 1638 |
| 203 | nmdc:mga0yw44_135132_c1 | 3300050492 | Bacteria | 1599 |
| 204 | nmdc:mga09592_57159_c1 | 3300050508 | Unclassified | 3297 |
| 205 | nmdc:mga08y16_160223_c1 | 3300050511 | Bacteria | 2338 |
| 206 | nmdc:mga08y16_86761_c1 | 3300050511 | Bacteria | 3261 |
| 207 | Ga0495601_0346386 | 3300053077 | Bacteria | 966 |
| 208 | Ga0495655_0008233 | 3300053083 | Bacteria | 1972 |
| 209 | Ga0501084_0115222 | 3300054114 | Bacteria | 2259 |
| 210 | Ga0590075_017288 | 3300059424 | Bacteria | 1777 |
| 211 | Ga0501082_0052484 | 3300060353 | Bacteria | 3515 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050508 | nmdc:mga09592_57159_c1 | nmdc:mga09592_57159_c1_763_1557 | 245 |
| 2 | 3300028381 | Ga0268264_10660835 | Ga0268264_106608351 | 247 |
| 3 | 3300046689 | Ga0495613_0262096 | Ga0495613_0262096_202_1074 | 264 |
| 4 | 3300044658 | Ga0466972_0087893 | Ga0466972_0087893_609_1463 | 270 |
| 5 | 3300044694 | Ga0466963_0137348 | Ga0466963_0137348_56_1009 | 270 |
| 6 | 3300005471 | Ga0070698_100013292 | Ga0070698_1000132923 | 272 |
| 7 | 3300005536 | Ga0070697_100000075 | Ga0070697_10000007510 | 272 |
| 8 | 3300005549 | Ga0070704_100008258 | Ga0070704_1000082584 | 272 |
| 9 | 3300009147 | Ga0114129_10003259 | Ga0114129_1000325917 | 272 |
| 10 | 3300053077 | Ga0495601_0346386 | Ga0495601_0346386_67_945 | 273 |
| 11 | 3300009551 | Ga0105238_10093785 | Ga0105238_100937853 | 274 |
| 12 | 3300025924 | Ga0207694_10141666 | Ga0207694_101416661 | 274 |
| 13 | 3300048908 | Ga0496105_0062221 | Ga0496105_0062221_894_1853 | 274 |
| 14 | 3300006051 | Ga0075364_10202260 | Ga0075364_102022602 | 277 |
| 15 | 3300050491 | nmdc:mga00v17_229317_c1 | nmdc:mga00v17_229317_c1_29_916 | 277 |
| 16 | 3300050492 | nmdc:mga0yw44_128487_c1 | nmdc:mga0yw44_128487_c1_569_1456 | 277 |
| 17 | 3300009094 | Ga0111539_10003359 | Ga0111539_1000335918 | 278 |
| 18 | 3300050511 | nmdc:mga08y16_160223_c1 | nmdc:mga08y16_160223_c1_989_1879 | 278 |
| 19 | 3300009553 | Ga0105249_10355372 | Ga0105249_103553723 | 279 |
| 20 | 3300046642 | Ga0495634_0023402 | Ga0495634_0023402_675_1634 | 279 |
| 21 | 3300046683 | Ga0495658_0077829 | Ga0495658_0077829_349_1308 | 279 |
| 22 | 3300048910 | Ga0496107_0290501 | Ga0496107_0290501_228_1187 | 279 |
| 23 | 3300046472 | Ga0495580_0188272 | Ga0495580_0188272_199_1110 | 282 |
| 24 | 3300046674 | Ga0495588_0036267 | Ga0495588_0036267_849_1760 | 282 |
| 25 | 3300046681 | Ga0495647_0068870 | Ga0495647_0068870_118_1032 | 282 |
| 26 | 3300047321 | Ga0495676_0091768 | Ga0495676_0091768_463_1374 | 282 |
| 27 | 3300048912 | Ga0496109_0256130 | Ga0496109_0256130_228_1187 | 283 |
| 28 | 3300050492 | nmdc:mga0yw44_135132_c1 | nmdc:mga0yw44_135132_c1_422_1381 | 283 |
| 29 | 3300005345 | Ga0070692_10064798 | Ga0070692_100647983 | 284 |
| 30 | 3300005719 | Ga0068861_100003894 | Ga0068861_1000038942 | 284 |
| 31 | 3300005840 | Ga0068870_10067964 | Ga0068870_100679642 | 284 |
| 32 | 3300005842 | Ga0068858_100599680 | Ga0068858_1005996801 | 284 |
| 33 | 3300006844 | Ga0075428_100083378 | Ga0075428_1000833783 | 284 |
| 34 | 3300006847 | Ga0075431_100005416 | Ga0075431_1000054169 | 284 |
| 35 | 3300006880 | Ga0075429_100006233 | Ga0075429_1000062338 | 284 |
| 36 | 3300026118 | Ga0207675_100003814 | Ga0207675_10000381410 | 284 |
| 37 | 3300027907 | Ga0207428_10011142 | Ga0207428_100111424 | 284 |
| 38 | 3300005518 | Ga0070699_100075745 | Ga0070699_1000757453 | 285 |
| 39 | 3300005437 | Ga0070710_10165650 | Ga0070710_101656501 | 286 |
| 40 | 3300005546 | Ga0070696_100009580 | Ga0070696_1000095805 | 286 |
| 41 | 3300005549 | Ga0070704_100089567 | Ga0070704_1000895673 | 286 |
| 42 | 3300048905 | Ga0496102_0262281 | Ga0496102_0262281_676_1608 | 286 |
| 43 | 3300044712 | Ga0453684_0004209 | Ga0453684_0004209_4416_5327 | 287 |
| 44 | 3300045051 | Ga0451576_0379256 | Ga0451576_0379256_206_1117 | 287 |
| 45 | 3300028558 | Ga0265326_10007991 | Ga0265326_100079912 | 290 |
| 46 | 3300028573 | Ga0265334_10013767 | Ga0265334_100137673 | 290 |
| 47 | 3300028577 | Ga0265318_10003381 | Ga0265318_100033811 | 290 |
| 48 | 3300028800 | Ga0265338_10069021 | Ga0265338_100690213 | 290 |
| 49 | 3300031240 | Ga0265320_10003505 | Ga0265320_100035058 | 290 |
| 50 | 3300031250 | Ga0265331_10056313 | Ga0265331_100563133 | 290 |
| 51 | 3300031344 | Ga0265316_10132827 | Ga0265316_101328272 | 290 |
| 52 | 3300031595 | Ga0265313_10043676 | Ga0265313_100436762 | 290 |
| 53 | 3300049574 | Ga0501038_0135209 | Ga0501038_0135209_836_1795 | 290 |
| 54 | 3300049576 | Ga0501040_0108445 | Ga0501040_0108445_412_1371 | 290 |
| 55 | 3300049580 | Ga0501046_0225207 | Ga0501046_0225207_417_1376 | 290 |
| 56 | 3300049590 | Ga0501074_0149057 | Ga0501074_0149057_581_1540 | 290 |
| 57 | 3300049741 | Ga0501079_0245523 | Ga0501079_0245523_19_978 | 290 |
| 58 | 3300054114 | Ga0501084_0115222 | Ga0501084_0115222_1042_2001 | 290 |
| 59 | 3300060353 | Ga0501082_0052484 | Ga0501082_0052484_1756_2715 | 290 |
| 60 | 3300005367 | Ga0070667_100000228 | Ga0070667_1000002283 | 291 |
| 61 | 3300025986 | Ga0207658_10000024 | Ga0207658_10000024126 | 291 |
| 62 | 3300045976 | Ga0466967_0021242 | Ga0466967_0021242_1000_1986 | 291 |
| 63 | 3300025898 | Ga0207692_10204431 | Ga0207692_102044312 | 292 |
| 64 | 3300050511 | nmdc:mga08y16_86761_c1 | nmdc:mga08y16_86761_c1_1603_2538 | 292 |
| 65 | 3300047315 | Ga0495581_0176103 | Ga0495581_0176103_311_1234 | 293 |
| 66 | 3300048907 | Ga0496104_0497174 | Ga0496104_0497174_24_947 | 293 |
| 67 | 3300048918 | Ga0496115_0368457 | Ga0496115_0368457_223_1146 | 293 |
| 68 | 3300049574 | Ga0501038_0264186 | Ga0501038_0264186_67_990 | 293 |
| 69 | 3300005365 | Ga0070688_100015627 | Ga0070688_1000156274 | 294 |
| 70 | iso_pu_bacteria | 2751185734 | 2753070915 | 295 |
| 71 | iso_pu_bacteria | 2870721527 | 2870726507 | 295 |
| 72 | 3300028573 | Ga0265334_10019984 | Ga0265334_100199844 | 296 |
| 73 | 3300028577 | Ga0265318_10000858 | Ga0265318_1000085818 | 296 |
| 74 | 3300028654 | Ga0265322_10023109 | Ga0265322_100231091 | 296 |
| 75 | 3300031235 | Ga0265330_10000745 | Ga0265330_100007452 | 296 |
| 76 | 3300031238 | Ga0265332_10009117 | Ga0265332_100091173 | 296 |
| 77 | 3300031240 | Ga0265320_10012973 | Ga0265320_100129733 | 296 |
| 78 | 3300031241 | Ga0265325_10000817 | Ga0265325_100008174 | 296 |
| 79 | 3300031242 | Ga0265329_10010039 | Ga0265329_100100394 | 296 |
| 80 | 3300031247 | Ga0265340_10049885 | Ga0265340_100498851 | 296 |
| 81 | 3300031251 | Ga0265327_10020079 | Ga0265327_100200793 | 296 |
| 82 | 3300031595 | Ga0265313_10004865 | Ga0265313_100048654 | 296 |
| 83 | 3300031711 | Ga0265314_10034872 | Ga0265314_100348723 | 296 |
| 84 | 3300046463 | Ga0495653_0112187 | Ga0495653_0112187_56_1027 | 298 |
| 85 | iso_pu_bacteria | 8056667051 | 8056668567 | 298 |
| 86 | 3300005618 | Ga0068864_100281901 | Ga0068864_1002819013 | 299 |
| 87 | 3300006844 | Ga0075428_100013746 | Ga0075428_1000137467 | 299 |
| 88 | 3300031251 | Ga0265327_10000021 | Ga0265327_10000021156 | 299 |
| 89 | 3300046516 | Ga0495628_0004398 | Ga0495628_0004398_7657_8652 | 299 |
| 90 | 3300047471 | Ga0495684_0002020 | Ga0495684_0002020_14066_15061 | 299 |
| 91 | 3300042145 | Ga0450906_021433 | Ga0450906_021433_41_1033 | 301 |
| 92 | iso_pu_bacteria | 2857727296 | 2857728675 | 302 |
| 93 | 3300005339 | Ga0070660_100182617 | Ga0070660_1001826172 | 304 |
| 94 | 3300005577 | Ga0068857_100363195 | Ga0068857_1003631952 | 304 |
| 95 | iso_pu_bacteria | 2884994152 | 2884995125 | 307 |
| 96 | 3300048927 | Ga0496124_0026527 | Ga0496124_0026527_4185_5186 | 308 |
| 97 | iso_pu_bacteria | 2643221694 | 2644526592 | 308 |
| 98 | iso_pu_bacteria | 2643221722 | 2644671258 | 308 |
| 99 | iso_pu_bacteria | 2643221690 | 2644506490 | 309 |
| 100 | 3300013105 | Ga0157369_10046589 | Ga0157369_100465894 | 311 |
| 101 | 3300045976 | Ga0466967_0225911 | Ga0466967_0225911_700_1680 | 311 |
| 102 | iso_pu_bacteria | 2537561592 | 2537900166 | 311 |
| 103 | iso_pu_bacteria | 2808606700 | 2810365623 | 311 |
| 104 | iso_pu_bacteria | 2905926851 | 2905927015 | 311 |
| 105 | iso_pu_bacteria | 2946003308 | 2946004130 | 311 |
| 106 | iso_pu_bacteria | 2808606370 | 2808890748 | 312 |
| 107 | iso_pu_bacteria | 2808606371 | 2808896028 | 312 |
| 108 | iso_pu_bacteria | 2939598168 | 2939600127 | 312 |
| 109 | iso_pu_bacteria | 2945920336 | 2945920389 | 312 |
| 110 | iso_pu_bacteria | 2945941187 | 2945943672 | 312 |
| 111 | iso_pu_bacteria | 2946037020 | 2946039645 | 312 |
| 112 | iso_pu_bacteria | 2953998280 | 2954000870 | 312 |
| 113 | iso_pu_bacteria | 2974302888 | 2974303139 | 312 |
| 114 | 3300041451 | Ga0451791_0239299 | Ga0451791_0239299_490_1530 | 313 |
| 115 | 3300041453 | Ga0451797_1159383 | Ga0451797_1159383_194_1234 | 313 |
| 116 | iso_pu_bacteria | 2523231044 | 2523386886 | 314 |
| 117 | iso_pu_bacteria | 2844849076 | 2844852388 | 314 |
| 118 | iso_pu_bacteria | 2857740372 | 2857744416 | 314 |
| 119 | iso_pu_bacteria | 2904497146 | 2904501058 | 314 |
| 120 | iso_pu_bacteria | 2904776348 | 2904778043 | 314 |
| 121 | iso_pu_bacteria | 2910809715 | 2910812208 | 314 |
| 122 | iso_pu_bacteria | 2919034639 | 2919038848 | 314 |
| 123 | iso_pu_bacteria | 2919391150 | 2919393360 | 314 |
| 124 | iso_pu_bacteria | 2919538618 | 2919542581 | 314 |
| 125 | iso_pu_bacteria | 2932426870 | 2932430510 | 314 |
| 126 | iso_pu_bacteria | 2933418574 | 2933421701 | 314 |
| 127 | iso_pu_bacteria | 2939674588 | 2939678871 | 314 |
| 128 | iso_pu_bacteria | 8004021418 | 8004024134 | 314 |
| 129 | iso_pu_bacteria | 8004025490 | 8004026311 | 314 |
| 130 | 3300031824 | Ga0307413_10081800 | Ga0307413_100818002 | 315 |
| 131 | 3300031852 | Ga0307410_10099796 | Ga0307410_100997963 | 315 |
| 132 | 3300031995 | Ga0307409_100015925 | Ga0307409_1000159253 | 315 |
| 133 | 3300032004 | Ga0307414_10003653 | Ga0307414_100036537 | 315 |
| 134 | 3300032126 | Ga0307415_100130583 | Ga0307415_1001305832 | 315 |
| 135 | 3300032126 | Ga0307415_100236837 | Ga0307415_1002368372 | 315 |
| 136 | 3300045976 | Ga0466967_0221011 | Ga0466967_0221011_578_1567 | 315 |
| 137 | 3300053083 | Ga0495655_0008233 | Ga0495655_0008233_890_1879 | 315 |
| 138 | 3300011119 | Ga0105246_10020780 | Ga0105246_100207802 | 316 |
| 139 | 3300031548 | Ga0307408_100001449 | Ga0307408_10000144910 | 316 |
| 140 | 3300031731 | Ga0307405_10068881 | Ga0307405_100688812 | 316 |
| 141 | 3300031731 | Ga0307405_10144379 | Ga0307405_101443792 | 316 |
| 142 | 3300031824 | Ga0307413_10037788 | Ga0307413_100377883 | 316 |
| 143 | 3300031852 | Ga0307410_10067777 | Ga0307410_100677772 | 316 |
| 144 | 3300031901 | Ga0307406_10123845 | Ga0307406_101238451 | 316 |
| 145 | 3300031903 | Ga0307407_10036231 | Ga0307407_100362312 | 316 |
| 146 | 3300031911 | Ga0307412_10000868 | Ga0307412_1000086816 | 316 |
| 147 | 3300031911 | Ga0307412_10153235 | Ga0307412_101532352 | 316 |
| 148 | 3300032002 | Ga0307416_100134338 | Ga0307416_1001343382 | 316 |
| 149 | 3300032002 | Ga0307416_100509700 | Ga0307416_1005097002 | 316 |
| 150 | 3300032004 | Ga0307414_10002425 | Ga0307414_100024253 | 316 |
| 151 | 3300032005 | Ga0307411_10088238 | Ga0307411_100882382 | 316 |
| 152 | 3300037312 | Ga0395899_0121215 | Ga0395899_0121215_639_1631 | 316 |
| 153 | 3300037418 | Ga0395900_0280518 | Ga0395900_0280518_121_1113 | 316 |
| 154 | 3300037466 | Ga0395898_0317069 | Ga0395898_0317069_33_1025 | 316 |
| 155 | 3300038443 | Ga0395901_0065402 | Ga0395901_0065402_2222_3214 | 316 |
| 156 | 3300038443 | Ga0395901_0218110 | Ga0395901_0218110_776_1768 | 316 |
| 157 | 3300011119 | Ga0105246_10001217 | Ga0105246_100012172 | 317 |
| 158 | 3300031852 | Ga0307410_10026232 | Ga0307410_100262323 | 317 |
| 159 | 3300002773 | JGI25152J39213_1001723 | JGI25152J39213_10017232 | 318 |
| 160 | 3300003762 | Ga0055542_1002722 | Ga0055542_10027225 | 318 |
| 161 | 3300005328 | Ga0070676_10022078 | Ga0070676_100220782 | 318 |
| 162 | 3300005333 | Ga0070677_10034026 | Ga0070677_100340262 | 318 |
| 163 | 3300005347 | Ga0070668_100319957 | Ga0070668_1003199572 | 318 |
| 164 | 3300005353 | Ga0070669_100007140 | Ga0070669_1000071406 | 318 |
| 165 | 3300005354 | Ga0070675_100045633 | Ga0070675_1000456334 | 318 |
| 166 | 3300005364 | Ga0070673_100246939 | Ga0070673_1002469391 | 318 |
| 167 | 3300005456 | Ga0070678_100004024 | Ga0070678_1000040242 | 318 |
| 168 | 3300009011 | Ga0105251_10037379 | Ga0105251_100373793 | 318 |
| 169 | 3300009036 | Ga0105244_10004700 | Ga0105244_100047004 | 318 |
| 170 | 3300009036 | Ga0105244_10008715 | Ga0105244_100087155 | 318 |
| 171 | 3300009148 | Ga0105243_10019175 | Ga0105243_100191756 | 318 |
| 172 | 3300013100 | Ga0157373_10017811 | Ga0157373_100178114 | 318 |
| 173 | 3300013102 | Ga0157371_10017570 | Ga0157371_100175704 | 318 |
| 174 | 3300013102 | Ga0157371_10072839 | Ga0157371_100728392 | 318 |
| 175 | 3300013104 | Ga0157370_10002619 | Ga0157370_100026196 | 318 |
| 176 | 3300013105 | Ga0157369_10069714 | Ga0157369_100697144 | 318 |
| 177 | 3300013306 | Ga0163162_10048432 | Ga0163162_100484322 | 318 |
| 178 | 3300025254 | Ga0209148_1002215 | Ga0209148_10022153 | 318 |
| 179 | 3300025258 | Ga0209129_1000142 | Ga0209129_100014271 | 318 |
| 180 | 3300025294 | Ga0209025_1002705 | Ga0209025_100270515 | 318 |
| 181 | 3300025303 | Ga0209051_1003007 | Ga0209051_10030077 | 318 |
| 182 | 3300025315 | Ga0207697_10011135 | Ga0207697_100111352 | 318 |
| 183 | 3300025728 | Ga0207655_1001340 | Ga0207655_10013403 | 318 |
| 184 | 3300025728 | Ga0207655_1006100 | Ga0207655_10061005 | 318 |
| 185 | 3300025735 | Ga0207713_1041826 | Ga0207713_10418263 | 318 |
| 186 | 3300025903 | Ga0207680_10073076 | Ga0207680_100730762 | 318 |
| 187 | 3300025907 | Ga0207645_10011801 | Ga0207645_100118013 | 318 |
| 188 | 3300025923 | Ga0207681_10080141 | Ga0207681_100801413 | 318 |
| 189 | 3300025925 | Ga0207650_10041806 | Ga0207650_100418062 | 318 |
| 190 | 3300025931 | Ga0207644_10204897 | Ga0207644_102048972 | 318 |
| 191 | 3300025937 | Ga0207669_10139387 | Ga0207669_101393872 | 318 |
| 192 | 3300025940 | Ga0207691_10003148 | Ga0207691_100031488 | 318 |
| 193 | 3300025972 | Ga0207668_10121724 | Ga0207668_101217241 | 318 |
| 194 | 3300025986 | Ga0207658_10256165 | Ga0207658_102561651 | 318 |
| 195 | 3300031548 | Ga0307408_100268949 | Ga0307408_1002689492 | 318 |
| 196 | 3300031731 | Ga0307405_10120972 | Ga0307405_101209722 | 318 |
| 197 | 3300031852 | Ga0307410_10034553 | Ga0307410_100345531 | 318 |
| 198 | 3300031903 | Ga0307407_10114894 | Ga0307407_101148942 | 318 |
| 199 | 3300031911 | Ga0307412_10088137 | Ga0307412_100881372 | 318 |
| 200 | 3300031911 | Ga0307412_10260955 | Ga0307412_102609551 | 318 |
| 201 | 3300031995 | Ga0307409_100011897 | Ga0307409_1000118974 | 318 |
| 202 | 3300031995 | Ga0307409_100089454 | Ga0307409_1000894542 | 318 |
| 203 | 3300032004 | Ga0307414_10040897 | Ga0307414_100408974 | 318 |
| 204 | 3300037312 | Ga0395899_0187019 | Ga0395899_0187019_67_1095 | 318 |
| 205 | 3300037418 | Ga0395900_0030470 | Ga0395900_0030470_3244_4272 | 318 |
| 206 | 3300037418 | Ga0395900_0278830 | Ga0395900_0278830_144_1145 | 318 |
| 207 | 3300037466 | Ga0395898_0028565 | Ga0395898_0028565_3185_4213 | 318 |
| 208 | 3300038443 | Ga0395901_0003390 | Ga0395901_0003390_13559_14560 | 318 |
| 209 | 3300038443 | Ga0395901_0025499 | Ga0395901_0025499_4021_5049 | 318 |
| 210 | 3300038443 | Ga0395901_0178552 | Ga0395901_0178552_650_1648 | 318 |
| 211 | 3300041406 | Ga0439439_0000145 | Ga0439439_0000145_7511_8509 | 318 |
| 212 | 3300041410 | Ga0439461_0007661 | Ga0439461_0007661_237_1235 | 318 |
| 213 | 3300041411 | Ga0439466_0000680 | Ga0439466_0000680_7764_8762 | 318 |
| 214 | 3300041999 | Ga0439433_0019675 | Ga0439433_0019675_62_1060 | 318 |
| 215 | 3300042002 | Ga0439442_001528 | Ga0439442_001528_248_1246 | 318 |
| 216 | 3300042006 | Ga0439432_002221 | Ga0439432_002221_378_1376 | 318 |
| 217 | 3300042007 | Ga0439449_0002930 | Ga0439449_0002930_1580_2578 | 318 |
| 218 | 3300042010 | Ga0439452_001946 | Ga0439452_001946_4369_5367 | 318 |
| 219 | 3300042015 | Ga0439462_0002957 | Ga0439462_0002957_2175_3173 | 318 |
| 220 | 3300042121 | Ga0450919_000060 | Ga0450919_000060_8135_9133 | 318 |
| 221 | 3300042122 | Ga0450920_000737 | Ga0450920_000737_852_1850 | 318 |
| 222 | 3300042184 | Ga0450908_000874 | Ga0450908_000874_852_1850 | 318 |
| 223 | 3300042185 | Ga0450909_000012 | Ga0450909_000012_7335_8333 | 318 |
| 224 | 3300042435 | Ga0439434_0003017 | Ga0439434_0003017_92_1090 | 318 |
| 225 | 3300042531 | Ga0450918_000374 | Ga0450918_000374_853_1851 | 318 |
| 226 | 3300046518 | Ga0495631_0021082 | Ga0495631_0021082_1385_2383 | 318 |
| 227 | 3300046522 | Ga0495643_0038445 | Ga0495643_0038445_1551_2549 | 318 |
| 228 | 3300046528 | Ga0495642_0013307 | Ga0495642_0013307_931_2016 | 318 |
| 229 | 3300046615 | Ga0495656_0001558 | Ga0495656_0001558_4454_5452 | 318 |
| 230 | 3300046691 | Ga0495670_0004847 | Ga0495670_0004847_2489_3487 | 318 |
| 231 | 3300047445 | Ga0495677_0056314 | Ga0495677_0056314_356_1354 | 318 |
| 232 | 3300048903 | Ga0496100_0218495 | Ga0496100_0218495_215_1213 | 318 |
| 233 | 3300048906 | Ga0496103_0034583 | Ga0496103_0034583_598_1596 | 318 |
| 234 | 3300048908 | Ga0496105_0032275 | Ga0496105_0032275_2312_3310 | 318 |
| 235 | 3300048910 | Ga0496107_0001017 | Ga0496107_0001017_10285_11283 | 318 |
| 236 | 3300048911 | Ga0496108_0155359 | Ga0496108_0155359_486_1484 | 318 |
| 237 | 3300048912 | Ga0496109_0178896 | Ga0496109_0178896_76_1074 | 318 |
| 238 | 3300048912 | Ga0496109_0321375 | Ga0496109_0321375_248_1246 | 318 |
| 239 | 3300048913 | Ga0496110_0057639 | Ga0496110_0057639_1186_2265 | 318 |
| 240 | 3300048914 | Ga0496111_0083198 | Ga0496111_0083198_1236_2315 | 318 |
| 241 | 3300048914 | Ga0496111_0158188 | Ga0496111_0158188_588_1586 | 318 |
| 242 | 3300048927 | Ga0496124_0059153 | Ga0496124_0059153_1595_2593 | 318 |
| 243 | 3300049569 | Ga0501032_0001192 | Ga0501032_0001192_8679_9677 | 318 |
| 244 | 3300049571 | Ga0501034_0000080 | Ga0501034_0000080_55354_56352 | 318 |
| 245 | 3300059424 | Ga0590075_017288 | Ga0590075_017288_12_1076 | 318 |
| 246 | iso_pu_bacteria | 2919059106 | 2919062839 | 318 |
| 247 | iso_pu_bacteria | 2939647034 | 2939651086 | 318 |
| 248 | iso_pu_bacteria | 8054107350 | 8054111903 | 318 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1g8s-assembly1.cif.gz_A-2 | methanococcus jannaschii fibrillarin pre-rrna processing protein | 0.8921 | 40 | 101 |
| 3mgg-assembly1.cif.gz_A | crystal structure of methyl transferase from methanosarcina mazei | 0.8842 | 40 | 94 |
| 1n2x-assembly1.cif.gz_A | crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam | 0.8724 | 14 | 312 |
| 1wg8-assembly2.cif.gz_B | crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. | 0.8716 | 14 | 313 |
| 3e05-assembly2.cif.gz_H | crystal structure of precorrin-6y c5,15-methyltransferase from geobacter metallireducens gs-15 | 0.8702 | 39 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9757 | 115 | 217 | 1.10.150.170 |
| 1wg8B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9565 | 115 | 217 | 1.10.150.170 |
| af_F7F172_184_294_1.10.150.170 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9476 | 119 | 217 | 1.10.150.170 |
| 3tkaA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain | 0.9468 | 115 | 217 | 1.10.150.170 |
| af_P9WJP1_66_380_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9403 | 15 | 311 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L6R716-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH (EC 2.1.1.199) | 0.9833 | 127 | 314 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A6L6R716-F1-model_v4 | 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH (EC 2.1.1.199) | 0.9731 | 127 | 314 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-X7ZWI6-F1-model_v4 | Ribosomal RNA small subunut methyltransferase H (EC 2.1.1.199) | 0.9648 | 131 | 311 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A2X3E5Y1-F1-model_v4 | rRNA small subunit methyltransferase H (EC 2.1.1.199) | 0.9596 | 122 | 219 |
GO:0005737
GO:0070475 GO:0071424 |
| AF-A0A6J6X9G2-F1-model_v4 | Unannotated protein | 0.959 | 129 | 314 |
GO:0005737
GO:0070475 GO:0071424 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar