F359555

General Info

Members Datasets Scaffolds Average Seq Length
248 199 211 318

Family's Representative Sequence

Representative Sequence 3300003762|Ga0055542_1002722|Ga0055542_10027225
Length 353
Sequence MGIWTKKHPSSTANPGKDAGMSDDSNQAKPTSERHVPVLKDRCINLLAPGFDAARRRGETPVVVDATLGMGGHSEAMLQRFPDLHLIGXDRDEEALALAGERLAPFADRTDLVHAVYDEXAEVIEDLGFSEVHGILMDLGVSSLQLDERDRGFAYSFDAPLDMRMDTSRGITAADVVNTYSEEDLVRIIRKWGEEKFAGRIANRIVAARAERPFTTTAQLVDTIRAVVPAGAAKSGGHPAKRTFQALRIEVNEELDVLERAIPAAVXSIALGGRVVVMSYHSLEDKIVKSVFQAGSKSSAPLGFPVELEEHKPELKTLTKGTEVPTAAEIAENPRAASARLRAVERIKARRDA

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
4 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
5 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
6 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
7 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
8 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
9 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
10 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
11 2857727296 Kocuria sp. R-72562 Isolate Unclassified
12 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
13 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
14 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
15 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
16 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
17 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
18 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
19 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
20 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
21 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
22 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
23 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
24 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
25 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
26 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
27 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
28 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
29 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
30 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
31 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
32 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
33 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
130 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
131 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
132 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
133 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
134 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
140 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
141 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
142 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
143 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
197 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
198 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
199 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.08
Metatranscriptomes 0
Isolates 14.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.03
Nodule 0
Rhizoplane 7.26
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001723 3300002773 Bacteria 8957
2 Ga0055542_1002722 3300003762 Bacteria 5401
3 Ga0070676_10022078 3300005328 Bacteria 3567
4 Ga0070677_10034026 3300005333 Bacteria 1966
5 Ga0070660_100182617 3300005339 Bacteria 1698
6 Ga0070692_10064798 3300005345 Unclassified 1933
7 Ga0070668_100319957 3300005347 Bacteria 1306
8 Ga0070669_100007140 3300005353 Bacteria 8026
9 Ga0070675_100045633 3300005354 Bacteria 3586
10 Ga0070673_100246939 3300005364 Bacteria 1554
11 Ga0070688_100015627 3300005365 Bacteria 4324
12 Ga0070667_100000228 3300005367 Bacteria 64501
13 Ga0070710_10165650 3300005437 Bacteria 1374
14 Ga0070678_100004024 3300005456 Bacteria 8272
15 Ga0070698_100013292 3300005471 Bacteria 8713
16 Ga0070699_100075745 3300005518 Bacteria 2929
17 Ga0070697_100000075 3300005536 Bacteria 79532
18 Ga0070696_100009580 3300005546 Bacteria 6478
19 Ga0070704_100008258 3300005549 Bacteria 6233
20 Ga0070704_100089567 3300005549 Bacteria 2289
21 Ga0068857_100363195 3300005577 Unclassified 1342
22 Ga0068864_100281901 3300005618 Bacteria 1551
23 Ga0068861_100003894 3300005719 Bacteria 9981
24 Ga0068870_10067964 3300005840 Bacteria 1935
25 Ga0068858_100599680 3300005842 Unclassified 1068
26 Ga0075364_10202260 3300006051 Bacteria 1346
27 Ga0075428_100013746 3300006844 Bacteria 9015
28 Ga0075428_100083378 3300006844 Unclassified 3488
29 Ga0075431_100005416 3300006847 Bacteria 12608
30 Ga0075429_100006233 3300006880 Bacteria 10323
31 Ga0105251_10037379 3300009011 Bacteria 2383
32 Ga0105244_10004700 3300009036 Bacteria 9303
33 Ga0105244_10008715 3300009036 Bacteria 6311
34 Ga0111539_10003359 3300009094 Bacteria 21129
35 Ga0114129_10003259 3300009147 Bacteria 22784
36 Ga0105243_10019175 3300009148 Bacteria 5186
37 Ga0105238_10093785 3300009551 Unclassified 2990
38 Ga0105249_10355372 3300009553 Bacteria 1485
39 Ga0105246_10001217 3300011119 Bacteria 15078
40 Ga0105246_10020780 3300011119 Bacteria 4216
41 Ga0157373_10017811 3300013100 Bacteria 5173
42 Ga0157371_10017570 3300013102 Bacteria 5310
43 Ga0157371_10072839 3300013102 Bacteria 2433
44 Ga0157370_10002619 3300013104 Bacteria 21643
45 Ga0157369_10046589 3300013105 Bacteria 4711
46 Ga0157369_10069714 3300013105 Bacteria 3777
47 Ga0163162_10048432 3300013306 Bacteria 4258
48 Ga0209148_1002215 3300025254 Bacteria 7146
49 Ga0209129_1000142 3300025258 Bacteria 116806
50 Ga0209025_1002705 3300025294 Bacteria 18045
51 Ga0209051_1003007 3300025303 Bacteria 11437
52 Ga0207697_10011135 3300025315 Bacteria 3812
53 Ga0207655_1001340 3300025728 Bacteria 23144
54 Ga0207655_1006100 3300025728 Bacteria 8044
55 Ga0207713_1041826 3300025735 Bacteria 1908
56 Ga0207692_10204431 3300025898 Bacteria 1163
57 Ga0207680_10073076 3300025903 Bacteria 2131
58 Ga0207645_10011801 3300025907 Bacteria 5950
59 Ga0207681_10080141 3300025923 Bacteria 2302
60 Ga0207694_10141666 3300025924 Bacteria 1934
61 Ga0207650_10041806 3300025925 Bacteria 3361
62 Ga0207644_10204897 3300025931 Bacteria 1557
63 Ga0207669_10139387 3300025937 Bacteria 1681
64 Ga0207691_10003148 3300025940 Bacteria 16133
65 Ga0207668_10121724 3300025972 Bacteria 1977
66 Ga0207658_10000024 3300025986 Bacteria 188273
67 Ga0207658_10256165 3300025986 Bacteria 1489
68 Ga0207675_100003814 3300026118 Bacteria 14671
69 Ga0207428_10011142 3300027907 Bacteria 7978
70 Ga0268264_10660835 3300028381 Bacteria 1035
71 Ga0265326_10007991 3300028558 Bacteria 3213
72 Ga0265334_10013767 3300028573 Bacteria 3381
73 Ga0265334_10019984 3300028573 Bacteria 2746
74 Ga0265318_10000858 3300028577 Bacteria 20003
75 Ga0265318_10003381 3300028577 Bacteria 8039
76 Ga0265322_10023109 3300028654 Bacteria 1778
77 Ga0265338_10069021 3300028800 Bacteria 3040
78 Ga0265330_10000745 3300031235 Bacteria 20548
79 Ga0265332_10009117 3300031238 Bacteria 4436
80 Ga0265320_10003505 3300031240 Bacteria 10519
81 Ga0265320_10012973 3300031240 Bacteria 4813
82 Ga0265325_10000817 3300031241 Bacteria 22571
83 Ga0265329_10010039 3300031242 Bacteria 3498
84 Ga0265340_10049885 3300031247 Bacteria 2031
85 Ga0265331_10056313 3300031250 Bacteria 1867
86 Ga0265327_10000021 3300031251 Bacteria 417788
87 Ga0265327_10020079 3300031251 Bacteria 4085
88 Ga0265316_10132827 3300031344 Bacteria 1874
89 Ga0307408_100001449 3300031548 Bacteria 17645
90 Ga0307408_100268949 3300031548 Bacteria 1414
91 Ga0265313_10004865 3300031595 Bacteria 10085
92 Ga0265313_10043676 3300031595 Bacteria 2193
93 Ga0265314_10034872 3300031711 Bacteria 3671
94 Ga0307405_10068881 3300031731 Bacteria 2266
95 Ga0307405_10120972 3300031731 Bacteria 1791
96 Ga0307405_10144379 3300031731 Bacteria 1664
97 Ga0307413_10037788 3300031824 Bacteria 2791
98 Ga0307413_10081800 3300031824 Bacteria 2072
99 Ga0307410_10026232 3300031852 Bacteria 3665
100 Ga0307410_10034553 3300031852 Bacteria 3275
101 Ga0307410_10067777 3300031852 Bacteria 2462
102 Ga0307410_10099796 3300031852 Bacteria 2079
103 Ga0307406_10123845 3300031901 Bacteria 1802
104 Ga0307407_10036231 3300031903 Bacteria 2717
105 Ga0307407_10114894 3300031903 Bacteria 1696
106 Ga0307412_10000868 3300031911 Bacteria 17366
107 Ga0307412_10088137 3300031911 Bacteria 2164
108 Ga0307412_10153235 3300031911 Bacteria 1703
109 Ga0307412_10260955 3300031911 Bacteria 1350
110 Ga0307409_100011897 3300031995 Bacteria 5514
111 Ga0307409_100015925 3300031995 Bacteria 4954
112 Ga0307409_100089454 3300031995 Bacteria 2517
113 Ga0307416_100134338 3300032002 Bacteria 2234
114 Ga0307416_100509700 3300032002 Bacteria 1269
115 Ga0307414_10002425 3300032004 Bacteria 9750
116 Ga0307414_10003653 3300032004 Bacteria 8243
117 Ga0307414_10040897 3300032004 Bacteria 3135
118 Ga0307411_10088238 3300032005 Bacteria 2156
119 Ga0307415_100130583 3300032126 Bacteria 1901
120 Ga0307415_100236837 3300032126 Bacteria 1474
121 Ga0395899_0121215 3300037312 Bacteria 1873
122 Ga0395899_0187019 3300037312 Bacteria 1451
123 Ga0395900_0030470 3300037418 Bacteria 5540
124 Ga0395900_0278830 3300037418 Bacteria 1664
125 Ga0395900_0280518 3300037418 Bacteria 1658
126 Ga0395898_0028565 3300037466 Bacteria 5589
127 Ga0395898_0317069 3300037466 Bacteria 1487
128 Ga0395901_0003390 3300038443 Bacteria 16045
129 Ga0395901_0025499 3300038443 Bacteria 6069
130 Ga0395901_0065402 3300038443 Bacteria 3786
131 Ga0395901_0178552 3300038443 Bacteria 2227
132 Ga0395901_0218110 3300038443 Bacteria 1994
133 Ga0439439_0000145 3300041406 Bacteria 10216
134 Ga0439461_0007661 3300041410 Bacteria 1919
135 Ga0439466_0000680 3300041411 Bacteria 12823
136 Ga0451791_0239299 3300041451 Bacteria 2204
137 Ga0451797_1159383 3300041453 Bacteria 1428
138 Ga0439433_0019675 3300041999 Bacteria 1505
139 Ga0439442_001528 3300042002 Bacteria 4537
140 Ga0439432_002221 3300042006 Bacteria 7325
141 Ga0439449_0002930 3300042007 Bacteria 6639
142 Ga0439452_001946 3300042010 Bacteria 7901
143 Ga0439462_0002957 3300042015 Bacteria 4025
144 Ga0450919_000060 3300042121 Bacteria 9866
145 Ga0450920_000737 3300042122 Bacteria 5269
146 Ga0450906_021433 3300042145 Bacteria 1155
147 Ga0450908_000874 3300042184 Bacteria 5819
148 Ga0450909_000012 3300042185 Bacteria 15117
149 Ga0439434_0003017 3300042435 Bacteria 4932
150 Ga0450918_000374 3300042531 Bacteria 9743
151 Ga0466972_0087893 3300044658 Bacteria 1476
152 Ga0466963_0137348 3300044694 Bacteria 1692
153 Ga0453684_0004209 3300044712 Bacteria 30919
154 Ga0451576_0379256 3300045051 Unclassified 1482
155 Ga0466967_0021242 3300045976 Bacteria 5266
156 Ga0466967_0221011 3300045976 Bacteria 1800
157 Ga0466967_0225911 3300045976 Bacteria 1781
158 Ga0495653_0112187 3300046463 Bacteria 1957
159 Ga0495580_0188272 3300046472 Bacteria 1424
160 Ga0495628_0004398 3300046516 Bacteria 12500
161 Ga0495631_0021082 3300046518 Bacteria 3037
162 Ga0495643_0038445 3300046522 Bacteria 2621
163 Ga0495642_0013307 3300046528 Bacteria 3181
164 Ga0495656_0001558 3300046615 Bacteria 7498
165 Ga0495634_0023402 3300046642 Bacteria 4343
166 Ga0495588_0036267 3300046674 Bacteria 2501
167 Ga0495647_0068870 3300046681 Bacteria 1412
168 Ga0495658_0077829 3300046683 Bacteria 1940
169 Ga0495613_0262096 3300046689 Bacteria 1204
170 Ga0495670_0004847 3300046691 Bacteria 6603
171 Ga0495581_0176103 3300047315 Bacteria 1250
172 Ga0495676_0091768 3300047321 Bacteria 2268
173 Ga0495677_0056314 3300047445 Bacteria 1452
174 Ga0495684_0002020 3300047471 Bacteria 16316
175 Ga0496100_0218495 3300048903 Bacteria 1397
176 Ga0496102_0262281 3300048905 Bacteria 1629
177 Ga0496103_0034583 3300048906 Bacteria 3090
178 Ga0496104_0497174 3300048907 Bacteria 1131
179 Ga0496105_0032275 3300048908 Bacteria 4296
180 Ga0496105_0062221 3300048908 Bacteria 3080
181 Ga0496107_0001017 3300048910 Bacteria 16749
182 Ga0496107_0290501 3300048910 Bacteria 1217
183 Ga0496108_0155359 3300048911 Bacteria 1975
184 Ga0496109_0178896 3300048912 Bacteria 1991
185 Ga0496109_0256130 3300048912 Bacteria 1648
186 Ga0496109_0321375 3300048912 Bacteria 1460
187 Ga0496110_0057639 3300048913 Bacteria 3419
188 Ga0496111_0083198 3300048914 Bacteria 2338
189 Ga0496111_0158188 3300048914 Bacteria 1681
190 Ga0496115_0368457 3300048918 Bacteria 1170
191 Ga0496124_0026527 3300048927 Bacteria 5221
192 Ga0496124_0059153 3300048927 Bacteria 3220
193 Ga0501032_0001192 3300049569 Bacteria 20813
194 Ga0501034_0000080 3300049571 Bacteria 170742
195 Ga0501038_0135209 3300049574 Bacteria 2021
196 Ga0501038_0264186 3300049574 Bacteria 1359
197 Ga0501040_0108445 3300049576 Bacteria 1941
198 Ga0501046_0225207 3300049580 Bacteria 1387
199 Ga0501074_0149057 3300049590 Bacteria 1673
200 Ga0501079_0245523 3300049741 Bacteria 1399
201 nmdc:mga00v17_229317_c1 3300050491 Bacteria 1203
202 nmdc:mga0yw44_128487_c1 3300050492 Bacteria 1638
203 nmdc:mga0yw44_135132_c1 3300050492 Bacteria 1599
204 nmdc:mga09592_57159_c1 3300050508 Unclassified 3297
205 nmdc:mga08y16_160223_c1 3300050511 Bacteria 2338
206 nmdc:mga08y16_86761_c1 3300050511 Bacteria 3261
207 Ga0495601_0346386 3300053077 Bacteria 966
208 Ga0495655_0008233 3300053083 Bacteria 1972
209 Ga0501084_0115222 3300054114 Bacteria 2259
210 Ga0590075_017288 3300059424 Bacteria 1777
211 Ga0501082_0052484 3300060353 Bacteria 3515

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_57159_c1 nmdc:mga09592_57159_c1_763_1557 245
2 3300028381 Ga0268264_10660835 Ga0268264_106608351 247
3 3300046689 Ga0495613_0262096 Ga0495613_0262096_202_1074 264
4 3300044658 Ga0466972_0087893 Ga0466972_0087893_609_1463 270
5 3300044694 Ga0466963_0137348 Ga0466963_0137348_56_1009 270
6 3300005471 Ga0070698_100013292 Ga0070698_1000132923 272
7 3300005536 Ga0070697_100000075 Ga0070697_10000007510 272
8 3300005549 Ga0070704_100008258 Ga0070704_1000082584 272
9 3300009147 Ga0114129_10003259 Ga0114129_1000325917 272
10 3300053077 Ga0495601_0346386 Ga0495601_0346386_67_945 273
11 3300009551 Ga0105238_10093785 Ga0105238_100937853 274
12 3300025924 Ga0207694_10141666 Ga0207694_101416661 274
13 3300048908 Ga0496105_0062221 Ga0496105_0062221_894_1853 274
14 3300006051 Ga0075364_10202260 Ga0075364_102022602 277
15 3300050491 nmdc:mga00v17_229317_c1 nmdc:mga00v17_229317_c1_29_916 277
16 3300050492 nmdc:mga0yw44_128487_c1 nmdc:mga0yw44_128487_c1_569_1456 277
17 3300009094 Ga0111539_10003359 Ga0111539_1000335918 278
18 3300050511 nmdc:mga08y16_160223_c1 nmdc:mga08y16_160223_c1_989_1879 278
19 3300009553 Ga0105249_10355372 Ga0105249_103553723 279
20 3300046642 Ga0495634_0023402 Ga0495634_0023402_675_1634 279
21 3300046683 Ga0495658_0077829 Ga0495658_0077829_349_1308 279
22 3300048910 Ga0496107_0290501 Ga0496107_0290501_228_1187 279
23 3300046472 Ga0495580_0188272 Ga0495580_0188272_199_1110 282
24 3300046674 Ga0495588_0036267 Ga0495588_0036267_849_1760 282
25 3300046681 Ga0495647_0068870 Ga0495647_0068870_118_1032 282
26 3300047321 Ga0495676_0091768 Ga0495676_0091768_463_1374 282
27 3300048912 Ga0496109_0256130 Ga0496109_0256130_228_1187 283
28 3300050492 nmdc:mga0yw44_135132_c1 nmdc:mga0yw44_135132_c1_422_1381 283
29 3300005345 Ga0070692_10064798 Ga0070692_100647983 284
30 3300005719 Ga0068861_100003894 Ga0068861_1000038942 284
31 3300005840 Ga0068870_10067964 Ga0068870_100679642 284
32 3300005842 Ga0068858_100599680 Ga0068858_1005996801 284
33 3300006844 Ga0075428_100083378 Ga0075428_1000833783 284
34 3300006847 Ga0075431_100005416 Ga0075431_1000054169 284
35 3300006880 Ga0075429_100006233 Ga0075429_1000062338 284
36 3300026118 Ga0207675_100003814 Ga0207675_10000381410 284
37 3300027907 Ga0207428_10011142 Ga0207428_100111424 284
38 3300005518 Ga0070699_100075745 Ga0070699_1000757453 285
39 3300005437 Ga0070710_10165650 Ga0070710_101656501 286
40 3300005546 Ga0070696_100009580 Ga0070696_1000095805 286
41 3300005549 Ga0070704_100089567 Ga0070704_1000895673 286
42 3300048905 Ga0496102_0262281 Ga0496102_0262281_676_1608 286
43 3300044712 Ga0453684_0004209 Ga0453684_0004209_4416_5327 287
44 3300045051 Ga0451576_0379256 Ga0451576_0379256_206_1117 287
45 3300028558 Ga0265326_10007991 Ga0265326_100079912 290
46 3300028573 Ga0265334_10013767 Ga0265334_100137673 290
47 3300028577 Ga0265318_10003381 Ga0265318_100033811 290
48 3300028800 Ga0265338_10069021 Ga0265338_100690213 290
49 3300031240 Ga0265320_10003505 Ga0265320_100035058 290
50 3300031250 Ga0265331_10056313 Ga0265331_100563133 290
51 3300031344 Ga0265316_10132827 Ga0265316_101328272 290
52 3300031595 Ga0265313_10043676 Ga0265313_100436762 290
53 3300049574 Ga0501038_0135209 Ga0501038_0135209_836_1795 290
54 3300049576 Ga0501040_0108445 Ga0501040_0108445_412_1371 290
55 3300049580 Ga0501046_0225207 Ga0501046_0225207_417_1376 290
56 3300049590 Ga0501074_0149057 Ga0501074_0149057_581_1540 290
57 3300049741 Ga0501079_0245523 Ga0501079_0245523_19_978 290
58 3300054114 Ga0501084_0115222 Ga0501084_0115222_1042_2001 290
59 3300060353 Ga0501082_0052484 Ga0501082_0052484_1756_2715 290
60 3300005367 Ga0070667_100000228 Ga0070667_1000002283 291
61 3300025986 Ga0207658_10000024 Ga0207658_10000024126 291
62 3300045976 Ga0466967_0021242 Ga0466967_0021242_1000_1986 291
63 3300025898 Ga0207692_10204431 Ga0207692_102044312 292
64 3300050511 nmdc:mga08y16_86761_c1 nmdc:mga08y16_86761_c1_1603_2538 292
65 3300047315 Ga0495581_0176103 Ga0495581_0176103_311_1234 293
66 3300048907 Ga0496104_0497174 Ga0496104_0497174_24_947 293
67 3300048918 Ga0496115_0368457 Ga0496115_0368457_223_1146 293
68 3300049574 Ga0501038_0264186 Ga0501038_0264186_67_990 293
69 3300005365 Ga0070688_100015627 Ga0070688_1000156274 294
70 iso_pu_bacteria 2751185734 2753070915 295
71 iso_pu_bacteria 2870721527 2870726507 295
72 3300028573 Ga0265334_10019984 Ga0265334_100199844 296
73 3300028577 Ga0265318_10000858 Ga0265318_1000085818 296
74 3300028654 Ga0265322_10023109 Ga0265322_100231091 296
75 3300031235 Ga0265330_10000745 Ga0265330_100007452 296
76 3300031238 Ga0265332_10009117 Ga0265332_100091173 296
77 3300031240 Ga0265320_10012973 Ga0265320_100129733 296
78 3300031241 Ga0265325_10000817 Ga0265325_100008174 296
79 3300031242 Ga0265329_10010039 Ga0265329_100100394 296
80 3300031247 Ga0265340_10049885 Ga0265340_100498851 296
81 3300031251 Ga0265327_10020079 Ga0265327_100200793 296
82 3300031595 Ga0265313_10004865 Ga0265313_100048654 296
83 3300031711 Ga0265314_10034872 Ga0265314_100348723 296
84 3300046463 Ga0495653_0112187 Ga0495653_0112187_56_1027 298
85 iso_pu_bacteria 8056667051 8056668567 298
86 3300005618 Ga0068864_100281901 Ga0068864_1002819013 299
87 3300006844 Ga0075428_100013746 Ga0075428_1000137467 299
88 3300031251 Ga0265327_10000021 Ga0265327_10000021156 299
89 3300046516 Ga0495628_0004398 Ga0495628_0004398_7657_8652 299
90 3300047471 Ga0495684_0002020 Ga0495684_0002020_14066_15061 299
91 3300042145 Ga0450906_021433 Ga0450906_021433_41_1033 301
92 iso_pu_bacteria 2857727296 2857728675 302
93 3300005339 Ga0070660_100182617 Ga0070660_1001826172 304
94 3300005577 Ga0068857_100363195 Ga0068857_1003631952 304
95 iso_pu_bacteria 2884994152 2884995125 307
96 3300048927 Ga0496124_0026527 Ga0496124_0026527_4185_5186 308
97 iso_pu_bacteria 2643221694 2644526592 308
98 iso_pu_bacteria 2643221722 2644671258 308
99 iso_pu_bacteria 2643221690 2644506490 309
100 3300013105 Ga0157369_10046589 Ga0157369_100465894 311
101 3300045976 Ga0466967_0225911 Ga0466967_0225911_700_1680 311
102 iso_pu_bacteria 2537561592 2537900166 311
103 iso_pu_bacteria 2808606700 2810365623 311
104 iso_pu_bacteria 2905926851 2905927015 311
105 iso_pu_bacteria 2946003308 2946004130 311
106 iso_pu_bacteria 2808606370 2808890748 312
107 iso_pu_bacteria 2808606371 2808896028 312
108 iso_pu_bacteria 2939598168 2939600127 312
109 iso_pu_bacteria 2945920336 2945920389 312
110 iso_pu_bacteria 2945941187 2945943672 312
111 iso_pu_bacteria 2946037020 2946039645 312
112 iso_pu_bacteria 2953998280 2954000870 312
113 iso_pu_bacteria 2974302888 2974303139 312
114 3300041451 Ga0451791_0239299 Ga0451791_0239299_490_1530 313
115 3300041453 Ga0451797_1159383 Ga0451797_1159383_194_1234 313
116 iso_pu_bacteria 2523231044 2523386886 314
117 iso_pu_bacteria 2844849076 2844852388 314
118 iso_pu_bacteria 2857740372 2857744416 314
119 iso_pu_bacteria 2904497146 2904501058 314
120 iso_pu_bacteria 2904776348 2904778043 314
121 iso_pu_bacteria 2910809715 2910812208 314
122 iso_pu_bacteria 2919034639 2919038848 314
123 iso_pu_bacteria 2919391150 2919393360 314
124 iso_pu_bacteria 2919538618 2919542581 314
125 iso_pu_bacteria 2932426870 2932430510 314
126 iso_pu_bacteria 2933418574 2933421701 314
127 iso_pu_bacteria 2939674588 2939678871 314
128 iso_pu_bacteria 8004021418 8004024134 314
129 iso_pu_bacteria 8004025490 8004026311 314
130 3300031824 Ga0307413_10081800 Ga0307413_100818002 315
131 3300031852 Ga0307410_10099796 Ga0307410_100997963 315
132 3300031995 Ga0307409_100015925 Ga0307409_1000159253 315
133 3300032004 Ga0307414_10003653 Ga0307414_100036537 315
134 3300032126 Ga0307415_100130583 Ga0307415_1001305832 315
135 3300032126 Ga0307415_100236837 Ga0307415_1002368372 315
136 3300045976 Ga0466967_0221011 Ga0466967_0221011_578_1567 315
137 3300053083 Ga0495655_0008233 Ga0495655_0008233_890_1879 315
138 3300011119 Ga0105246_10020780 Ga0105246_100207802 316
139 3300031548 Ga0307408_100001449 Ga0307408_10000144910 316
140 3300031731 Ga0307405_10068881 Ga0307405_100688812 316
141 3300031731 Ga0307405_10144379 Ga0307405_101443792 316
142 3300031824 Ga0307413_10037788 Ga0307413_100377883 316
143 3300031852 Ga0307410_10067777 Ga0307410_100677772 316
144 3300031901 Ga0307406_10123845 Ga0307406_101238451 316
145 3300031903 Ga0307407_10036231 Ga0307407_100362312 316
146 3300031911 Ga0307412_10000868 Ga0307412_1000086816 316
147 3300031911 Ga0307412_10153235 Ga0307412_101532352 316
148 3300032002 Ga0307416_100134338 Ga0307416_1001343382 316
149 3300032002 Ga0307416_100509700 Ga0307416_1005097002 316
150 3300032004 Ga0307414_10002425 Ga0307414_100024253 316
151 3300032005 Ga0307411_10088238 Ga0307411_100882382 316
152 3300037312 Ga0395899_0121215 Ga0395899_0121215_639_1631 316
153 3300037418 Ga0395900_0280518 Ga0395900_0280518_121_1113 316
154 3300037466 Ga0395898_0317069 Ga0395898_0317069_33_1025 316
155 3300038443 Ga0395901_0065402 Ga0395901_0065402_2222_3214 316
156 3300038443 Ga0395901_0218110 Ga0395901_0218110_776_1768 316
157 3300011119 Ga0105246_10001217 Ga0105246_100012172 317
158 3300031852 Ga0307410_10026232 Ga0307410_100262323 317
159 3300002773 JGI25152J39213_1001723 JGI25152J39213_10017232 318
160 3300003762 Ga0055542_1002722 Ga0055542_10027225 318
161 3300005328 Ga0070676_10022078 Ga0070676_100220782 318
162 3300005333 Ga0070677_10034026 Ga0070677_100340262 318
163 3300005347 Ga0070668_100319957 Ga0070668_1003199572 318
164 3300005353 Ga0070669_100007140 Ga0070669_1000071406 318
165 3300005354 Ga0070675_100045633 Ga0070675_1000456334 318
166 3300005364 Ga0070673_100246939 Ga0070673_1002469391 318
167 3300005456 Ga0070678_100004024 Ga0070678_1000040242 318
168 3300009011 Ga0105251_10037379 Ga0105251_100373793 318
169 3300009036 Ga0105244_10004700 Ga0105244_100047004 318
170 3300009036 Ga0105244_10008715 Ga0105244_100087155 318
171 3300009148 Ga0105243_10019175 Ga0105243_100191756 318
172 3300013100 Ga0157373_10017811 Ga0157373_100178114 318
173 3300013102 Ga0157371_10017570 Ga0157371_100175704 318
174 3300013102 Ga0157371_10072839 Ga0157371_100728392 318
175 3300013104 Ga0157370_10002619 Ga0157370_100026196 318
176 3300013105 Ga0157369_10069714 Ga0157369_100697144 318
177 3300013306 Ga0163162_10048432 Ga0163162_100484322 318
178 3300025254 Ga0209148_1002215 Ga0209148_10022153 318
179 3300025258 Ga0209129_1000142 Ga0209129_100014271 318
180 3300025294 Ga0209025_1002705 Ga0209025_100270515 318
181 3300025303 Ga0209051_1003007 Ga0209051_10030077 318
182 3300025315 Ga0207697_10011135 Ga0207697_100111352 318
183 3300025728 Ga0207655_1001340 Ga0207655_10013403 318
184 3300025728 Ga0207655_1006100 Ga0207655_10061005 318
185 3300025735 Ga0207713_1041826 Ga0207713_10418263 318
186 3300025903 Ga0207680_10073076 Ga0207680_100730762 318
187 3300025907 Ga0207645_10011801 Ga0207645_100118013 318
188 3300025923 Ga0207681_10080141 Ga0207681_100801413 318
189 3300025925 Ga0207650_10041806 Ga0207650_100418062 318
190 3300025931 Ga0207644_10204897 Ga0207644_102048972 318
191 3300025937 Ga0207669_10139387 Ga0207669_101393872 318
192 3300025940 Ga0207691_10003148 Ga0207691_100031488 318
193 3300025972 Ga0207668_10121724 Ga0207668_101217241 318
194 3300025986 Ga0207658_10256165 Ga0207658_102561651 318
195 3300031548 Ga0307408_100268949 Ga0307408_1002689492 318
196 3300031731 Ga0307405_10120972 Ga0307405_101209722 318
197 3300031852 Ga0307410_10034553 Ga0307410_100345531 318
198 3300031903 Ga0307407_10114894 Ga0307407_101148942 318
199 3300031911 Ga0307412_10088137 Ga0307412_100881372 318
200 3300031911 Ga0307412_10260955 Ga0307412_102609551 318
201 3300031995 Ga0307409_100011897 Ga0307409_1000118974 318
202 3300031995 Ga0307409_100089454 Ga0307409_1000894542 318
203 3300032004 Ga0307414_10040897 Ga0307414_100408974 318
204 3300037312 Ga0395899_0187019 Ga0395899_0187019_67_1095 318
205 3300037418 Ga0395900_0030470 Ga0395900_0030470_3244_4272 318
206 3300037418 Ga0395900_0278830 Ga0395900_0278830_144_1145 318
207 3300037466 Ga0395898_0028565 Ga0395898_0028565_3185_4213 318
208 3300038443 Ga0395901_0003390 Ga0395901_0003390_13559_14560 318
209 3300038443 Ga0395901_0025499 Ga0395901_0025499_4021_5049 318
210 3300038443 Ga0395901_0178552 Ga0395901_0178552_650_1648 318
211 3300041406 Ga0439439_0000145 Ga0439439_0000145_7511_8509 318
212 3300041410 Ga0439461_0007661 Ga0439461_0007661_237_1235 318
213 3300041411 Ga0439466_0000680 Ga0439466_0000680_7764_8762 318
214 3300041999 Ga0439433_0019675 Ga0439433_0019675_62_1060 318
215 3300042002 Ga0439442_001528 Ga0439442_001528_248_1246 318
216 3300042006 Ga0439432_002221 Ga0439432_002221_378_1376 318
217 3300042007 Ga0439449_0002930 Ga0439449_0002930_1580_2578 318
218 3300042010 Ga0439452_001946 Ga0439452_001946_4369_5367 318
219 3300042015 Ga0439462_0002957 Ga0439462_0002957_2175_3173 318
220 3300042121 Ga0450919_000060 Ga0450919_000060_8135_9133 318
221 3300042122 Ga0450920_000737 Ga0450920_000737_852_1850 318
222 3300042184 Ga0450908_000874 Ga0450908_000874_852_1850 318
223 3300042185 Ga0450909_000012 Ga0450909_000012_7335_8333 318
224 3300042435 Ga0439434_0003017 Ga0439434_0003017_92_1090 318
225 3300042531 Ga0450918_000374 Ga0450918_000374_853_1851 318
226 3300046518 Ga0495631_0021082 Ga0495631_0021082_1385_2383 318
227 3300046522 Ga0495643_0038445 Ga0495643_0038445_1551_2549 318
228 3300046528 Ga0495642_0013307 Ga0495642_0013307_931_2016 318
229 3300046615 Ga0495656_0001558 Ga0495656_0001558_4454_5452 318
230 3300046691 Ga0495670_0004847 Ga0495670_0004847_2489_3487 318
231 3300047445 Ga0495677_0056314 Ga0495677_0056314_356_1354 318
232 3300048903 Ga0496100_0218495 Ga0496100_0218495_215_1213 318
233 3300048906 Ga0496103_0034583 Ga0496103_0034583_598_1596 318
234 3300048908 Ga0496105_0032275 Ga0496105_0032275_2312_3310 318
235 3300048910 Ga0496107_0001017 Ga0496107_0001017_10285_11283 318
236 3300048911 Ga0496108_0155359 Ga0496108_0155359_486_1484 318
237 3300048912 Ga0496109_0178896 Ga0496109_0178896_76_1074 318
238 3300048912 Ga0496109_0321375 Ga0496109_0321375_248_1246 318
239 3300048913 Ga0496110_0057639 Ga0496110_0057639_1186_2265 318
240 3300048914 Ga0496111_0083198 Ga0496111_0083198_1236_2315 318
241 3300048914 Ga0496111_0158188 Ga0496111_0158188_588_1586 318
242 3300048927 Ga0496124_0059153 Ga0496124_0059153_1595_2593 318
243 3300049569 Ga0501032_0001192 Ga0501032_0001192_8679_9677 318
244 3300049571 Ga0501034_0000080 Ga0501034_0000080_55354_56352 318
245 3300059424 Ga0590075_017288 Ga0590075_017288_12_1076 318
246 iso_pu_bacteria 2919059106 2919062839 318
247 iso_pu_bacteria 2939647034 2939651086 318
248 iso_pu_bacteria 8054107350 8054111903 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

32

347

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g8s-assembly1.cif.gz_A-2 methanococcus jannaschii fibrillarin pre-rrna processing protein 0.8921 40 101
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8842 40 94
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8724 14 312
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.8716 14 313
3e05-assembly2.cif.gz_H crystal structure of precorrin-6y c5,15-methyltransferase from geobacter metallireducens gs-15 0.8702 39 95
ID Description Score Start End Superfamily
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9757 115 217 1.10.150.170
1wg8B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9565 115 217 1.10.150.170
af_F7F172_184_294_1.10.150.170 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9476 119 217 1.10.150.170
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9468 115 217 1.10.150.170
af_P9WJP1_66_380_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9403 15 311 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6L6R716-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH (EC 2.1.1.199) 0.9833 127 314 GO:0005737
GO:0070475
GO:0071424
AF-A0A6L6R716-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH (EC 2.1.1.199) 0.9731 127 314 GO:0005737
GO:0070475
GO:0071424
AF-X7ZWI6-F1-model_v4 Ribosomal RNA small subunut methyltransferase H (EC 2.1.1.199) 0.9648 131 311 GO:0005737
GO:0070475
GO:0071424
AF-A0A2X3E5Y1-F1-model_v4 rRNA small subunit methyltransferase H (EC 2.1.1.199) 0.9596 122 219 GO:0005737
GO:0070475
GO:0071424
AF-A0A6J6X9G2-F1-model_v4 Unannotated protein 0.959 129 314 GO:0005737
GO:0070475
GO:0071424

Feature Viewer

pLDDT pTM Quality
79.96 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map