F359538

General Info

Members Datasets Scaffolds Average Seq Length
248 185 240 145

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10067252|JGI25406J46586_100672522
Length 152
Sequence MLRDDINAALKDAMKAKDQPRVATLRLINAAIQSAEIDLRDGNKLSEDALLGVLQKMIKQRQESLDIYQKAGREELAAKERAEIEIISGYLPKQMSEDEAKAAIAAVVVVKEINAQSVKDMGKVMAALKERFAGKMDFGKASGVVKSLLSGG

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
6 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
7 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
150 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
151 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
152 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
153 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
154 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
155 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
156 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
157 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
158 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
170 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
171 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
172 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
173 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
177 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
178 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
181 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
182 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
183 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.37
Metatranscriptomes 0.4
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.89
Nodule 0
Rhizoplane 6.05
Rhizosphere 77.42
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004258 3300001989 Bacteria 5479
2 JGI24737J22298_10057395 3300001990 Bacteria 1175
3 JGI24738J21930_10152215 3300002075 Bacteria 514
4 JGI24034J26672_10093186 3300002239 Bacteria 561
5 JGI25406J46586_10067252 3300003203 Bacteria 1135
6 Ga0065707_10136989 3300005295 Bacteria 1826
7 Ga0070670_100010644 3300005331 Bacteria 7857
8 Ga0070670_100137775 3300005331 Bacteria 2109
9 Ga0070666_10102567 3300005335 Bacteria 1973
10 Ga0070666_10145195 3300005335 Bacteria 1654
11 Ga0070668_100000100 3300005347 Bacteria 52736
12 Ga0070668_100430056 3300005347 Bacteria 1131
13 Ga0070669_100147967 3300005353 Bacteria 1816
14 Ga0070669_101022325 3300005353 Bacteria 710
15 Ga0070675_100429837 3300005354 Bacteria 1182
16 Ga0070671_100000131 3300005355 Bacteria 48521
17 Ga0070671_100138568 3300005355 Bacteria 2052
18 Ga0070671_100377092 3300005355 Bacteria 1212
19 Ga0070667_100000004 3300005367 Bacteria 444091
20 Ga0070667_100000397 3300005367 Bacteria 47063
21 Ga0070667_100142471 3300005367 Bacteria 2100
22 Ga0070694_100687194 3300005444 Bacteria 831
23 Ga0070663_100049586 3300005455 Bacteria 2982
24 Ga0070663_100174080 3300005455 Bacteria 1665
25 Ga0070662_100397020 3300005457 Bacteria 1137
26 Ga0070672_100145835 3300005543 Bacteria 1956
27 Ga0070665_100420175 3300005548 Bacteria 1346
28 Ga0070665_101275215 3300005548 Bacteria 745
29 Ga0070664_100237315 3300005564 Bacteria 1636
30 Ga0068857_100096732 3300005577 Bacteria 2646
31 Ga0068857_100559145 3300005577 Bacteria 1078
32 Ga0068857_100608278 3300005577 Bacteria 1033
33 Ga0068854_100025897 3300005578 Bacteria 4026
34 Ga0068852_100174362 3300005616 Bacteria 2018
35 Ga0068852_100326373 3300005616 Bacteria 1492
36 Ga0068859_100079726 3300005617 Bacteria 3315
37 Ga0068859_101267779 3300005617 Bacteria 812
38 Ga0068851_10055591 3300005834 Bacteria 2016
39 Ga0068863_100001017 3300005841 Bacteria 28079
40 Ga0068863_100016200 3300005841 Bacteria 7151
41 Ga0068863_100091062 3300005841 Bacteria 2892
42 Ga0068858_100001674 3300005842 Bacteria 22661
43 Ga0068860_100000002 3300005843 Bacteria 627849
44 Ga0068860_100000521 3300005843 Bacteria 47063
45 Ga0068862_100000336 3300005844 Bacteria 51088
46 Ga0068862_101821827 3300005844 Bacteria 618
47 Ga0081539_10013456 3300005985 Bacteria 6162
48 Ga0075364_10511364 3300006051 Bacteria 821
49 Ga0070716_100559393 3300006173 Bacteria 854
50 Ga0075366_10235497 3300006195 Bacteria 1116
51 Ga0075370_10009108 3300006353 Bacteria 5136
52 Ga0068871_101668601 3300006358 Bacteria 604
53 Ga0075434_100212130 3300006871 Bacteria 1956
54 Ga0097620_100079726 3300006931 Bacteria 3315
55 Ga0097620_101268165 3300006931 Bacteria 812
56 Ga0114129_10774805 3300009147 Bacteria 1226
57 Ga0114129_10848427 3300009147 Bacteria 1161
58 Ga0105241_10175571 3300009174 Bacteria 1773
59 Ga0105241_10479288 3300009174 Bacteria 1106
60 Ga0105248_10048772 3300009177 Bacteria 4750
61 Ga0105237_10144070 3300009545 Bacteria 2377
62 Ga0105237_10249019 3300009545 Bacteria 1778
63 Ga0105238_10599743 3300009551 Bacteria 1109
64 Ga0105238_10668874 3300009551 Bacteria 1049
65 Ga0105249_10130614 3300009553 Bacteria 2398
66 Ga0157326_1000164 3300012513 Bacteria 7233
67 Ga0157373_10106355 3300013100 Bacteria 1973
68 Ga0157372_10458130 3300013307 Bacteria 1486
69 Ga0163163_10317523 3300014325 Bacteria 1611
70 Ga0213876_10008172 3300021384 Bacteria 5665
71 Ga0207697_10062619 3300025315 Bacteria 1549
72 Ga0207656_10242995 3300025321 Bacteria 880
73 Ga0207710_10058659 3300025900 Bacteria 1741
74 Ga0207688_10678705 3300025901 Bacteria 651
75 Ga0207680_10122127 3300025903 Bacteria 1705
76 Ga0207680_10501074 3300025903 Bacteria 865
77 Ga0207647_10072183 3300025904 Bacteria 2082
78 Ga0207705_10569960 3300025909 Bacteria 880
79 Ga0207654_10544360 3300025911 Bacteria 824
80 Ga0207671_10119554 3300025914 Bacteria 2013
81 Ga0207657_10065972 3300025919 Bacteria 3083
82 Ga0207681_10092875 3300025923 Bacteria 2158
83 Ga0207681_10229623 3300025923 Bacteria 1440
84 Ga0207681_11096635 3300025923 Bacteria 668
85 Ga0207694_10394394 3300025924 Bacteria 1150
86 Ga0207694_10484040 3300025924 Bacteria 1035
87 Ga0207650_10001083 3300025925 Bacteria 20152
88 Ga0207650_10069862 3300025925 Bacteria 2639
89 Ga0207659_10243498 3300025926 Bacteria 1456
90 Ga0207659_10746159 3300025926 Bacteria 840
91 Ga0207644_10000173 3300025931 Bacteria 45985
92 Ga0207644_11087953 3300025931 Bacteria 672
93 Ga0207690_10163942 3300025932 Bacteria 1659
94 Ga0207706_10165820 3300025933 Bacteria 1941
95 Ga0207686_10606447 3300025934 Bacteria 862
96 Ga0207709_10298874 3300025935 Bacteria 1196
97 Ga0207691_10219385 3300025940 Bacteria 1649
98 Ga0207661_11131127 3300025944 Bacteria 721
99 Ga0207679_10165158 3300025945 Bacteria 1817
100 Ga0207667_10003607 3300025949 Bacteria 19102
101 Ga0207712_10076744 3300025961 Bacteria 2420
102 Ga0207712_11709069 3300025961 Bacteria 564
103 Ga0207668_10000008 3300025972 Bacteria 189904
104 Ga0207668_11157357 3300025972 Bacteria 694
105 Ga0207658_10000002 3300025986 Bacteria 1364188
106 Ga0207658_10000335 3300025986 Bacteria 47117
107 Ga0207658_11845600 3300025986 Bacteria 551
108 Ga0207658_11972822 3300025986 Bacteria 531
109 Ga0207703_10003388 3300026035 Bacteria 13383
110 Ga0207678_10064521 3300026067 Bacteria 3146
111 Ga0207678_10077558 3300026067 Bacteria 2846
112 Ga0207641_10000342 3300026088 Bacteria 56068
113 Ga0207641_10003824 3300026088 Bacteria 13187
114 Ga0207641_10008823 3300026088 Bacteria 8325
115 Ga0207641_10074453 3300026088 Bacteria 2929
116 Ga0207674_10047840 3300026116 Bacteria 4382
117 Ga0207674_10055155 3300026116 Bacteria 4042
118 Ga0207674_10203810 3300026116 Bacteria 1927
119 Ga0207675_100086857 3300026118 Bacteria 2937
120 Ga0207698_10114181 3300026142 Bacteria 2271
121 Ga0207698_10142296 3300026142 Bacteria 2069
122 Ga0207698_10582942 3300026142 Bacteria 1100
123 Ga0209813_10201628 3300027866 Bacteria 737
124 Ga0209974_10023726 3300027876 Bacteria 2030
125 Ga0268266_10717129 3300028379 Bacteria 964
126 Ga0268265_10003708 3300028380 Bacteria 10875
127 Ga0268264_10000001 3300028381 Bacteria 1221000
128 Ga0268264_10000324 3300028381 Bacteria 75484
129 Ga0268264_10326476 3300028381 Bacteria 1453
130 Ga0307408_100411282 3300031548 Bacteria 1164
131 Ga0307405_10164771 3300031731 Bacteria 1574
132 Ga0307405_10237733 3300031731 Bacteria 1347
133 Ga0307405_10536620 3300031731 Bacteria 944
134 Ga0307413_10040871 3300031824 Bacteria 2710
135 Ga0307413_10477709 3300031824 Bacteria 995
136 Ga0307410_10073314 3300031852 Bacteria 2380
137 Ga0307410_11782594 3300031852 Bacteria 546
138 Ga0307406_10020845 3300031901 Bacteria 3868
139 Ga0307406_10220411 3300031901 Bacteria 1409
140 Ga0307407_10291430 3300031903 Bacteria 1134
141 Ga0307412_10061360 3300031911 Bacteria 2527
142 Ga0307412_10523639 3300031911 Bacteria 991
143 Ga0307412_10682597 3300031911 Bacteria 879
144 Ga0307416_100164047 3300032002 Bacteria 2058
145 Ga0307416_102030636 3300032002 Bacteria 677
146 Ga0307414_10035190 3300032004 Bacteria 3330
147 Ga0307411_10202566 3300032005 Bacteria 1525
148 Ga0307411_10268982 3300032005 Bacteria 1350
149 Ga0307415_100591625 3300032126 Bacteria 986
150 Ga0373925_0476945 3300037068 Bacteria 1023
151 Ga0436365_1242187 3300039437 Bacteria 8691
152 Ga0436365_1909513 3300039437 Bacteria 15386
153 Ga0436363_0137459 3300039450 Bacteria 532
154 Ga0436362_0238977 3300039453 Bacteria 622
155 Ga0451797_0448939 3300041453 Bacteria 995
156 Ga0451853_3898491 3300041512 Bacteria 571
157 Ga0466970_0348766 3300044765 Bacteria 840
158 Ga0466959_0422922 3300045049 Bacteria 904
159 Ga0495638_0238214 3300046460 Bacteria 1009
160 Ga0495594_0019661 3300046499 Bacteria 3592
161 Ga0495610_0101075 3300046512 Bacteria 1292
162 Ga0495637_0073431 3300046520 Bacteria 1376
163 Ga0495643_0057673 3300046522 Bacteria 2069
164 Ga0495643_0100986 3300046522 Bacteria 1478
165 Ga0495654_0001789 3300046530 Bacteria 14325
166 Ga0495597_0043635 3300046542 Bacteria 1996
167 Ga0495597_0056033 3300046542 Bacteria 1727
168 Ga0495668_0239096 3300046616 Bacteria 994
169 Ga0495625_0056978 3300046660 Bacteria 2780
170 Ga0495687_016403 3300047443 Bacteria 3726
171 Ga0495685_064655 3300047447 Bacteria 1230
172 Ga0495686_0009402 3300047472 Bacteria 7044
173 Ga0495686_0026927 3300047472 Bacteria 3758
174 Ga0495615_0049454 3300048090 Bacteria 1078
175 Ga0495626_0039361 3300048091 Bacteria 2238
176 Ga0496101_0547179 3300048904 Bacteria 915
177 Ga0496101_0864994 3300048904 Bacteria 712
178 Ga0496102_0122881 3300048905 Bacteria 2425
179 Ga0496103_0184908 3300048906 Bacteria 1339
180 Ga0496104_1139563 3300048907 Bacteria 683
181 Ga0496105_0264497 3300048908 Bacteria 1390
182 Ga0496106_0300015 3300048909 Bacteria 1288
183 Ga0496107_0303265 3300048910 Bacteria 1189
184 Ga0496108_0173367 3300048911 Bacteria 1867
185 Ga0496109_0589969 3300048912 Bacteria 1047
186 Ga0496110_0387359 3300048913 Bacteria 1274
187 Ga0496112_0149607 3300048915 Bacteria 2302
188 Ga0496113_0287823 3300048916 Bacteria 1314
189 Ga0496115_0460203 3300048918 Bacteria 1026
190 Ga0496118_0355245 3300048921 Bacteria 779
191 Ga0496121_0183016 3300048924 Bacteria 1510
192 Ga0496124_0443204 3300048927 Bacteria 888
193 Ga0496125_0037463 3300048928 Bacteria 4216
194 Ga0501306_086700 3300049127 Bacteria 546
195 Ga0501290_061033 3300049513 Bacteria 607
196 Ga0501034_0040075 3300049571 Bacteria 4743
197 Ga0501036_0750354 3300049572 Bacteria 805
198 Ga0501043_0021424 3300049579 Bacteria 5067
199 Ga0501046_0306705 3300049580 Bacteria 1158
200 Ga0501047_0002625 3300049581 Bacteria 17104
201 Ga0501207_014752 3300049654 Bacteria 1196
202 Ga0501227_215052 3300049665 Bacteria 546
203 Ga0501240_044884 3300049673 Bacteria 744
204 Ga0501249_000133 3300049679 Bacteria 23209
205 Ga0501256_010401 3300049685 Bacteria 888
206 Ga0501257_000089 3300049686 Bacteria 22034
207 Ga0501268_016960 3300049765 Bacteria 1211
208 Ga0501273_013841 3300049770 Bacteria 1033
209 Ga0501280_082012 3300049776 Bacteria 594
210 Ga0501283_017770 3300049779 Bacteria 1115
211 Ga0501035_0007097 3300049822 Bacteria 10475
212 Ga0501044_0183848 3300049823 Bacteria 2056
213 Ga0501045_1085735 3300049824 Bacteria 586
214 nmdc:mga00v17_225004_c1 3300050491 Bacteria 1215
215 nmdc:mga0k408_115225_c1 3300050493 Bacteria 1590
216 nmdc:mga05p37_625341_c1 3300050507 Bacteria 1211
217 nmdc:mga0n895_311621_c1 3300050512 Bacteria 1595
218 nmdc:mga0a205_1104888_c1 3300050515 Bacteria 640
219 Ga0500643_000166 3300053087 Bacteria 65586
220 Ga0500643_001817 3300053087 Bacteria 11670
221 Ga0500641_0013911 3300053096 Bacteria 2962
222 Ga0500592_000160 3300053116 Bacteria 13568
223 Ga0500592_001757 3300053116 Bacteria 3508
224 Ga0500595_095917 3300053119 Bacteria 854
225 Ga0500614_011259 3300053123 Bacteria 1933
226 Ga0500642_0014282 3300053130 Bacteria 2949
227 Ga0500655_000590 3300053133 Bacteria 7291
228 Ga0500658_0253112 3300053134 Bacteria 809
229 Ga0500559_0146215 3300053136 Bacteria 1108
230 Ga0500564_165694 3300053138 Bacteria 932
231 Ga0500590_003281 3300053148 Bacteria 7418
232 Ga0500604_0234847 3300053151 Bacteria 633
233 Ga0500622_0019856 3300053156 Bacteria 3567
234 Ga0500627_0000268 3300053158 Bacteria 14730
235 Ga0500627_0000324 3300053158 Bacteria 13062
236 Ga0500627_0055396 3300053158 Bacteria 1736
237 Ga0500639_208685 3300053163 Bacteria 830
238 Ga0500570_017325 3300053724 Bacteria 4033
239 Ga0500645_059217 3300053730 Bacteria 1109
240 Ga0501082_1589541 3300060353 Bacteria 571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0040075 Ga0501034_0040075_4356_4733 109
2 3300050507 nmdc:mga05p37_625341_c1 nmdc:mga05p37_625341_c1_819_1196 124
3 3300002075 JGI24738J21930_10152215 JGI24738J21930_101522151 126
4 3300002239 JGI24034J26672_10093186 JGI24034J26672_100931861 126
5 3300005331 Ga0070670_100137775 Ga0070670_1001377752 126
6 3300005347 Ga0070668_100430056 Ga0070668_1004300562 126
7 3300005354 Ga0070675_100429837 Ga0070675_1004298372 126
8 3300005367 Ga0070667_100142471 Ga0070667_1001424712 126
9 3300005455 Ga0070663_100049586 Ga0070663_1000495863 126
10 3300005548 Ga0070665_100420175 Ga0070665_1004201752 126
11 3300005577 Ga0068857_100559145 Ga0068857_1005591451 126
12 3300006353 Ga0075370_10009108 Ga0075370_100091084 126
13 3300009174 Ga0105241_10175571 Ga0105241_101755712 126
14 3300009545 Ga0105237_10144070 Ga0105237_101440703 126
15 3300014325 Ga0163163_10317523 Ga0163163_103175232 126
16 3300025315 Ga0207697_10062619 Ga0207697_100626192 126
17 3300025900 Ga0207710_10058659 Ga0207710_100586591 126
18 3300025901 Ga0207688_10678705 Ga0207688_106787051 126
19 3300025904 Ga0207647_10072183 Ga0207647_100721833 126
20 3300025911 Ga0207654_10544360 Ga0207654_105443602 126
21 3300025923 Ga0207681_10229623 Ga0207681_102296231 126
22 3300025924 Ga0207694_10394394 Ga0207694_103943941 126
23 3300025925 Ga0207650_10069862 Ga0207650_100698623 126
24 3300025926 Ga0207659_10746159 Ga0207659_107461591 126
25 3300025931 Ga0207644_11087953 Ga0207644_110879531 126
26 3300025933 Ga0207706_10165820 Ga0207706_101658203 126
27 3300025934 Ga0207686_10606447 Ga0207686_106064471 126
28 3300025935 Ga0207709_10298874 Ga0207709_102988742 126
29 3300025961 Ga0207712_11709069 Ga0207712_117090691 126
30 3300025972 Ga0207668_11157357 Ga0207668_111573571 126
31 3300025986 Ga0207658_11845600 Ga0207658_118456001 126
32 3300026067 Ga0207678_10077558 Ga0207678_100775583 126
33 3300026116 Ga0207674_10203810 Ga0207674_102038101 126
34 3300027866 Ga0209813_10201628 Ga0209813_102016281 126
35 3300028379 Ga0268266_10717129 Ga0268266_107171292 126
36 3300028381 Ga0268264_10326476 Ga0268264_103264762 126
37 3300046512 Ga0495610_0101075 Ga0495610_0101075_25_480 126
38 3300046522 Ga0495643_0100986 Ga0495643_0100986_741_1196 126
39 3300046542 Ga0495597_0043635 Ga0495597_0043635_993_1448 126
40 3300046616 Ga0495668_0239096 Ga0495668_0239096_49_504 126
41 3300047443 Ga0495687_016403 Ga0495687_016403_2442_2897 126
42 3300048091 Ga0495626_0039361 Ga0495626_0039361_1650_2105 126
43 3300048904 Ga0496101_0864994 Ga0496101_0864994_163_618 126
44 3300048905 Ga0496102_0122881 Ga0496102_0122881_639_1094 126
45 3300048906 Ga0496103_0184908 Ga0496103_0184908_556_1011 126
46 3300048911 Ga0496108_0173367 Ga0496108_0173367_615_1070 126
47 3300048915 Ga0496112_0149607 Ga0496112_0149607_805_1260 126
48 3300048916 Ga0496113_0287823 Ga0496113_0287823_462_917 126
49 3300048913 Ga0496110_0387359 Ga0496110_0387359_799_1248 132
50 3300021384 Ga0213876_10008172 Ga0213876_100081724 133
51 3300039437 Ga0436365_1909513 Ga0436365_1909513_10489_10944 133
52 3300048904 Ga0496101_0547179 Ga0496101_0547179_203_658 133
53 3300048907 Ga0496104_1139563 Ga0496104_1139563_96_551 133
54 3300048909 Ga0496106_0300015 Ga0496106_0300015_643_1098 133
55 3300048910 Ga0496107_0303265 Ga0496107_0303265_360_815 133
56 3300048918 Ga0496115_0460203 Ga0496115_0460203_133_588 133
57 3300049822 Ga0501035_0007097 Ga0501035_0007097_6196_6648 133
58 3300006051 Ga0075364_10511364 Ga0075364_105113641 135
59 3300048924 Ga0496121_0183016 Ga0496121_0183016_542_997 135
60 3300050491 nmdc:mga00v17_225004_c1 nmdc:mga00v17_225004_c1_537_992 135
61 3300050515 nmdc:mga0a205_1104888_c1 nmdc:mga0a205_1104888_c1_22_435 135
62 3300039450 Ga0436363_0137459 Ga0436363_0137459_20_484 136
63 3300026142 Ga0207698_10582942 Ga0207698_105829422 137
64 3300044765 Ga0466970_0348766 Ga0466970_0348766_17_433 137
65 3300053138 Ga0500564_165694 Ga0500564_165694_16_432 137
66 3300060353 Ga0501082_1589541 Ga0501082_1589541_10_426 137
67 3300005355 Ga0070671_100377092 Ga0070671_1003770922 139
68 3300005841 Ga0068863_100091062 Ga0068863_1000910622 139
69 3300026088 Ga0207641_10074453 Ga0207641_100744532 140
70 3300046460 Ga0495638_0238214 Ga0495638_0238214_27_524 140
71 3300005355 Ga0070671_100138568 Ga0070671_1001385683 142
72 iso_pu_bacteria 2582581305 2585261949 146
73 iso_pu_bacteria 2643221541 2643730249 146
74 iso_pu_bacteria 2643221605 2644037369 146
75 iso_pu_bacteria 2643221606 2644043418 146
76 iso_pu_bacteria 2643221671 2644393578 146
77 iso_pu_bacteria 2885429604 2885431160 146
78 iso_pu_bacteria 2919709256 2919710590 146
79 iso_pu_bacteria 8057101203 8057103511 146
80 3300003203 JGI25406J46586_10067252 JGI25406J46586_100672522 148
81 3300005985 Ga0081539_10013456 Ga0081539_100134562 148
82 3300009147 Ga0114129_10848427 Ga0114129_108484271 148
83 3300046499 Ga0495594_0019661 Ga0495594_0019661_2388_2840 148
84 3300001989 JGI24739J22299_10004258 JGI24739J22299_100042581 150
85 3300001990 JGI24737J22298_10057395 JGI24737J22298_100573952 150
86 3300005295 Ga0065707_10136989 Ga0065707_101369892 150
87 3300005331 Ga0070670_100010644 Ga0070670_1000106442 150
88 3300005335 Ga0070666_10102567 Ga0070666_101025672 150
89 3300005335 Ga0070666_10145195 Ga0070666_101451952 150
90 3300005347 Ga0070668_100000100 Ga0070668_10000010021 150
91 3300005353 Ga0070669_100147967 Ga0070669_1001479672 150
92 3300005353 Ga0070669_101022325 Ga0070669_1010223251 150
93 3300005355 Ga0070671_100000131 Ga0070671_10000013131 150
94 3300005367 Ga0070667_100000004 Ga0070667_100000004273 150
95 3300005367 Ga0070667_100000397 Ga0070667_10000039752 150
96 3300005444 Ga0070694_100687194 Ga0070694_1006871942 150
97 3300005455 Ga0070663_100174080 Ga0070663_1001740802 150
98 3300005457 Ga0070662_100397020 Ga0070662_1003970201 150
99 3300005543 Ga0070672_100145835 Ga0070672_1001458352 150
100 3300005548 Ga0070665_101275215 Ga0070665_1012752151 150
101 3300005564 Ga0070664_100237315 Ga0070664_1002373152 150
102 3300005577 Ga0068857_100096732 Ga0068857_1000967322 150
103 3300005577 Ga0068857_100608278 Ga0068857_1006082782 150
104 3300005578 Ga0068854_100025897 Ga0068854_1000258973 150
105 3300005616 Ga0068852_100174362 Ga0068852_1001743622 150
106 3300005616 Ga0068852_100326373 Ga0068852_1003263732 150
107 3300005617 Ga0068859_100079726 Ga0068859_1000797262 150
108 3300005617 Ga0068859_101267779 Ga0068859_1012677791 150
109 3300005834 Ga0068851_10055591 Ga0068851_100555912 150
110 3300005841 Ga0068863_100001017 Ga0068863_1000010175 150
111 3300005841 Ga0068863_100016200 Ga0068863_1000162004 150
112 3300005842 Ga0068858_100001674 Ga0068858_10000167421 150
113 3300005843 Ga0068860_100000002 Ga0068860_100000002266 150
114 3300005843 Ga0068860_100000521 Ga0068860_10000052151 150
115 3300005844 Ga0068862_100000336 Ga0068862_10000033615 150
116 3300005844 Ga0068862_101821827 Ga0068862_1018218271 150
117 3300006173 Ga0070716_100559393 Ga0070716_1005593931 150
118 3300006195 Ga0075366_10235497 Ga0075366_102354972 150
119 3300006358 Ga0068871_101668601 Ga0068871_1016686011 150
120 3300006871 Ga0075434_100212130 Ga0075434_1002121303 150
121 3300006931 Ga0097620_100079726 Ga0097620_1000797262 150
122 3300006931 Ga0097620_101268165 Ga0097620_1012681651 150
123 3300009147 Ga0114129_10774805 Ga0114129_107748051 150
124 3300009174 Ga0105241_10479288 Ga0105241_104792881 150
125 3300009177 Ga0105248_10048772 Ga0105248_100487722 150
126 3300009545 Ga0105237_10249019 Ga0105237_102490191 150
127 3300009551 Ga0105238_10599743 Ga0105238_105997431 150
128 3300009551 Ga0105238_10668874 Ga0105238_106688742 150
129 3300009553 Ga0105249_10130614 Ga0105249_101306142 150
130 3300012513 Ga0157326_1000164 Ga0157326_10001646 150
131 3300013100 Ga0157373_10106355 Ga0157373_101063552 150
132 3300013307 Ga0157372_10458130 Ga0157372_104581301 150
133 3300025321 Ga0207656_10242995 Ga0207656_102429951 150
134 3300025903 Ga0207680_10122127 Ga0207680_101221272 150
135 3300025903 Ga0207680_10501074 Ga0207680_105010742 150
136 3300025909 Ga0207705_10569960 Ga0207705_105699602 150
137 3300025914 Ga0207671_10119554 Ga0207671_101195543 150
138 3300025919 Ga0207657_10065972 Ga0207657_100659724 150
139 3300025923 Ga0207681_10092875 Ga0207681_100928752 150
140 3300025923 Ga0207681_11096635 Ga0207681_110966351 150
141 3300025924 Ga0207694_10484040 Ga0207694_104840402 150
142 3300025925 Ga0207650_10001083 Ga0207650_100010835 150
143 3300025926 Ga0207659_10243498 Ga0207659_102434981 150
144 3300025931 Ga0207644_10000173 Ga0207644_1000017312 150
145 3300025932 Ga0207690_10163942 Ga0207690_101639422 150
146 3300025940 Ga0207691_10219385 Ga0207691_102193852 150
147 3300025944 Ga0207661_11131127 Ga0207661_111311271 150
148 3300025945 Ga0207679_10165158 Ga0207679_101651582 150
149 3300025949 Ga0207667_10003607 Ga0207667_1000360720 150
150 3300025961 Ga0207712_10076744 Ga0207712_100767442 150
151 3300025972 Ga0207668_10000008 Ga0207668_10000008189 150
152 3300025986 Ga0207658_10000002 Ga0207658_10000002566 150
153 3300025986 Ga0207658_10000335 Ga0207658_1000033544 150
154 3300025986 Ga0207658_11972822 Ga0207658_119728221 150
155 3300026035 Ga0207703_10003388 Ga0207703_100033887 150
156 3300026067 Ga0207678_10064521 Ga0207678_100645212 150
157 3300026088 Ga0207641_10000342 Ga0207641_1000034248 150
158 3300026088 Ga0207641_10003824 Ga0207641_1000382412 150
159 3300026088 Ga0207641_10008823 Ga0207641_100088234 150
160 3300026116 Ga0207674_10047840 Ga0207674_100478404 150
161 3300026116 Ga0207674_10055155 Ga0207674_100551552 150
162 3300026118 Ga0207675_100086857 Ga0207675_1000868572 150
163 3300026142 Ga0207698_10114181 Ga0207698_101141813 150
164 3300026142 Ga0207698_10142296 Ga0207698_101422962 150
165 3300027876 Ga0209974_10023726 Ga0209974_100237262 150
166 3300028380 Ga0268265_10003708 Ga0268265_100037086 150
167 3300028381 Ga0268264_10000001 Ga0268264_10000001891 150
168 3300028381 Ga0268264_10000324 Ga0268264_1000032445 150
169 3300031548 Ga0307408_100411282 Ga0307408_1004112822 150
170 3300031731 Ga0307405_10164771 Ga0307405_101647712 150
171 3300031731 Ga0307405_10237733 Ga0307405_102377332 150
172 3300031731 Ga0307405_10536620 Ga0307405_105366202 150
173 3300031824 Ga0307413_10040871 Ga0307413_100408712 150
174 3300031824 Ga0307413_10477709 Ga0307413_104777092 150
175 3300031852 Ga0307410_10073314 Ga0307410_100733144 150
176 3300031852 Ga0307410_11782594 Ga0307410_117825941 150
177 3300031901 Ga0307406_10020845 Ga0307406_100208453 150
178 3300031901 Ga0307406_10220411 Ga0307406_102204112 150
179 3300031903 Ga0307407_10291430 Ga0307407_102914302 150
180 3300031911 Ga0307412_10061360 Ga0307412_100613602 150
181 3300031911 Ga0307412_10523639 Ga0307412_105236392 150
182 3300031911 Ga0307412_10682597 Ga0307412_106825972 150
183 3300032002 Ga0307416_100164047 Ga0307416_1001640472 150
184 3300032002 Ga0307416_102030636 Ga0307416_1020306361 150
185 3300032004 Ga0307414_10035190 Ga0307414_100351903 150
186 3300032005 Ga0307411_10202566 Ga0307411_102025662 150
187 3300032005 Ga0307411_10268982 Ga0307411_102689822 150
188 3300032126 Ga0307415_100591625 Ga0307415_1005916252 150
189 3300037068 Ga0373925_0476945 Ga0373925_0476945_299_751 150
190 3300039437 Ga0436365_1242187 Ga0436365_1242187_3259_3714 150
191 3300039453 Ga0436362_0238977 Ga0436362_0238977_24_479 150
192 3300041453 Ga0451797_0448939 Ga0451797_0448939_21_473 150
193 3300041512 Ga0451853_3898491 Ga0451853_3898491_48_500 150
194 3300045049 Ga0466959_0422922 Ga0466959_0422922_295_822 150
195 3300046520 Ga0495637_0073431 Ga0495637_0073431_488_943 150
196 3300046522 Ga0495643_0057673 Ga0495643_0057673_1104_1559 150
197 3300046530 Ga0495654_0001789 Ga0495654_0001789_2197_2652 150
198 3300046542 Ga0495597_0056033 Ga0495597_0056033_878_1330 150
199 3300046660 Ga0495625_0056978 Ga0495625_0056978_1921_2376 150
200 3300047447 Ga0495685_064655 Ga0495685_064655_55_510 150
201 3300047472 Ga0495686_0009402 Ga0495686_0009402_2177_2629 150
202 3300047472 Ga0495686_0026927 Ga0495686_0026927_2060_2512 150
203 3300048090 Ga0495615_0049454 Ga0495615_0049454_578_1033 150
204 3300048908 Ga0496105_0264497 Ga0496105_0264497_179_634 150
205 3300048912 Ga0496109_0589969 Ga0496109_0589969_332_784 150
206 3300048921 Ga0496118_0355245 Ga0496118_0355245_227_679 150
207 3300048927 Ga0496124_0443204 Ga0496124_0443204_39_494 150
208 3300048928 Ga0496125_0037463 Ga0496125_0037463_458_910 150
209 3300049127 Ga0501306_086700 Ga0501306_086700_59_514 150
210 3300049513 Ga0501290_061033 Ga0501290_061033_49_501 150
211 3300049572 Ga0501036_0750354 Ga0501036_0750354_280_732 150
212 3300049579 Ga0501043_0021424 Ga0501043_0021424_2792_3244 150
213 3300049580 Ga0501046_0306705 Ga0501046_0306705_355_807 150
214 3300049581 Ga0501047_0002625 Ga0501047_0002625_1869_2321 150
215 3300049654 Ga0501207_014752 Ga0501207_014752_674_1129 150
216 3300049665 Ga0501227_215052 Ga0501227_215052_54_506 150
217 3300049673 Ga0501240_044884 Ga0501240_044884_32_484 150
218 3300049679 Ga0501249_000133 Ga0501249_000133_2273_2725 150
219 3300049685 Ga0501256_010401 Ga0501256_010401_227_679 150
220 3300049686 Ga0501257_000089 Ga0501257_000089_43_495 150
221 3300049765 Ga0501268_016960 Ga0501268_016960_385_837 150
222 3300049770 Ga0501273_013841 Ga0501273_013841_58_513 150
223 3300049776 Ga0501280_082012 Ga0501280_082012_40_492 150
224 3300049779 Ga0501283_017770 Ga0501283_017770_590_1042 150
225 3300049823 Ga0501044_0183848 Ga0501044_0183848_546_998 150
226 3300049824 Ga0501045_1085735 Ga0501045_1085735_50_502 150
227 3300050493 nmdc:mga0k408_115225_c1 nmdc:mga0k408_115225_c1_326_778 150
228 3300050512 nmdc:mga0n895_311621_c1 nmdc:mga0n895_311621_c1_804_1259 150
229 3300053087 Ga0500643_000166 Ga0500643_000166_61984_62436 150
230 3300053087 Ga0500643_001817 Ga0500643_001817_6857_7312 150
231 3300053096 Ga0500641_0013911 Ga0500641_0013911_2476_2928 150
232 3300053116 Ga0500592_000160 Ga0500592_000160_3584_4039 150
233 3300053116 Ga0500592_001757 Ga0500592_001757_424_876 150
234 3300053119 Ga0500595_095917 Ga0500595_095917_309_764 150
235 3300053123 Ga0500614_011259 Ga0500614_011259_1458_1910 150
236 3300053130 Ga0500642_0014282 Ga0500642_0014282_2471_2923 150
237 3300053133 Ga0500655_000590 Ga0500655_000590_2357_2809 150
238 3300053134 Ga0500658_0253112 Ga0500658_0253112_165_620 150
239 3300053136 Ga0500559_0146215 Ga0500559_0146215_625_1077 150
240 3300053148 Ga0500590_003281 Ga0500590_003281_4424_4876 150
241 3300053151 Ga0500604_0234847 Ga0500604_0234847_156_608 150
242 3300053156 Ga0500622_0019856 Ga0500622_0019856_2656_3108 150
243 3300053158 Ga0500627_0000268 Ga0500627_0000268_2487_2942 150
244 3300053158 Ga0500627_0000324 Ga0500627_0000324_10390_10845 150
245 3300053158 Ga0500627_0055396 Ga0500627_0055396_1196_1648 150
246 3300053163 Ga0500639_208685 Ga0500639_208685_42_494 150
247 3300053724 Ga0500570_017325 Ga0500570_017325_2542_2994 150
248 3300053730 Ga0500645_059217 Ga0500645_059217_367_822 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

3

149

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s4c-assembly1.cif.gz_A-2 lactose phosphorylase in complex with sulfate 0.9037 53 93
2c41-assembly1.cif.gz_C x-ray structure of dps from thermosynechococcus elongatus 0.8447 41 92
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.793 4 150
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7698 4 150
1jig-assembly1.cif.gz_A dlp-2 from bacillus anthracis 0.7012 42 92
ID Description Score Start End Superfamily
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9264 2 93 1.10.1510.10
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9129 4 92 1.10.1510.10
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9125 94 150 1.10.10.410
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9074 1 93 1.10.1510.10
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.898 94 150 1.10.10.410
ID Description Score Start End GO Terms
AF-A0A259HHD4-F1-model_v4 Aspartyl-tRNA amidotransferase 0.9378 1 106 GO:0016740
GO:0016884
AF-A0A502FIE2-F1-model_v4 GatB/YqeY domain-containing protein 0.9317 1 150 GO:0016884
AF-A0A653J3S8-F1-model_v4 GatB protein 0.9299 1 150 GO:0016884
AF-A0A2E0UZ94-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9269 1 149 GO:0016740
GO:0016884
AF-A0A1E1F0X5-F1-model_v4 GatB/Yqey domain-containing protein 0.9248 1 150 GO:0016884

Feature Viewer

pLDDT pTM Quality
95.68 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map