F359491

General Info

Members Datasets Scaffolds Average Seq Length
247 190 494 117

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006486233|3006492154
Length 136
Sequence ASAGPSYGSAEALHMLSPMTDSTGISPEDSKIITLARSARARNGVPEGAAVRDETGRTYVAGTVELPSLRLSALQTAVAMAVASGAESLEAAAVVGTADAVVDLDRAAVRDLGGPDTPVLLAAPDGTLRSTTPAGA

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
8 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
9 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
10 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
11 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
12 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
13 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
14 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
15 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
16 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
17 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
18 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
19 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
20 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
21 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
22 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
23 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
24 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
25 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
26 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
27 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
28 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
29 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
30 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
31 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
32 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
33 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
34 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
35 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
36 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
37 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
38 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
39 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
40 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
41 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
42 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
43 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
44 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
45 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
46 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
47 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
48 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
49 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
50 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
51 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
52 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
53 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
54 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
55 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
56 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
57 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
58 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
59 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
60 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
61 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
62 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
63 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
64 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
65 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
66 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
69 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
70 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
71 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
79 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
85 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
86 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
95 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
96 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
101 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
102 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
129 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
131 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
137 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
138 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
139 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
140 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
141 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
142 2643221548 Streptomyces sp. Root55 Isolate Unclassified
143 2643221578 Streptomyces sp. Root63 Isolate Unclassified
144 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
145 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
146 2643221670 Streptomyces sp. Root431 Isolate Unclassified
147 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
148 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
149 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
150 2643221714 Streptomyces sp. Root264 Isolate Unclassified
151 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
152 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
153 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
154 2808606448 Streptomyces sp. 193411 Isolate Unclassified
155 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
156 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
157 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
158 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
159 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
160 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
161 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
162 2867475112 Streptomyces sp. TM32 Isolate Unclassified
163 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
164 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
165 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
166 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
167 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
168 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
169 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
170 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
171 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
172 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
173 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
174 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
175 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
176 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
177 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
178 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
179 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
180 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
181 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
182 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
183 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
184 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
185 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
186 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
187 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
188 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
189 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
190 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.92
Metatranscriptomes 0.81
Isolates 22.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 0
Rhizosphere 83.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10006346 3300003316 Bacteria 8065
2 rootH1_10027481 3300003316 Bacteria 4184
3 rootL2_10093340 3300003322 Bacteria 2876
4 rootH1_10038927 3300003323 Bacteria 7257
5 Ga0006562J51391_1134954 3300003578 Bacteria 951
6 Ga0006562J51391_1169987 3300003578 Bacteria 1360
7 Ga0068858_100778931 3300005842 Bacteria 933
8 Ga0075363_100024212 3300006048 Bacteria 3084
9 Ga0105251_10367047 3300009011 Bacteria 658
10 Ga0105245_12582593 3300009098 Bacteria 561
11 Ga0105035_125405 3300009988 Bacteria 571
12 Ga0157515_136269 3300013875 Bacteria 522
13 Ga0209758_1002893 3300025297 Bacteria 16577
14 Ga0207426_1006137 3300025302 Bacteria 5291
15 Ga0209371_1010904 3300027312 Bacteria 2747
16 Ga0268256_1011762 3300030500 Bacteria 2747
17 Ga0307512_10002516 3300030522 Bacteria 22951
18 Ga0307508_10009056 3300031616 Bacteria 9170
19 Ga0307518_10052377 3300031838 Bacteria 2965
20 Ga0307409_101242340 3300031995 Bacteria 769
21 Ga0307507_10080271 3300033179 Bacteria 2877
22 Ga0307507_10083445 3300033179 Bacteria 2794
23 Ga0395900_0026487 3300037418 Bacteria 5937
24 Ga0395898_0010348 3300037466 Bacteria 9756
25 Ga0395898_0015609 3300037466 Bacteria 7785
26 Ga0395905_0369691 3300037471 Bacteria 1327
27 Ga0451837_1637405 3300041494 Bacteria 2906
28 Ga0439445_0177120 3300042004 Bacteria 626
29 Ga0439449_0032660 3300042007 Bacteria 1940
30 Ga0439455_0000243 3300042012 Bacteria 6556
31 Ga0450900_046075 3300042136 Bacteria 661
32 Ga0450902_008335 3300042137 Bacteria 1617
33 Ga0450903_001079 3300042138 Bacteria 5195
34 Ga0450903_001186 3300042138 Bacteria 4910
35 Ga0466969_0032489 3300044656 Bacteria 2653
36 Ga0466972_0000726 3300044658 Bacteria 15757
37 Ga0466965_0013879 3300044683 Bacteria 3807
38 Ga0466966_0015684 3300044684 Bacteria 5009
39 Ga0466966_0918170 3300044684 Bacteria 528
40 Ga0466961_0267216 3300044693 Bacteria 1048
41 Ga0466963_0095576 3300044694 Bacteria 2028
42 Ga0466971_0006199 3300044719 Bacteria 5198
43 Ga0466968_0005713 3300044735 Bacteria 4665
44 Ga0466970_0720039 3300044765 Bacteria 582
45 Ga0466958_0755777 3300045836 Bacteria 634
46 Ga0466967_0068291 3300045976 Bacteria 3173
47 Ga0466967_1996831 3300045976 Bacteria 577
48 Ga0495617_113946 3300046452 Bacteria 873
49 Ga0495603_0002756 3300046455 Bacteria 10351
50 Ga0495603_0008978 3300046455 Bacteria 6044
51 Ga0495603_0020606 3300046455 Bacteria 3994
52 Ga0495629_0006576 3300046459 Bacteria 8613
53 Ga0495629_0012565 3300046459 Bacteria 6132
54 Ga0495629_0012722 3300046459 Bacteria 6093
55 Ga0495638_0133481 3300046460 Bacteria 1456
56 Ga0495651_0013804 3300046462 Bacteria 6248
57 Ga0495582_0055942 3300046473 Bacteria 2174
58 Ga0495582_0440073 3300046473 Bacteria 752
59 Ga0495605_0021019 3300046474 Bacteria 3461
60 Ga0495662_0006516 3300046476 Bacteria 5832
61 Ga0495662_0053275 3300046476 Bacteria 1953
62 Ga0495662_0151130 3300046476 Bacteria 1144
63 Ga0495664_0150147 3300046477 Bacteria 1413
64 Ga0495585_0017257 3300046492 Bacteria 4173
65 Ga0495585_0052386 3300046492 Bacteria 2259
66 Ga0495585_0108929 3300046492 Bacteria 1475
67 Ga0495594_0000649 3300046499 Bacteria 17952
68 Ga0495596_0047778 3300046500 Bacteria 1679
69 Ga0495607_0344287 3300046501 Bacteria 689
70 Ga0495583_0064767 3300046506 Bacteria 1620
71 Ga0495583_0392864 3300046506 Bacteria 545
72 Ga0495606_0018539 3300046507 Bacteria 5213
73 Ga0495610_0077715 3300046512 Bacteria 1532
74 Ga0495616_0001801 3300046513 Bacteria 14547
75 Ga0495618_0040063 3300046514 Bacteria 2947
76 Ga0495618_0249611 3300046514 Bacteria 1113
77 Ga0495620_0029621 3300046515 Bacteria 2530
78 Ga0495620_0030272 3300046515 Bacteria 2494
79 Ga0495620_0273151 3300046515 Bacteria 643
80 Ga0495631_0018010 3300046518 Bacteria 3332
81 Ga0495631_0040678 3300046518 Bacteria 2059
82 Ga0495632_0140006 3300046519 Bacteria 1123
83 Ga0495643_0028642 3300046522 Bacteria 3120
84 Ga0495648_0126580 3300046524 Bacteria 1364
85 Ga0495648_0201371 3300046524 Bacteria 996
86 Ga0495666_0007722 3300046526 Bacteria 5382
87 Ga0495642_0531749 3300046528 Bacteria 521
88 Ga0495654_0187545 3300046530 Bacteria 892
89 Ga0495640_0014424 3300046533 Bacteria 5981
90 Ga0495609_0176163 3300046538 Bacteria 901
91 Ga0495597_0028256 3300046542 Bacteria 2567
92 Ga0495645_0040915 3300046543 Bacteria 3379
93 Ga0495645_0332951 3300046543 Bacteria 982
94 Ga0495645_0578212 3300046543 Bacteria 693
95 Ga0495622_0007395 3300046557 Bacteria 5095
96 Ga0495622_0009917 3300046557 Bacteria 4406
97 Ga0495667_0223939 3300046559 Bacteria 1200
98 Ga0495668_0011536 3300046616 Bacteria 5286
99 Ga0495634_0014911 3300046642 Bacteria 5587
100 Ga0495634_0023201 3300046642 Bacteria 4363
101 Ga0495611_0023867 3300046648 Bacteria 2656
102 Ga0495611_0176457 3300046648 Bacteria 998
103 Ga0495625_0011519 3300046660 Bacteria 7203
104 Ga0495625_0080122 3300046660 Bacteria 2275
105 Ga0495635_0003438 3300046663 Bacteria 10956
106 Ga0495661_0140379 3300046665 Bacteria 1315
107 Ga0495588_0005021 3300046674 Bacteria 5873
108 Ga0495657_0028891 3300046675 Bacteria 3893
109 Ga0495657_0047605 3300046675 Bacteria 2897
110 Ga0495657_0071605 3300046675 Bacteria 2262
111 Ga0495623_0156953 3300046679 Bacteria 1340
112 Ga0495646_0023163 3300046680 Bacteria 3910
113 Ga0495613_0009907 3300046689 Bacteria 7084
114 Ga0495613_0032888 3300046689 Bacteria 3853
115 Ga0495613_0037188 3300046689 Bacteria 3609
116 Ga0495624_0216359 3300046690 Bacteria 1162
117 Ga0495624_0387287 3300046690 Bacteria 839
118 Ga0495649_0056465 3300046694 Bacteria 2119
119 Ga0495649_0129384 3300046694 Bacteria 1332
120 Ga0495589_0071197 3300046794 Bacteria 1699
121 Ga0495589_0077738 3300046794 Bacteria 1616
122 Ga0495589_0086927 3300046794 Bacteria 1518
123 Ga0495589_0322943 3300046794 Bacteria 713
124 Ga0495600_0027580 3300046809 Bacteria 3670
125 Ga0495600_0128635 3300046809 Bacteria 1646
126 Ga0495600_0309728 3300046809 Bacteria 995
127 Ga0495581_0003080 3300047315 Bacteria 9535
128 Ga0495604_0011500 3300047317 Bacteria 7030
129 Ga0495604_0037611 3300047317 Bacteria 3810
130 Ga0495604_0878087 3300047317 Bacteria 561
131 Ga0495636_0048442 3300047318 Bacteria 1776
132 Ga0495676_0003075 3300047321 Bacteria 15091
133 Ga0495676_0006097 3300047321 Bacteria 11085
134 Ga0495676_0007442 3300047321 Bacteria 10045
135 Ga0495676_0033752 3300047321 Bacteria 4302
136 Ga0495683_0010569 3300047323 Bacteria 4870
137 Ga0495675_0006437 3300047444 Bacteria 7190
138 Ga0495675_0007937 3300047444 Bacteria 6561
139 Ga0495677_0074262 3300047445 Bacteria 1269
140 Ga0495685_004056 3300047447 Bacteria 4710
141 Ga0495685_020307 3300047447 Bacteria 2282
142 Ga0495685_038826 3300047447 Bacteria 1630
143 Ga0495681_0145399 3300047470 Bacteria 998
144 Ga0495686_0168426 3300047472 Bacteria 1275
145 Ga0495593_0071295 3300047673 Bacteria 1804
146 Ga0495593_0102734 3300047673 Bacteria 1465
147 Ga0495593_0387366 3300047673 Bacteria 699
148 Ga0495602_0023316 3300048088 Bacteria 6032
149 Ga0495614_0003244 3300048089 Bacteria 7262
150 Ga0495614_0005803 3300048089 Bacteria 5562
151 Ga0495614_0089353 3300048089 Bacteria 1339
152 Ga0495614_0133676 3300048089 Bacteria 1099
153 Ga0495614_0143153 3300048089 Bacteria 1063
154 Ga0495626_0031422 3300048091 Bacteria 2555
155 Ga0495626_0053521 3300048091 Bacteria 1857
156 Ga0495682_0175978 3300049460 Bacteria 761
157 Ga0501033_0093100 3300049570 Bacteria 2203
158 Ga0501034_0067849 3300049571 Bacteria 3578
159 Ga0501036_0714692 3300049572 Bacteria 827
160 Ga0501039_0072618 3300049575 Bacteria 2673
161 Ga0501040_0026594 3300049576 Bacteria 3892
162 Ga0501041_0004249 3300049577 Bacteria 8293
163 Ga0501042_0053728 3300049578 Bacteria 2873
164 Ga0501046_0017682 3300049580 Bacteria 5945
165 Ga0501047_0073799 3300049581 Bacteria 3285
166 Ga0501047_0411631 3300049581 Bacteria 1184
167 Ga0501048_0035233 3300049582 Bacteria 3603
168 Ga0501067_0005729 3300049583 Bacteria 6896
169 Ga0501068_0052262 3300049584 Bacteria 2472
170 Ga0501069_0026378 3300049585 Bacteria 3180
171 Ga0501070_0931373 3300049586 Bacteria 676
172 Ga0501071_0025730 3300049587 Bacteria 4123
173 Ga0501072_0013115 3300049588 Bacteria 6342
174 Ga0501073_0055476 3300049589 Bacteria 2772
175 Ga0501074_0195545 3300049590 Bacteria 1441
176 Ga0501077_0083564 3300049593 Bacteria 2023
177 Ga0501079_0002823 3300049741 Bacteria 12665
178 Ga0501080_0383806 3300049742 Bacteria 1265
179 Ga0501035_0015388 3300049822 Bacteria 7057
180 Ga0501044_0004371 3300049823 Bacteria 15818
181 Ga0501044_0020491 3300049823 Bacteria 7060
182 Ga0501044_0569604 3300049823 Bacteria 1028
183 Ga0501045_0390712 3300049824 Bacteria 1035
184 nmdc:mga03n38_390937_c1 3300050490 Bacteria 764
185 Ga0500647_0199564 3300053091 Bacteria 908
186 Ga0500572_059086 3300053111 Bacteria 1162
187 Ga0500608_366232 3300053122 Bacteria 504
188 Ga0500586_133159 3300053145 Bacteria 859
189 Ga0501084_0044079 3300054114 Bacteria 3733
190 Ga0501082_0007288 3300060353 Bacteria 9541
191 Ga0466962_0001536 3300061719 Bacteria 10791
192 Ga0530510_0049701 3300061734 Bacteria 3029
193 3006492154 3006486233 Bacteria 8157040
194 2547407933 2547132111 Bacteria 8013147
195 2554258658 2554235005 Bacteria 6457341
196 2585301344 2582581312 Bacteria 7308206
197 2585304922 2582581313 Bacteria 10042643
198 2585318938 2582581314 Bacteria 11452267
199 2643759690 2643221548 Bacteria 8053412
200 2643897805 2643221578 Bacteria 9213798
201 2644018758 2643221601 Bacteria 7493239
202 2644179893 2643221631 Bacteria 8168043
203 2644385318 2643221670 Bacteria 6497041
204 2644408950 2643221673 Bacteria 9196637
205 2644436293 2643221678 Bacteria 9540101
206 2644462895 2643221682 Bacteria 6743283
207 2644625842 2643221714 Bacteria 9015452
208 2785344351 2784746763 Bacteria 9783172
209 2786669520 2786546132 Bacteria 10419719
210 2808841191 2808606359 Bacteria 9866990
211 2809231382 2808606448 Bacteria 8656184
212 2812359063 2811994879 Bacteria 9313447
213 2812481303 2811994917 Bacteria 7761064
214 2819693740 2818991463 Bacteria 7948711
215 2819742925 2818991472 Bacteria 10089953
216 2852641196 2852635781 Bacteria 8251373
217 2862182562 2862178590 Bacteria 8583590
218 2862296930 2862290372 Bacteria 7471434
219 2867479548 2867475112 Bacteria 6909112
220 2873156633 2873151551 Bacteria 8625867
221 2877682034 2877676314 Bacteria 9512378
222 2912725082 2912723979 Bacteria 8557534
223 2919468591 2919468124 Bacteria 9133025
224 2946050936 2946045630 Bacteria 8527308
225 2946066815 2946064051 Bacteria 8957905
226 2946075141 2946072368 Bacteria 8999607
227 2947230414 2947224130 Bacteria 9938529
228 2954003742 2954002825 Bacteria 9173742
229 2954676010 2954673503 Bacteria 9685905
230 2954688155 2954682443 Bacteria 9862841
231 2954717099 2954711539 Bacteria 10867210
232 2954727069 2954721474 Bacteria 10456478
233 2954734733 2954731030 Bacteria 10243860
234 2954745972 2954740390 Bacteria 10229294
235 2954753620 2954749733 Bacteria 10366972
236 2966603355 2966598605 Bacteria 7676064
237 2990092526 2990088156 Bacteria 6657676
238 2995471043 2995463766 Bacteria 8577691
239 2997456485 2997451912 Bacteria 8492419
240 3006321912 3006321560 Bacteria 8247479
241 3006501024 3006493962 Bacteria 8825450
242 8008579687 8008574985 Bacteria 7815457
243 8025484072 8025478263 Bacteria 8209203
244 8033689300 8033684223 Bacteria 6906479
245 8054167271 8054160619 Bacteria 7783213
246 8056453298 8056447290 Bacteria 7680491
247 8056673332 8056667051 Bacteria 6953971
248 rootH1_10006346
249 rootH1_10027481
250 rootL2_10093340
251 rootH1_10038927
252 Ga0006562J51391_1134954
253 Ga0006562J51391_1169987
254 Ga0068858_100778931
255 Ga0075363_100024212
256 Ga0105251_10367047
257 Ga0105245_12582593
258 Ga0105035_125405
259 Ga0157515_136269
260 Ga0209758_1002893
261 Ga0207426_1006137
262 Ga0209371_1010904
263 Ga0268256_1011762
264 Ga0307512_10002516
265 Ga0307508_10009056
266 Ga0307518_10052377
267 Ga0307409_101242340
268 Ga0307507_10080271
269 Ga0307507_10083445
270 Ga0395900_0026487
271 Ga0395898_0010348
272 Ga0395898_0015609
273 Ga0395905_0369691
274 Ga0451837_1637405
275 Ga0439445_0177120
276 Ga0439449_0032660
277 Ga0439455_0000243
278 Ga0450900_046075
279 Ga0450902_008335
280 Ga0450903_001079
281 Ga0450903_001186
282 Ga0466969_0032489
283 Ga0466972_0000726
284 Ga0466965_0013879
285 Ga0466966_0015684
286 Ga0466966_0918170
287 Ga0466961_0267216
288 Ga0466963_0095576
289 Ga0466971_0006199
290 Ga0466968_0005713
291 Ga0466970_0720039
292 Ga0466958_0755777
293 Ga0466967_0068291
294 Ga0466967_1996831
295 Ga0495617_113946
296 Ga0495603_0002756
297 Ga0495603_0008978
298 Ga0495603_0020606
299 Ga0495629_0006576
300 Ga0495629_0012565
301 Ga0495629_0012722
302 Ga0495638_0133481
303 Ga0495651_0013804
304 Ga0495582_0055942
305 Ga0495582_0440073
306 Ga0495605_0021019
307 Ga0495662_0006516
308 Ga0495662_0053275
309 Ga0495662_0151130
310 Ga0495664_0150147
311 Ga0495585_0017257
312 Ga0495585_0052386
313 Ga0495585_0108929
314 Ga0495594_0000649
315 Ga0495596_0047778
316 Ga0495607_0344287
317 Ga0495583_0064767
318 Ga0495583_0392864
319 Ga0495606_0018539
320 Ga0495610_0077715
321 Ga0495616_0001801
322 Ga0495618_0040063
323 Ga0495618_0249611
324 Ga0495620_0029621
325 Ga0495620_0030272
326 Ga0495620_0273151
327 Ga0495631_0018010
328 Ga0495631_0040678
329 Ga0495632_0140006
330 Ga0495643_0028642
331 Ga0495648_0126580
332 Ga0495648_0201371
333 Ga0495666_0007722
334 Ga0495642_0531749
335 Ga0495654_0187545
336 Ga0495640_0014424
337 Ga0495609_0176163
338 Ga0495597_0028256
339 Ga0495645_0040915
340 Ga0495645_0332951
341 Ga0495645_0578212
342 Ga0495622_0007395
343 Ga0495622_0009917
344 Ga0495667_0223939
345 Ga0495668_0011536
346 Ga0495634_0014911
347 Ga0495634_0023201
348 Ga0495611_0023867
349 Ga0495611_0176457
350 Ga0495625_0011519
351 Ga0495625_0080122
352 Ga0495635_0003438
353 Ga0495661_0140379
354 Ga0495588_0005021
355 Ga0495657_0028891
356 Ga0495657_0047605
357 Ga0495657_0071605
358 Ga0495623_0156953
359 Ga0495646_0023163
360 Ga0495613_0009907
361 Ga0495613_0032888
362 Ga0495613_0037188
363 Ga0495624_0216359
364 Ga0495624_0387287
365 Ga0495649_0056465
366 Ga0495649_0129384
367 Ga0495589_0071197
368 Ga0495589_0077738
369 Ga0495589_0086927
370 Ga0495589_0322943
371 Ga0495600_0027580
372 Ga0495600_0128635
373 Ga0495600_0309728
374 Ga0495581_0003080
375 Ga0495604_0011500
376 Ga0495604_0037611
377 Ga0495604_0878087
378 Ga0495636_0048442
379 Ga0495676_0003075
380 Ga0495676_0006097
381 Ga0495676_0007442
382 Ga0495676_0033752
383 Ga0495683_0010569
384 Ga0495675_0006437
385 Ga0495675_0007937
386 Ga0495677_0074262
387 Ga0495685_004056
388 Ga0495685_020307
389 Ga0495685_038826
390 Ga0495681_0145399
391 Ga0495686_0168426
392 Ga0495593_0071295
393 Ga0495593_0102734
394 Ga0495593_0387366
395 Ga0495602_0023316
396 Ga0495614_0003244
397 Ga0495614_0005803
398 Ga0495614_0089353
399 Ga0495614_0133676
400 Ga0495614_0143153
401 Ga0495626_0031422
402 Ga0495626_0053521
403 Ga0495682_0175978
404 Ga0501033_0093100
405 Ga0501034_0067849
406 Ga0501036_0714692
407 Ga0501039_0072618
408 Ga0501040_0026594
409 Ga0501041_0004249
410 Ga0501042_0053728
411 Ga0501046_0017682
412 Ga0501047_0073799
413 Ga0501047_0411631
414 Ga0501048_0035233
415 Ga0501067_0005729
416 Ga0501068_0052262
417 Ga0501069_0026378
418 Ga0501070_0931373
419 Ga0501071_0025730
420 Ga0501072_0013115
421 Ga0501073_0055476
422 Ga0501074_0195545
423 Ga0501077_0083564
424 Ga0501079_0002823
425 Ga0501080_0383806
426 Ga0501035_0015388
427 Ga0501044_0004371
428 Ga0501044_0020491
429 Ga0501044_0569604
430 Ga0501045_0390712
431 nmdc:mga03n38_390937_c1
432 Ga0500647_0199564
433 Ga0500572_059086
434 Ga0500608_366232
435 Ga0500586_133159
436 Ga0501084_0044079
437 Ga0501082_0007288
438 Ga0466962_0001536
439 Ga0530510_0049701
440 3006492154
441 2547407933
442 2554258658
443 2585301344
444 2585304922
445 2585318938
446 2643759690
447 2643897805
448 2644018758
449 2644179893
450 2644385318
451 2644408950
452 2644436293
453 2644462895
454 2644625842
455 2785344351
456 2786669520
457 2808841191
458 2809231382
459 2812359063
460 2812481303
461 2819693740
462 2819742925
463 2852641196
464 2862182562
465 2862296930
466 2867479548
467 2873156633
468 2877682034
469 2912725082
470 2919468591
471 2946050936
472 2946066815
473 2946075141
474 2947230414
475 2954003742
476 2954676010
477 2954688155
478 2954717099
479 2954727069
480 2954734733
481 2954745972
482 2954753620
483 2966603355
484 2990092526
485 2995471043
486 2997456485
487 3006321912
488 3006501024
489 8008579687
490 8025484072
491 8033689300
492 8054167271
493 8056453298
494 8056673332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dmo-assembly1.cif.gz_C 1.6 a crystal structure of cytidine deaminase from burkholderia pseudomallei 0.8742 13 117
1ux1-assembly1.cif.gz_D bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution 0.8732 11 116
1jtk-assembly1.cif.gz_A crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine 0.867 11 116
2d30-assembly1.cif.gz_A crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution 0.8663 12 117
1ux0-assembly1.cif.gz_B-2 bacillus subtilis cytidine deaminase with an arg56 - gln substitution 0.8663 11 116
ID Description Score Start End Superfamily
af_O05833_19_112_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.952 15 109 3.40.140.10
af_O05833_19_112_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.923 15 109 3.40.140.10
af_E1B6T7_69_316_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8842 29 43 2.40.10.10
af_Q9VLR2_22_168_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8668 6 116 3.40.140.10
af_F1QSJ0_1_133_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.865 11 116 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A060ZUX2-F1-model_v4 Cytidine deaminase 1.002 7 115 GO:0003824
AF-A0A2W6RL99-F1-model_v4 deleted 1.002 15 117
AF-A0A6B2RWA3-F1-model_v4 Cytidine deaminase 1.001 7 117 GO:0003824
AF-A0A5Q0LJ38-F1-model_v4 Cytidine deaminase 0.9993 1 117 GO:0003824
AF-A0A6G3CNW3-F1-model_v4 Cytidine deaminase 0.9984 1 117 GO:0003824

Map