F359259

General Info

Members Datasets Scaffolds Average Seq Length
247 171 492 346

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0025647|Ga0466968_0025647_1069_2115
Length 324
Sequence VRLISFAAAAGISGAGATFPYPIYAKWADTYKKETNIGLNYQSIGSGGGIKQIQAATVTFGATDAPLKGEDLDKHGLVQFPMVMGGIVPVVNLDGVESGSLVLDGATLANIFMGKVKSWDDAAIKKLNPSAKLPSTAIAVVHRSDGSGTTFNFTDYLSKASAEWKSNVGSNAKGNEGVANNVAQTKGAIGYVEYAYAKQNKLNVTKMVNKDGKTVSPVAASFQAAAANADWKSVPGYGVVLSDEPGAGSWPMTAATFILIHKQPKDAAAAGEALKFFAWAYKNGAKSAEELDYIPMPANVVADVEKTWGEIKDQSGKPVYTASH

Samples

Sample ID Description Type Environment
1 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 10.53
Rhizosphere 86.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466968_0025647 3300044735 Bacteria 2415
2 JGI25405J52794_10004879 3300003911 Bacteria 2402
3 Ga0070670_100210148 3300005331 Bacteria 1692
4 Ga0070661_100061146 3300005344 Bacteria 2764
5 Ga0070675_100199624 3300005354 Bacteria 1736
6 Ga0070713_100007460 3300005436 Bacteria 7681
7 Ga0070713_100013069 3300005436 Bacteria 6116
8 Ga0070713_100025617 3300005436 Bacteria 4614
9 Ga0070713_100030406 3300005436 Bacteria 4288
10 Ga0070713_100079126 3300005436 Bacteria 2800
11 Ga0070710_10042117 3300005437 Bacteria 2523
12 Ga0070711_100017123 3300005439 Bacteria 4610
13 Ga0070681_10018025 3300005458 Bacteria 7054
14 Ga0070681_10380190 3300005458 Bacteria 1323
15 Ga0070699_100007114 3300005518 Bacteria 9719
16 Ga0070679_100252098 3300005530 Bacteria 1721
17 Ga0070684_100183270 3300005535 Bacteria 1904
18 Ga0068853_100002733 3300005539 Bacteria 13317
19 Ga0068853_100303688 3300005539 Bacteria 1476
20 Ga0070664_100161611 3300005564 Bacteria 1982
21 Ga0068857_100350224 3300005577 Bacteria 1367
22 Ga0068854_100003619 3300005578 Bacteria 9668
23 Ga0068852_100198086 3300005616 Bacteria 1899
24 Ga0068864_100049908 3300005618 Bacteria 3601
25 Ga0068851_10001321 3300005834 Bacteria 10808
26 Ga0068858_100250552 3300005842 Bacteria 1682
27 Ga0081455_10002919 3300005937 Bacteria 20055
28 Ga0081455_10049342 3300005937 Bacteria 3629
29 Ga0070717_10004117 3300006028 Bacteria 10484
30 Ga0070717_10076984 3300006028 Bacteria 2793
31 Ga0070717_10252118 3300006028 Bacteria 1559
32 Ga0075432_10004847 3300006058 Bacteria 4580
33 Ga0075428_100005459 3300006844 Bacteria 14138
34 Ga0075428_100069729 3300006844 Bacteria 3843
35 Ga0075428_100241243 3300006844 Bacteria 1950
36 Ga0075428_100298542 3300006844 Bacteria 1732
37 Ga0075431_100000469 3300006847 Bacteria 33367
38 Ga0075431_100100224 3300006847 Bacteria 2989
39 Ga0075431_100112337 3300006847 Bacteria 2812
40 Ga0075433_10058103 3300006852 Bacteria 3382
41 Ga0075434_100061918 3300006871 Bacteria 3724
42 Ga0075429_100011527 3300006880 Bacteria 7666
43 Ga0075436_100038608 3300006914 Bacteria 3295
44 Ga0075436_100086653 3300006914 Bacteria 2175
45 Ga0075435_100007924 3300007076 Bacteria 7602
46 Ga0099794_10002565 3300007265 Bacteria 6737
47 Ga0105240_10011415 3300009093 Bacteria 12373
48 Ga0105240_10051846 3300009093 Bacteria 5161
49 Ga0105240_10299095 3300009093 Bacteria 1841
50 Ga0111539_10000072 3300009094 Bacteria 100461
51 Ga0111539_10026442 3300009094 Bacteria 7094
52 Ga0111539_10210922 3300009094 Bacteria 2263
53 Ga0105247_10094509 3300009101 Bacteria 1902
54 Ga0114129_10000134 3300009147 Bacteria 76265
55 Ga0114129_10020471 3300009147 Bacteria 9409
56 Ga0114129_10209177 3300009147 Bacteria 2638
57 Ga0105237_10037831 3300009545 Bacteria 4875
58 Ga0105237_10147478 3300009545 Bacteria 2348
59 Ga0105238_10077814 3300009551 Bacteria 3308
60 Ga0105238_10087860 3300009551 Bacteria 3095
61 Ga0105239_10041487 3300010375 Bacteria 5043
62 Ga0105239_10231119 3300010375 Bacteria 2075
63 Ga0157369_10075486 3300013105 Bacteria 3614
64 Ga0163162_10176986 3300013306 Bacteria 2259
65 Ga0157372_10163935 3300013307 Bacteria 2570
66 Ga0157379_10195371 3300014968 Bacteria 1829
67 Ga0157379_10334942 3300014968 Bacteria 1383
68 Ga0213872_10013585 3300021361 Bacteria 3813
69 Ga0207656_10008277 3300025321 Bacteria 3819
70 Ga0207653_10005558 3300025885 Bacteria 3935
71 Ga0207692_10117182 3300025898 Bacteria 1486
72 Ga0207699_10096997 3300025906 Bacteria 1862
73 Ga0207684_10054203 3300025910 Bacteria 3402
74 Ga0207654_10017632 3300025911 Bacteria 3737
75 Ga0207707_10052233 3300025912 Bacteria 3559
76 Ga0207695_10045016 3300025913 Bacteria 4689
77 Ga0207695_10055047 3300025913 Bacteria 4149
78 Ga0207695_10208155 3300025913 Bacteria 1868
79 Ga0207671_10043823 3300025914 Bacteria 3308
80 Ga0207693_10098754 3300025915 Bacteria 2289
81 Ga0207693_10120696 3300025915 Bacteria 2058
82 Ga0207663_10050086 3300025916 Bacteria 2594
83 Ga0207649_10021909 3300025920 Bacteria 3687
84 Ga0207649_10229573 3300025920 Bacteria 1326
85 Ga0207646_10054955 3300025922 Bacteria 3561
86 Ga0207694_10127294 3300025924 Bacteria 2039
87 Ga0207650_10009782 3300025925 Bacteria 6555
88 Ga0207700_10026232 3300025928 Bacteria 4061
89 Ga0207700_10081171 3300025928 Bacteria 2532
90 Ga0207664_10010038 3300025929 Bacteria 6672
91 Ga0207664_10366308 3300025929 Bacteria 1277
92 Ga0207706_10112853 3300025933 Bacteria 2391
93 Ga0207665_10021523 3300025939 Bacteria 4240
94 Ga0207679_10073633 3300025945 Bacteria 2585
95 Ga0207667_10014281 3300025949 Bacteria 9059
96 Ga0207640_10010542 3300025981 Bacteria 5211
97 Ga0207703_10408369 3300026035 Bacteria 1261
98 Ga0207639_10003203 3300026041 Bacteria 11003
99 Ga0207674_10203769 3300026116 Bacteria 1928
100 Ga0207698_10107639 3300026142 Bacteria 2328
101 Ga0207698_10335475 3300026142 Bacteria 1422
102 Ga0207428_10032234 3300027907 Bacteria 4312
103 Ga0207428_10058009 3300027907 Bacteria 3073
104 Ga0265338_10005691 3300028800 Bacteria 16122
105 Ga0265762_1012519 3300030760 Bacteria 1522
106 Ga0265330_10005976 3300031235 Bacteria 6025
107 Ga0265330_10068425 3300031235 Bacteria 1538
108 Ga0265328_10020485 3300031239 Bacteria 2531
109 Ga0265325_10018656 3300031241 Bacteria 3847
110 Ga0265329_10006913 3300031242 Bacteria 4440
111 Ga0265340_10000180 3300031247 Bacteria 32042
112 Ga0265339_10002123 3300031249 Bacteria 14448
113 Ga0265339_10003958 3300031249 Bacteria 10240
114 Ga0265331_10108498 3300031250 Bacteria 1274
115 Ga0265316_10028833 3300031344 Bacteria 4573
116 Ga0265313_10000063 3300031595 Bacteria 104056
117 Ga0265313_10002147 3300031595 Bacteria 17547
118 Ga0307508_10206517 3300031616 Bacteria 1565
119 Ga0265314_10051940 3300031711 Bacteria 2852
120 Ga0265342_10002641 3300031712 Bacteria 15322
121 Ga0373931_0024336 3300035691 Bacteria 3067
122 Ga0373935_0018354 3300035692 Bacteria 4254
123 Ga0373927_0007110 3300035695 Bacteria 7594
124 Ga0373947_0004987 3300035725 Bacteria 7771
125 Ga0373947_0026195 3300035725 Bacteria 3406
126 Ga0373937_0056189 3300036401 Bacteria 3614
127 Ga0373925_0027789 3300037068 Bacteria 4141
128 Ga0395899_0009432 3300037312 Bacteria 7495
129 Ga0395900_0010360 3300037418 Bacteria 9537
130 Ga0395898_0007300 3300037466 Bacteria 11732
131 Ga0395905_0003591 3300037471 Bacteria 16501
132 Ga0436364_0106318 3300037853 Bacteria 6422
133 Ga0436364_1485631 3300037853 Bacteria 1963
134 Ga0395901_0021221 3300038443 Bacteria 6652
135 Ga0436361_0200318 3300039447 Bacteria 12914
136 Ga0436361_0525993 3300039447 Bacteria 3957
137 Ga0436363_0673017 3300039450 Bacteria 4195
138 Ga0436362_0400342 3300039453 Bacteria 1471
139 Ga0436362_1304758 3300039453 Bacteria 2332
140 Ga0439453_0001608 3300041408 Bacteria 2941
141 Ga0495592_0030809 3300046454 Bacteria 4058
142 Ga0495629_0053566 3300046459 Bacteria 2822
143 Ga0495653_0094700 3300046463 Bacteria 2175
144 Ga0495639_0049681 3300046475 Bacteria 1904
145 Ga0495662_0000496 3300046476 Bacteria 17907
146 Ga0495664_0000566 3300046477 Bacteria 18617
147 Ga0495618_0000768 3300046514 Bacteria 22434
148 Ga0495652_0036398 3300046529 Bacteria 4280
149 Ga0495665_0038460 3300046531 Bacteria 2550
150 Ga0495640_0006102 3300046533 Bacteria 9552
151 Ga0495640_0061310 3300046533 Bacteria 2555
152 Ga0495586_0018616 3300046535 Bacteria 3698
153 Ga0495645_0000610 3300046543 Bacteria 24662
154 Ga0495634_0001422 3300046642 Bacteria 21356
155 Ga0495634_0201802 3300046642 Bacteria 1235
156 Ga0495635_0001235 3300046663 Bacteria 17097
157 Ga0495658_0228221 3300046683 Bacteria 1167
158 Ga0495624_0047314 3300046690 Bacteria 2733
159 Ga0495674_0000895 3300047319 Bacteria 28524
160 Ga0495674_0250098 3300047319 Bacteria 1459
161 Ga0495683_0131377 3300047323 Bacteria 1181
162 Ga0495684_0003808 3300047471 Bacteria 11756
163 Ga0496101_0075028 3300048904 Bacteria 2489
164 Ga0496102_0004383 3300048905 Bacteria 11923
165 Ga0496103_0004389 3300048906 Bacteria 8560
166 Ga0496104_0000349 3300048907 Bacteria 41342
167 Ga0496104_0004721 3300048907 Bacteria 11859
168 Ga0496104_0136220 3300048907 Bacteria 2359
169 Ga0496105_0000058 3300048908 Bacteria 87226
170 Ga0496105_0003205 3300048908 Bacteria 12047
171 Ga0496105_0098371 3300048908 Bacteria 2416
172 Ga0496106_0015055 3300048909 Bacteria 5723
173 Ga0496107_0103341 3300048910 Bacteria 2090
174 Ga0496108_0004327 3300048911 Bacteria 11413
175 Ga0496108_0129017 3300048911 Bacteria 2173
176 Ga0496109_0003355 3300048912 Bacteria 13395
177 Ga0496110_0003749 3300048913 Bacteria 11704
178 Ga0496110_0032690 3300048913 Bacteria 4496
179 Ga0496111_0005961 3300048914 Bacteria 7863
180 Ga0496111_0181400 3300048914 Bacteria 1565
181 Ga0496112_0001834 3300048915 Bacteria 16719
182 Ga0496112_0023059 3300048915 Bacteria 5940
183 Ga0496112_0416868 3300048915 Bacteria 1282
184 Ga0496113_0003350 3300048916 Bacteria 9567
185 Ga0496113_0007137 3300048916 Bacteria 7156
186 Ga0496114_0053191 3300048917 Bacteria 3375
187 Ga0496115_0015223 3300048918 Bacteria 5830
188 Ga0496115_0250492 3300048918 Bacteria 1458
189 Ga0496119_0001924 3300048922 Bacteria 23705
190 Ga0501031_0048924 3300049568 Bacteria 2755
191 Ga0501032_0058997 3300049569 Bacteria 2575
192 Ga0501033_0013714 3300049570 Bacteria 6165
193 Ga0501034_0005959 3300049571 Bacteria 13194
194 Ga0501036_0005364 3300049572 Bacteria 10381
195 Ga0501036_0025955 3300049572 Bacteria 4944
196 Ga0501036_0157934 3300049572 Bacteria 1912
197 Ga0501037_0021516 3300049573 Bacteria 4768
198 Ga0501038_0004903 3300049574 Bacteria 12431
199 Ga0501038_0023048 3300049574 Bacteria 5571
200 Ga0501038_0096279 3300049574 Bacteria 2471
201 Ga0501039_0032086 3300049575 Bacteria 4049
202 Ga0501039_0034430 3300049575 Bacteria 3908
203 Ga0501042_0008578 3300049578 Bacteria 6761
204 Ga0501047_0012980 3300049581 Bacteria 7888
205 Ga0501047_0044636 3300049581 Bacteria 4283
206 Ga0501047_0066844 3300049581 Bacteria 3465
207 Ga0501047_0226250 3300049581 Bacteria 1725
208 Ga0501048_0006829 3300049582 Bacteria 8669
209 Ga0501068_0138148 3300049584 Bacteria 1527
210 Ga0501069_0112546 3300049585 Bacteria 1551
211 Ga0501070_0002835 3300049586 Bacteria 15126
212 Ga0501070_0075914 3300049586 Bacteria 2782
213 Ga0501070_0085986 3300049586 Bacteria 2603
214 Ga0501071_0004116 3300049587 Bacteria 9195
215 Ga0501072_0110501 3300049588 Bacteria 2188
216 Ga0501073_0011030 3300049589 Bacteria 6611
217 Ga0501073_0028942 3300049589 Bacteria 3958
218 Ga0501074_0074636 3300049590 Bacteria 2435
219 Ga0501076_0081313 3300049592 Bacteria 2601
220 Ga0501080_0009499 3300049742 Bacteria 8874
221 Ga0501080_0021360 3300049742 Bacteria 5992
222 Ga0501035_0008120 3300049822 Bacteria 9782
223 Ga0501035_0248165 3300049822 Bacteria 1512
224 Ga0501044_0015260 3300049823 Bacteria 8275
225 Ga0501044_0275445 3300049823 Bacteria 1617
226 Ga0501045_0020754 3300049824 Bacteria 4694
227 nmdc:mga00v17_76737_c1 3300050491 Bacteria 2079
228 nmdc:mga05p37_41790_c1 3300050507 Bacteria 5630
229 nmdc:mga05p37_51_c1 3300050507 Bacteria 103396
230 nmdc:mga0qj67_10675_c1 3300050509 Bacteria 6864
231 nmdc:mga06r32_16_c1 3300050510 Bacteria 101899
232 nmdc:mga06r32_510344_c1 3300050510 Bacteria 1179
233 nmdc:mga06r32_89815_c1 3300050510 Bacteria 3000
234 nmdc:mga08y16_38233_c1 3300050511 Bacteria 5040
235 nmdc:mga08y16_79_c2 3300050511 Bacteria 54400
236 nmdc:mga0n895_20190_c1 3300050512 Bacteria 6209
237 nmdc:mga0rr50_61931_c1 3300050513 Bacteria 2821
238 nmdc:mga08x19_37387_c1 3300050514 Bacteria 3080
239 nmdc:mga0a205_33096_c1 3300050515 Bacteria 4958
240 Ga0495601_0000662 3300053077 Bacteria 18374
241 Ga0495601_0102635 3300053077 Bacteria 1848
242 Ga0495612_0000165 3300053078 Bacteria 27544
243 Ga0495619_0002588 3300053085 Bacteria 11823
244 Ga0495619_0018124 3300053085 Bacteria 4464
245 Ga0495619_0080961 3300053085 Bacteria 2186
246 Ga0500616_0002139 3300053153 Bacteria 17096
247 Ga0466968_0025647
248 JGI25405J52794_10004879
249 Ga0070670_100210148
250 Ga0070661_100061146
251 Ga0070675_100199624
252 Ga0070713_100007460
253 Ga0070713_100013069
254 Ga0070713_100025617
255 Ga0070713_100030406
256 Ga0070713_100079126
257 Ga0070710_10042117
258 Ga0070711_100017123
259 Ga0070681_10018025
260 Ga0070681_10380190
261 Ga0070699_100007114
262 Ga0070679_100252098
263 Ga0070684_100183270
264 Ga0068853_100002733
265 Ga0068853_100303688
266 Ga0070664_100161611
267 Ga0068857_100350224
268 Ga0068854_100003619
269 Ga0068852_100198086
270 Ga0068864_100049908
271 Ga0068851_10001321
272 Ga0068858_100250552
273 Ga0081455_10002919
274 Ga0081455_10049342
275 Ga0070717_10004117
276 Ga0070717_10076984
277 Ga0070717_10252118
278 Ga0075432_10004847
279 Ga0075428_100005459
280 Ga0075428_100069729
281 Ga0075428_100241243
282 Ga0075428_100298542
283 Ga0075431_100000469
284 Ga0075431_100100224
285 Ga0075431_100112337
286 Ga0075433_10058103
287 Ga0075434_100061918
288 Ga0075429_100011527
289 Ga0075436_100038608
290 Ga0075436_100086653
291 Ga0075435_100007924
292 Ga0099794_10002565
293 Ga0105240_10011415
294 Ga0105240_10051846
295 Ga0105240_10299095
296 Ga0111539_10000072
297 Ga0111539_10026442
298 Ga0111539_10210922
299 Ga0105247_10094509
300 Ga0114129_10000134
301 Ga0114129_10020471
302 Ga0114129_10209177
303 Ga0105237_10037831
304 Ga0105237_10147478
305 Ga0105238_10077814
306 Ga0105238_10087860
307 Ga0105239_10041487
308 Ga0105239_10231119
309 Ga0157369_10075486
310 Ga0163162_10176986
311 Ga0157372_10163935
312 Ga0157379_10195371
313 Ga0157379_10334942
314 Ga0213872_10013585
315 Ga0207656_10008277
316 Ga0207653_10005558
317 Ga0207692_10117182
318 Ga0207699_10096997
319 Ga0207684_10054203
320 Ga0207654_10017632
321 Ga0207707_10052233
322 Ga0207695_10045016
323 Ga0207695_10055047
324 Ga0207695_10208155
325 Ga0207671_10043823
326 Ga0207693_10098754
327 Ga0207693_10120696
328 Ga0207663_10050086
329 Ga0207649_10021909
330 Ga0207649_10229573
331 Ga0207646_10054955
332 Ga0207694_10127294
333 Ga0207650_10009782
334 Ga0207700_10026232
335 Ga0207700_10081171
336 Ga0207664_10010038
337 Ga0207664_10366308
338 Ga0207706_10112853
339 Ga0207665_10021523
340 Ga0207679_10073633
341 Ga0207667_10014281
342 Ga0207640_10010542
343 Ga0207703_10408369
344 Ga0207639_10003203
345 Ga0207674_10203769
346 Ga0207698_10107639
347 Ga0207698_10335475
348 Ga0207428_10032234
349 Ga0207428_10058009
350 Ga0265338_10005691
351 Ga0265762_1012519
352 Ga0265330_10005976
353 Ga0265330_10068425
354 Ga0265328_10020485
355 Ga0265325_10018656
356 Ga0265329_10006913
357 Ga0265340_10000180
358 Ga0265339_10002123
359 Ga0265339_10003958
360 Ga0265331_10108498
361 Ga0265316_10028833
362 Ga0265313_10000063
363 Ga0265313_10002147
364 Ga0307508_10206517
365 Ga0265314_10051940
366 Ga0265342_10002641
367 Ga0373931_0024336
368 Ga0373935_0018354
369 Ga0373927_0007110
370 Ga0373947_0004987
371 Ga0373947_0026195
372 Ga0373937_0056189
373 Ga0373925_0027789
374 Ga0395899_0009432
375 Ga0395900_0010360
376 Ga0395898_0007300
377 Ga0395905_0003591
378 Ga0436364_0106318
379 Ga0436364_1485631
380 Ga0395901_0021221
381 Ga0436361_0200318
382 Ga0436361_0525993
383 Ga0436363_0673017
384 Ga0436362_0400342
385 Ga0436362_1304758
386 Ga0439453_0001608
387 Ga0495592_0030809
388 Ga0495629_0053566
389 Ga0495653_0094700
390 Ga0495639_0049681
391 Ga0495662_0000496
392 Ga0495664_0000566
393 Ga0495618_0000768
394 Ga0495652_0036398
395 Ga0495665_0038460
396 Ga0495640_0006102
397 Ga0495640_0061310
398 Ga0495586_0018616
399 Ga0495645_0000610
400 Ga0495634_0001422
401 Ga0495634_0201802
402 Ga0495635_0001235
403 Ga0495658_0228221
404 Ga0495624_0047314
405 Ga0495674_0000895
406 Ga0495674_0250098
407 Ga0495683_0131377
408 Ga0495684_0003808
409 Ga0496101_0075028
410 Ga0496102_0004383
411 Ga0496103_0004389
412 Ga0496104_0000349
413 Ga0496104_0004721
414 Ga0496104_0136220
415 Ga0496105_0000058
416 Ga0496105_0003205
417 Ga0496105_0098371
418 Ga0496106_0015055
419 Ga0496107_0103341
420 Ga0496108_0004327
421 Ga0496108_0129017
422 Ga0496109_0003355
423 Ga0496110_0003749
424 Ga0496110_0032690
425 Ga0496111_0005961
426 Ga0496111_0181400
427 Ga0496112_0001834
428 Ga0496112_0023059
429 Ga0496112_0416868
430 Ga0496113_0003350
431 Ga0496113_0007137
432 Ga0496114_0053191
433 Ga0496115_0015223
434 Ga0496115_0250492
435 Ga0496119_0001924
436 Ga0501031_0048924
437 Ga0501032_0058997
438 Ga0501033_0013714
439 Ga0501034_0005959
440 Ga0501036_0005364
441 Ga0501036_0025955
442 Ga0501036_0157934
443 Ga0501037_0021516
444 Ga0501038_0004903
445 Ga0501038_0023048
446 Ga0501038_0096279
447 Ga0501039_0032086
448 Ga0501039_0034430
449 Ga0501042_0008578
450 Ga0501047_0012980
451 Ga0501047_0044636
452 Ga0501047_0066844
453 Ga0501047_0226250
454 Ga0501048_0006829
455 Ga0501068_0138148
456 Ga0501069_0112546
457 Ga0501070_0002835
458 Ga0501070_0075914
459 Ga0501070_0085986
460 Ga0501071_0004116
461 Ga0501072_0110501
462 Ga0501073_0011030
463 Ga0501073_0028942
464 Ga0501074_0074636
465 Ga0501076_0081313
466 Ga0501080_0009499
467 Ga0501080_0021360
468 Ga0501035_0008120
469 Ga0501035_0248165
470 Ga0501044_0015260
471 Ga0501044_0275445
472 Ga0501045_0020754
473 nmdc:mga00v17_76737_c1
474 nmdc:mga05p37_41790_c1
475 nmdc:mga05p37_51_c1
476 nmdc:mga0qj67_10675_c1
477 nmdc:mga06r32_16_c1
478 nmdc:mga06r32_510344_c1
479 nmdc:mga06r32_89815_c1
480 nmdc:mga08y16_38233_c1
481 nmdc:mga08y16_79_c2
482 nmdc:mga0n895_20190_c1
483 nmdc:mga0rr50_61931_c1
484 nmdc:mga08x19_37387_c1
485 nmdc:mga0a205_33096_c1
486 Ga0495601_0000662
487 Ga0495601_0102635
488 Ga0495612_0000165
489 Ga0495619_0002588
490 Ga0495619_0018124
491 Ga0495619_0080961
492 Ga0500616_0002139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

5

283

0.87

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

9

287

0.84

PF12727

PBP_like

PBP superfamily domain

28

222

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9552 25 337
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9523 25 337
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.9426 25 337
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.9369 25 337
1quj-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate 0.9363 25 345
ID Description Score Start End Superfamily
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9541 100 276 3.40.190.10
5i84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9465 25 337 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9435 100 276 3.40.190.10
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9417 102 275 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9374 101 276 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A530BRS6-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.993 204 348
AF-A0A4S1FX25-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9917 113 218
AF-A0A530BRS6-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9862 204 348
AF-A0A257ZV96-F1-model_v4 Phosphate-binding protein PstS 0.9845 126 345 GO:0035435
GO:0042301
GO:0043190
AF-J5KYC1-F1-model_v4 deleted 0.984 219 346

Map