F359050

General Info

Members Datasets Scaffolds Average Seq Length
247 151 494 137

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10566233|Ga0207688_105662332
Length 128
Sequence MPSDCLFCKIVGGEIPATVVREDERTVAFMDINPATRGHLLVIPRAHAANLLEIGGDDLALAALVTDRLGADGVNLMNSCGRDAWQTVFHFHIHVIPRYAGDPLRLPWTPAPGDRDEIAAAAAALTRS

Samples

Sample ID Description Type Environment
1 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
148 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
151 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 7.69
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207688_10566233 3300025901 Bacteria 715
2 Ga0070683_100000151 3300005329 Bacteria 44735
3 Ga0070683_100415226 3300005329 Bacteria 1283
4 Ga0070670_100443048 3300005331 Bacteria 1150
5 Ga0070680_100522608 3300005336 Bacteria 1016
6 Ga0070682_100617835 3300005337 Bacteria 858
7 Ga0070661_101290394 3300005344 Bacteria 612
8 Ga0070674_100681674 3300005356 Bacteria 877
9 Ga0070674_101747465 3300005356 Bacteria 563
10 Ga0070673_101173073 3300005364 Bacteria 719
11 Ga0070688_100088506 3300005365 Bacteria 2019
12 Ga0070659_100101082 3300005366 Bacteria 2321
13 Ga0070714_100014742 3300005435 Bacteria 6283
14 Ga0070714_100016225 3300005435 Bacteria 6007
15 Ga0070714_100177581 3300005435 Bacteria 1936
16 Ga0070713_100813400 3300005436 Bacteria 896
17 Ga0070710_10000008 3300005437 Bacteria 198148
18 Ga0070710_10355497 3300005437 Bacteria 971
19 Ga0070711_101309771 3300005439 Bacteria 629
20 Ga0070700_100822097 3300005441 Bacteria 750
21 Ga0070663_100642292 3300005455 Bacteria 897
22 Ga0070678_101390429 3300005456 Bacteria 655
23 Ga0070662_100103807 3300005457 Bacteria 2156
24 Ga0070684_100000216 3300005535 Bacteria 40342
25 Ga0070684_100360561 3300005535 Bacteria 1338
26 Ga0070672_100791550 3300005543 Bacteria 834
27 Ga0070665_100822816 3300005548 Bacteria 942
28 Ga0070704_100175726 3300005549 Bacteria 1708
29 Ga0070704_101019598 3300005549 Bacteria 749
30 Ga0070664_100070379 3300005564 Bacteria 2996
31 Ga0068857_100014937 3300005577 Bacteria 6773
32 Ga0068856_100075046 3300005614 Bacteria 3349
33 Ga0070702_100921315 3300005615 Bacteria 686
34 Ga0068861_100110098 3300005719 Bacteria 2206
35 Ga0068861_101235562 3300005719 Bacteria 724
36 Ga0068861_101626175 3300005719 Bacteria 637
37 Ga0068870_10292676 3300005840 Bacteria 1025
38 Ga0068862_101789305 3300005844 Bacteria 623
39 Ga0081455_10019606 3300005937 Bacteria 6390
40 Ga0081455_10118837 3300005937 Bacteria 2086
41 Ga0081455_10678124 3300005937 Bacteria 660
42 Ga0081455_10717701 3300005937 Bacteria 635
43 Ga0081538_10003427 3300005981 Bacteria 14997
44 Ga0081538_10005481 3300005981 Bacteria 11401
45 Ga0081538_10039438 3300005981 Bacteria 3029
46 Ga0081538_10063174 3300005981 Bacteria 2104
47 Ga0081540_1001098 3300005983 Bacteria 23963
48 Ga0070717_10001047 3300006028 Bacteria 18556
49 Ga0070717_10038991 3300006028 Bacteria 3863
50 Ga0070717_10058030 3300006028 Bacteria 3200
51 Ga0075365_10650321 3300006038 Bacteria 745
52 Ga0075363_100365685 3300006048 Unclassified 844
53 Ga0075364_10172734 3300006051 Bacteria 1461
54 Ga0075364_10231376 3300006051 Bacteria 1255
55 Ga0070712_100061560 3300006175 Bacteria 2652
56 Ga0070712_100110340 3300006175 Bacteria 2051
57 Ga0075430_100006738 3300006846 Bacteria 9687
58 Ga0075431_100073086 3300006847 Bacteria 3538
59 Ga0075434_100541536 3300006871 Bacteria 1184
60 Ga0105240_12518877 3300009093 Bacteria 532
61 Ga0111539_11320077 3300009094 Bacteria 837
62 Ga0105245_10068231 3300009098 Bacteria 3222
63 Ga0105245_10140115 3300009098 Bacteria 2277
64 Ga0105245_10223846 3300009098 Bacteria 1817
65 Ga0105245_10744942 3300009098 Bacteria 1015
66 Ga0105243_10058588 3300009148 Bacteria 3069
67 Ga0105243_10163678 3300009148 Bacteria 1920
68 Ga0105242_10138067 3300009176 Bacteria 2112
69 Ga0105249_10428571 3300009553 Bacteria 1358
70 Ga0105249_13565641 3300009553 Bacteria 501
71 Ga0105239_12067207 3300010375 Bacteria 662
72 Ga0157369_11582284 3300013105 Bacteria 666
73 Ga0157369_11877430 3300013105 Bacteria 608
74 Ga0157378_13193202 3300013297 Bacteria 509
75 Ga0163162_11372029 3300013306 Bacteria 804
76 Ga0157372_12673389 3300013307 Bacteria 573
77 Ga0157375_12709220 3300013308 Bacteria 593
78 Ga0163163_11193607 3300014325 Bacteria 823
79 Ga0157380_10895294 3300014326 Bacteria 913
80 Ga0157380_12932731 3300014326 Bacteria 543
81 Ga0157376_12007084 3300014969 Bacteria 616
82 Ga0163161_10891446 3300017792 Bacteria 753
83 Ga0213876_10042757 3300021384 Bacteria 2394
84 Ga0213876_10095847 3300021384 Bacteria 1572
85 Ga0213875_10074488 3300021388 Bacteria 1584
86 Ga0213875_10086440 3300021388 Bacteria 1463
87 Ga0207692_10000034 3300025898 Bacteria 45780
88 Ga0207692_10607863 3300025898 Bacteria 703
89 Ga0207699_10297406 3300025906 Bacteria 1126
90 Ga0207643_10074362 3300025908 Bacteria 1960
91 Ga0207643_10342067 3300025908 Bacteria 938
92 Ga0207693_10065612 3300025915 Bacteria 2842
93 Ga0207693_10087109 3300025915 Bacteria 2447
94 Ga0207693_10251860 3300025915 Bacteria 1386
95 Ga0207660_10393273 3300025917 Bacteria 1116
96 Ga0207657_10321874 3300025919 Bacteria 1222
97 Ga0207650_10373261 3300025925 Bacteria 1177
98 Ga0207687_10229284 3300025927 Bacteria 1466
99 Ga0207700_10090667 3300025928 Bacteria 2413
100 Ga0207700_11127795 3300025928 Bacteria 701
101 Ga0207664_10000349 3300025929 Bacteria 33673
102 Ga0207690_10528615 3300025932 Bacteria 957
103 Ga0207706_10082086 3300025933 Bacteria 2833
104 Ga0207709_10132515 3300025935 Bacteria 1700
105 Ga0207704_10245403 3300025938 Bacteria 1341
106 Ga0207665_10144718 3300025939 Unclassified 1698
107 Ga0207665_10605956 3300025939 Bacteria 855
108 Ga0207691_10605582 3300025940 Bacteria 927
109 Ga0207661_10009068 3300025944 Bacteria 7129
110 Ga0207661_10338792 3300025944 Bacteria 1355
111 Ga0207679_10035861 3300025945 Bacteria 3513
112 Ga0207640_10496890 3300025981 Bacteria 1015
113 Ga0207677_10332211 3300026023 Bacteria 1267
114 Ga0207678_11309293 3300026067 Bacteria 641
115 Ga0207708_10287256 3300026075 Bacteria 1334
116 Ga0207708_11032170 3300026075 Bacteria 715
117 Ga0207702_10063082 3300026078 Bacteria 3168
118 Ga0207702_12129018 3300026078 Bacteria 550
119 Ga0207676_10556306 3300026095 Bacteria 1097
120 Ga0207674_10005442 3300026116 Bacteria 15122
121 Ga0207675_100255370 3300026118 Bacteria 1697
122 Ga0207675_101360778 3300026118 Bacteria 730
123 Ga0207675_102525535 3300026118 Bacteria 524
124 Ga0207698_11260494 3300026142 Bacteria 754
125 Ga0265338_10052629 3300028800 Bacteria 3650
126 Ga0265338_10134473 3300028800 Bacteria 1947
127 Ga0265327_10010195 3300031251 Bacteria 6641
128 Ga0265327_10216279 3300031251 Bacteria 863
129 Ga0307408_101234687 3300031548 Bacteria 698
130 Ga0307405_10504598 3300031731 Bacteria 970
131 Ga0307413_11408585 3300031824 Bacteria 613
132 Ga0307410_10208161 3300031852 Bacteria 1497
133 Ga0307406_10451842 3300031901 Bacteria 1031
134 Ga0307406_10600861 3300031901 Bacteria 907
135 Ga0307407_10007577 3300031903 Bacteria 4924
136 Ga0307407_10685861 3300031903 Bacteria 770
137 Ga0307412_10112400 3300031911 Bacteria 1947
138 Ga0307409_100016250 3300031995 Bacteria 4917
139 Ga0307416_100239935 3300032002 Bacteria 1755
140 Ga0307416_100531870 3300032002 Bacteria 1246
141 Ga0307414_10188317 3300032004 Bacteria 1667
142 Ga0307411_10071171 3300032005 Bacteria 2356
143 Ga0307411_10296336 3300032005 Bacteria 1295
144 Ga0307415_100067712 3300032126 Bacteria 2496
145 Ga0307415_100120904 3300032126 Bacteria 1963
146 Ga0307415_100448108 3300032126 Bacteria 1115
147 Ga0373934_0169510 3300035086 Bacteria 896
148 Ga0373941_0238740 3300035115 Bacteria 705
149 Ga0395900_0164475 3300037418 Bacteria 2262
150 Ga0395900_0405849 3300037418 Unclassified 1326
151 Ga0395900_0412332 3300037418 Bacteria 1313
152 Ga0395900_0435477 3300037418 Unclassified 1270
153 Ga0395900_0576159 3300037418 Bacteria 1068
154 Ga0395900_0988123 3300037418 Bacteria 762
155 Ga0395898_0039578 3300037466 Bacteria 4666
156 Ga0395898_0393496 3300037466 Bacteria 1321
157 Ga0395898_1045597 3300037466 Bacteria 751
158 Ga0395898_1190961 3300037466 Bacteria 693
159 Ga0395898_1773764 3300037466 Bacteria 539
160 Ga0395905_0530262 3300037471 Bacteria 1078
161 Ga0436364_0185151 3300037853 Bacteria 2606
162 Ga0436364_0426125 3300037853 Bacteria 1285
163 Ga0436364_0438652 3300037853 Bacteria 11637
164 Ga0436364_0516052 3300037853 Unclassified 700
165 Ga0395901_0318097 3300038443 Bacteria 1611
166 Ga0395901_1382239 3300038443 Bacteria 663
167 Ga0436365_0248021 3300039437 Bacteria 1872
168 Ga0436365_1454171 3300039437 Bacteria 2181
169 Ga0436361_0153275 3300039447 Bacteria 600
170 Ga0436362_0319236 3300039453 Bacteria 2625
171 Ga0436362_1168769 3300039453 Bacteria 763
172 Ga0466969_0353044 3300044656 Bacteria 666
173 Ga0466972_0367195 3300044658 Bacteria 674
174 Ga0466965_0049273 3300044683 Bacteria 2088
175 Ga0466965_0060700 3300044683 Bacteria 1889
176 Ga0466965_0876618 3300044683 Bacteria 522
177 Ga0466961_0828791 3300044693 Bacteria 552
178 Ga0466963_0002750 3300044694 Bacteria 9924
179 Ga0466963_0032254 3300044694 Bacteria 3391
180 Ga0466963_0079976 3300044694 Bacteria 2212
181 Ga0466963_0082894 3300044694 Bacteria 2174
182 Ga0466963_0266624 3300044694 Bacteria 1203
183 Ga0466963_0349972 3300044694 Bacteria 1040
184 Ga0466971_0028544 3300044719 Bacteria 2496
185 Ga0466971_0100801 3300044719 Bacteria 1327
186 Ga0466971_0573630 3300044719 Bacteria 561
187 Ga0466968_0084022 3300044735 Bacteria 1403
188 Ga0466970_0105215 3300044765 Bacteria 1539
189 Ga0466970_0888527 3300044765 Bacteria 524
190 Ga0466957_0003271 3300044842 Bacteria 8876
191 Ga0466957_0037550 3300044842 Bacteria 2917
192 Ga0466957_0455888 3300044842 Bacteria 882
193 Ga0466957_0525961 3300044842 Bacteria 822
194 Ga0466959_0891551 3300045049 Bacteria 593
195 Ga0466958_0001708 3300045836 Bacteria 10594
196 Ga0466958_0223333 3300045836 Bacteria 1202
197 Ga0466958_0330502 3300045836 Bacteria 980
198 Ga0466958_0444363 3300045836 Bacteria 839
199 Ga0466967_0000491 3300045976 Bacteria 19255
200 Ga0466967_0037656 3300045976 Bacteria 4141
201 Ga0466967_0042116 3300045976 Bacteria 3944
202 Ga0466967_0071230 3300045976 Bacteria 3112
203 Ga0466967_0099842 3300045976 Bacteria 2651
204 Ga0466967_0117499 3300045976 Bacteria 2452
205 Ga0466967_0286840 3300045976 Bacteria 1580
206 Ga0466967_0422765 3300045976 Bacteria 1299
207 Ga0495605_0094181 3300046474 Bacteria 1384
208 Ga0495664_0494490 3300046477 Bacteria 731
209 Ga0495631_0102429 3300046518 Bacteria 1232
210 Ga0495644_0393139 3300046523 Unclassified 548
211 Ga0495649_0303319 3300046694 Bacteria 813
212 Ga0495589_0357832 3300046794 Bacteria 672
213 Ga0495674_0915634 3300047319 Bacteria 676
214 Ga0496100_0787239 3300048903 Bacteria 745
215 Ga0496101_1432364 3300048904 Bacteria 539
216 Ga0496102_0005546 3300048905 Bacteria 10717
217 Ga0496103_0546951 3300048906 Bacteria 739
218 Ga0496106_0241333 3300048909 Bacteria 1444
219 Ga0496106_0277389 3300048909 Bacteria 1343
220 Ga0496107_0588560 3300048910 Bacteria 823
221 Ga0496109_0930076 3300048912 Bacteria 807
222 Ga0496109_1197508 3300048912 Bacteria 696
223 Ga0496110_0187697 3300048913 Bacteria 1877
224 Ga0496111_0024912 3300048914 Bacteria 4220
225 Ga0496111_0776095 3300048914 Bacteria 694
226 Ga0496112_0071853 3300048915 Bacteria 3420
227 Ga0496113_0375379 3300048916 Bacteria 1141
228 Ga0496113_0449142 3300048916 Bacteria 1036
229 Ga0496113_1240476 3300048916 Bacteria 581
230 Ga0496114_0116930 3300048917 Bacteria 2290
231 Ga0496114_0936802 3300048917 Bacteria 748
232 Ga0496114_1479850 3300048917 Bacteria 567
233 Ga0496124_0154239 3300048927 Bacteria 1798
234 nmdc:mga00v17_208113_c1 3300050491 Bacteria 1265
235 nmdc:mga00v17_214296_c1 3300050491 Bacteria 1246
236 nmdc:mga00v17_466675_c1 3300050491 Bacteria 819
237 nmdc:mga06r32_310458_c1 3300050510 Bacteria 1563
238 nmdc:mga08y16_853708_c1 3300050511 Bacteria 899
239 nmdc:mga0n895_937974_c1 3300050512 Bacteria 849
240 Ga0495601_0477079 3300053077 Bacteria 806
241 Ga0495655_0071652 3300053083 Bacteria 970
242 Ga0495655_0226449 3300053083 Bacteria 621
243 Ga0500554_011065 3300053102 Bacteria 2222
244 Ga0466962_0038359 3300061719 Bacteria 2294
245 Ga0466962_0112603 3300061719 Bacteria 1311
246 2515851074 2515154155 Bacteria 7985436
247 2816426075 2816332119 Bacteria 8120218
248 Ga0207688_10566233
249 Ga0070683_100000151
250 Ga0070683_100415226
251 Ga0070670_100443048
252 Ga0070680_100522608
253 Ga0070682_100617835
254 Ga0070661_101290394
255 Ga0070674_100681674
256 Ga0070674_101747465
257 Ga0070673_101173073
258 Ga0070688_100088506
259 Ga0070659_100101082
260 Ga0070714_100014742
261 Ga0070714_100016225
262 Ga0070714_100177581
263 Ga0070713_100813400
264 Ga0070710_10000008
265 Ga0070710_10355497
266 Ga0070711_101309771
267 Ga0070700_100822097
268 Ga0070663_100642292
269 Ga0070678_101390429
270 Ga0070662_100103807
271 Ga0070684_100000216
272 Ga0070684_100360561
273 Ga0070672_100791550
274 Ga0070665_100822816
275 Ga0070704_100175726
276 Ga0070704_101019598
277 Ga0070664_100070379
278 Ga0068857_100014937
279 Ga0068856_100075046
280 Ga0070702_100921315
281 Ga0068861_100110098
282 Ga0068861_101235562
283 Ga0068861_101626175
284 Ga0068870_10292676
285 Ga0068862_101789305
286 Ga0081455_10019606
287 Ga0081455_10118837
288 Ga0081455_10678124
289 Ga0081455_10717701
290 Ga0081538_10003427
291 Ga0081538_10005481
292 Ga0081538_10039438
293 Ga0081538_10063174
294 Ga0081540_1001098
295 Ga0070717_10001047
296 Ga0070717_10038991
297 Ga0070717_10058030
298 Ga0075365_10650321
299 Ga0075363_100365685
300 Ga0075364_10172734
301 Ga0075364_10231376
302 Ga0070712_100061560
303 Ga0070712_100110340
304 Ga0075430_100006738
305 Ga0075431_100073086
306 Ga0075434_100541536
307 Ga0105240_12518877
308 Ga0111539_11320077
309 Ga0105245_10068231
310 Ga0105245_10140115
311 Ga0105245_10223846
312 Ga0105245_10744942
313 Ga0105243_10058588
314 Ga0105243_10163678
315 Ga0105242_10138067
316 Ga0105249_10428571
317 Ga0105249_13565641
318 Ga0105239_12067207
319 Ga0157369_11582284
320 Ga0157369_11877430
321 Ga0157378_13193202
322 Ga0163162_11372029
323 Ga0157372_12673389
324 Ga0157375_12709220
325 Ga0163163_11193607
326 Ga0157380_10895294
327 Ga0157380_12932731
328 Ga0157376_12007084
329 Ga0163161_10891446
330 Ga0213876_10042757
331 Ga0213876_10095847
332 Ga0213875_10074488
333 Ga0213875_10086440
334 Ga0207692_10000034
335 Ga0207692_10607863
336 Ga0207699_10297406
337 Ga0207643_10074362
338 Ga0207643_10342067
339 Ga0207693_10065612
340 Ga0207693_10087109
341 Ga0207693_10251860
342 Ga0207660_10393273
343 Ga0207657_10321874
344 Ga0207650_10373261
345 Ga0207687_10229284
346 Ga0207700_10090667
347 Ga0207700_11127795
348 Ga0207664_10000349
349 Ga0207690_10528615
350 Ga0207706_10082086
351 Ga0207709_10132515
352 Ga0207704_10245403
353 Ga0207665_10144718
354 Ga0207665_10605956
355 Ga0207691_10605582
356 Ga0207661_10009068
357 Ga0207661_10338792
358 Ga0207679_10035861
359 Ga0207640_10496890
360 Ga0207677_10332211
361 Ga0207678_11309293
362 Ga0207708_10287256
363 Ga0207708_11032170
364 Ga0207702_10063082
365 Ga0207702_12129018
366 Ga0207676_10556306
367 Ga0207674_10005442
368 Ga0207675_100255370
369 Ga0207675_101360778
370 Ga0207675_102525535
371 Ga0207698_11260494
372 Ga0265338_10052629
373 Ga0265338_10134473
374 Ga0265327_10010195
375 Ga0265327_10216279
376 Ga0307408_101234687
377 Ga0307405_10504598
378 Ga0307413_11408585
379 Ga0307410_10208161
380 Ga0307406_10451842
381 Ga0307406_10600861
382 Ga0307407_10007577
383 Ga0307407_10685861
384 Ga0307412_10112400
385 Ga0307409_100016250
386 Ga0307416_100239935
387 Ga0307416_100531870
388 Ga0307414_10188317
389 Ga0307411_10071171
390 Ga0307411_10296336
391 Ga0307415_100067712
392 Ga0307415_100120904
393 Ga0307415_100448108
394 Ga0373934_0169510
395 Ga0373941_0238740
396 Ga0395900_0164475
397 Ga0395900_0405849
398 Ga0395900_0412332
399 Ga0395900_0435477
400 Ga0395900_0576159
401 Ga0395900_0988123
402 Ga0395898_0039578
403 Ga0395898_0393496
404 Ga0395898_1045597
405 Ga0395898_1190961
406 Ga0395898_1773764
407 Ga0395905_0530262
408 Ga0436364_0185151
409 Ga0436364_0426125
410 Ga0436364_0438652
411 Ga0436364_0516052
412 Ga0395901_0318097
413 Ga0395901_1382239
414 Ga0436365_0248021
415 Ga0436365_1454171
416 Ga0436361_0153275
417 Ga0436362_0319236
418 Ga0436362_1168769
419 Ga0466969_0353044
420 Ga0466972_0367195
421 Ga0466965_0049273
422 Ga0466965_0060700
423 Ga0466965_0876618
424 Ga0466961_0828791
425 Ga0466963_0002750
426 Ga0466963_0032254
427 Ga0466963_0079976
428 Ga0466963_0082894
429 Ga0466963_0266624
430 Ga0466963_0349972
431 Ga0466971_0028544
432 Ga0466971_0100801
433 Ga0466971_0573630
434 Ga0466968_0084022
435 Ga0466970_0105215
436 Ga0466970_0888527
437 Ga0466957_0003271
438 Ga0466957_0037550
439 Ga0466957_0455888
440 Ga0466957_0525961
441 Ga0466959_0891551
442 Ga0466958_0001708
443 Ga0466958_0223333
444 Ga0466958_0330502
445 Ga0466958_0444363
446 Ga0466967_0000491
447 Ga0466967_0037656
448 Ga0466967_0042116
449 Ga0466967_0071230
450 Ga0466967_0099842
451 Ga0466967_0117499
452 Ga0466967_0286840
453 Ga0466967_0422765
454 Ga0495605_0094181
455 Ga0495664_0494490
456 Ga0495631_0102429
457 Ga0495644_0393139
458 Ga0495649_0303319
459 Ga0495589_0357832
460 Ga0495674_0915634
461 Ga0496100_0787239
462 Ga0496101_1432364
463 Ga0496102_0005546
464 Ga0496103_0546951
465 Ga0496106_0241333
466 Ga0496106_0277389
467 Ga0496107_0588560
468 Ga0496109_0930076
469 Ga0496109_1197508
470 Ga0496110_0187697
471 Ga0496111_0024912
472 Ga0496111_0776095
473 Ga0496112_0071853
474 Ga0496113_0375379
475 Ga0496113_0449142
476 Ga0496113_1240476
477 Ga0496114_0116930
478 Ga0496114_0936802
479 Ga0496114_1479850
480 Ga0496124_0154239
481 nmdc:mga00v17_208113_c1
482 nmdc:mga00v17_214296_c1
483 nmdc:mga00v17_466675_c1
484 nmdc:mga06r32_310458_c1
485 nmdc:mga08y16_853708_c1
486 nmdc:mga0n895_937974_c1
487 Ga0495601_0477079
488 Ga0495655_0071652
489 Ga0495655_0226449
490 Ga0500554_011065
491 Ga0466962_0038359
492 Ga0466962_0112603
493 2515851074
494 2816426075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

12

101

0.93

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

4

102

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o0m-assembly1.cif.gz_A crystal structure of a zn-bound histidine triad family protein from mycobacterium smegmatis 0.9453 2 133
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9358 1 133
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9348 1 133
3imi-assembly2.cif.gz_C 2.01 angstrom resolution crystal structure of a hit family protein from bacillus anthracis str. 'ames ancestor' 0.9334 3 116
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9223 1 133
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9564 17 106 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9517 3 109 3.30.428.10
3o0mB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9499 3 133 3.30.428.10
af_F4K1R2_26_184_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9281 2 133 3.30.428.10
3ksvA01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9242 2 108 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A350TWM6-F1-model_v4 deleted 0.9836 2 103
AF-A0A2E5KGQ5-F1-model_v4 HIT family hydrolase 0.9813 3 109 GO:0009117
GO:0016787
AF-A0A838MGY5-F1-model_v4 HIT family protein 0.9808 4 109 GO:0003824
GO:0009117
AF-A0A3N5E9W3-F1-model_v4 HIT family protein 0.9772 2 105 GO:0003824
GO:0009117
AF-A0A846Q632-F1-model_v4 HIT domain-containing protein 0.9745 2 106 GO:0003824
GO:0009117

Map