F358992

General Info

Members Datasets Scaffolds Average Seq Length
247 179 244 213

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10016477|Ga0157373_100164776
Length 240
Sequence MFFNIFCGCVSFGPGNRQTGGKDMKIYWIKAQAPRRVLALVKHLGIDAQCIEVDLQVGGLKTSSYLALNPNGKAPTMVDGDVTLWESSAIMAYLCVKTGSDMWPVHRPAEQIEILRWLSWNDSHWSRAVGPFYFEHVIKPEFHLGEPDDSELTGAMPELMKLAAVLDDHLEQRDFVACGRLTIADFQLASMACDWRRSDMPLADFSHVVRWLDRLMDIPGWADPWPARVAGQPAPVLASA

Samples

Sample ID Description Type Environment
1 2739367700 Dyella sp. YR388 Isolate Unclassified
2 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
3 2928963466 Dyella japonica 1073 Isolate Unclassified
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
68 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
69 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
106 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
176 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
177 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
178 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
179 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 1.62
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.81
Nodule 0
Rhizoplane 3.64
Rhizosphere 65.59
Stem 0
Stem Tuber 0
Unclassified 12.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10031810 3300001989 Bacteria 1821
2 JGI24737J22298_10005270 3300001990 Bacteria 4472
3 JGI24735J21928_10005311 3300002067 Bacteria 4277
4 JGI25156J39149_1012477 3300002705 Bacteria 1864
5 JGI25162J39368_1000066 3300002737 Bacteria 130612
6 JGI25162J39368_1001441 3300002737 Bacteria 12720
7 JGI25162J39368_1002131 3300002737 Bacteria 8362
8 JGI25154J39366_1009578 3300002738 Bacteria 1185
9 JGI25157J39369_1000050 3300002741 Bacteria 114470
10 JGI25163J39215_1000224 3300002771 Bacteria 21198
11 JGI25164J39214_1000056 3300002772 Bacteria 114468
12 JGI25164J39214_1000923 3300002772 Bacteria 9729
13 JGI25151J46595_10000008 3300003187 Bacteria 334180
14 JGI25165J46597_1000009 3300003214 Bacteria 467965
15 JGI25165J46597_1001435 3300003214 Bacteria 12752
16 rootH1_10095801 3300003316 Bacteria 2793
17 rootH1_10142730 3300003316 Bacteria 1582
18 rootH2_10094653 3300003320 Bacteria 3795
19 rootH1_10045431 3300003323 Bacteria 4678
20 Ga0055538_1000797 3300003751 Bacteria 8653
21 Ga0055533_1000225 3300003756 Bacteria 38201
22 Ga0055527_1010872 3300003760 Bacteria 1046
23 Ga0055535_1000045 3300003761 Bacteria 140688
24 Ga0055542_1000079 3300003762 Bacteria 130623
25 Ga0055542_1001057 3300003762 Bacteria 17067
26 Ga0055529_1000122 3300003763 Bacteria 114462
27 Ga0065712_10247310 3300005290 Bacteria 968
28 Ga0070680_100504376 3300005336 Bacteria 1035
29 Ga0070689_100001372 3300005340 Bacteria 15465
30 Ga0070688_100026082 3300005365 Bacteria 3468
31 Ga0070667_100259930 3300005367 Bacteria 1554
32 Ga0070714_100000439 3300005435 Bacteria 30200
33 Ga0070714_100250378 3300005435 Bacteria 1638
34 Ga0070710_10084295 3300005437 Bacteria 1862
35 Ga0070663_100246073 3300005455 Bacteria 1414
36 Ga0070681_10141804 3300005458 Bacteria 2332
37 Ga0070681_10380868 3300005458 Bacteria 1321
38 Ga0070706_100794391 3300005467 Bacteria 876
39 Ga0070679_100073735 3300005530 Bacteria 3404
40 Ga0068853_100004383 3300005539 Bacteria 10927
41 Ga0070665_100125118 3300005548 Bacteria 2573
42 Ga0068855_100020705 3300005563 Bacteria 7887
43 Ga0068855_100024004 3300005563 Bacteria 7300
44 Ga0068857_100160143 3300005577 Bacteria 2042
45 Ga0068856_100327681 3300005614 Unclassified 1549
46 Ga0068859_100588478 3300005617 Bacteria 1206
47 Ga0068864_100092570 3300005618 Bacteria 2669
48 Ga0068861_101073872 3300005719 Bacteria 772
49 Ga0068863_100008424 3300005841 Bacteria 10068
50 Ga0068863_100014125 3300005841 Bacteria 7692
51 Ga0068860_100323214 3300005843 Bacteria 1515
52 Ga0068860_100649911 3300005843 Bacteria 1062
53 Ga0068862_100028987 3300005844 Bacteria 4663
54 Ga0070717_10002605 3300006028 Bacteria 12717
55 Ga0070716_100208573 3300006173 Bacteria 1304
56 Ga0070712_100084695 3300006175 Bacteria 2306
57 Ga0075366_10046140 3300006195 Bacteria 2582
58 Ga0097620_100588502 3300006931 Bacteria 1206
59 Ga0099794_10272055 3300007265 Bacteria 875
60 Ga0105240_10000123 3300009093 Bacteria 160908
61 Ga0105240_10001969 3300009093 Bacteria 33947
62 Ga0105238_10051483 3300009551 Bacteria 4142
63 Ga0105249_10054035 3300009553 Bacteria 3672
64 Ga0105249_10060375 3300009553 Bacteria 3478
65 Ga0105249_10267044 3300009553 Bacteria 1703
66 Ga0105148_107405 3300009978 Bacteria 814
67 Ga0105239_10000090 3300010375 Bacteria 127911
68 Ga0105239_10006908 3300010375 Bacteria 13093
69 Ga0157373_10016477 3300013100 Bacteria 5390
70 Ga0157373_10024546 3300013100 Bacteria 4366
71 Ga0157371_10689008 3300013102 Bacteria 764
72 Ga0157370_10021678 3300013104 Bacteria 6401
73 Ga0157369_10111073 3300013105 Bacteria 2913
74 Ga0157369_10113603 3300013105 Bacteria 2877
75 Ga0157375_10667723 3300013308 Bacteria 1195
76 Ga0163163_10692235 3300014325 Bacteria 1083
77 Ga0182008_10031586 3300014497 Bacteria 2665
78 Ga0182008_10038537 3300014497 Bacteria 2390
79 Ga0157376_10044260 3300014969 Bacteria 3658
80 Ga0182006_1027564 3300015261 Bacteria 2317
81 Ga0182007_10065485 3300015262 Bacteria 1191
82 Ga0183369_1003 3300015685 Bacteria 726443
83 Ga0183368_1002 3300015687 Bacteria 1865598
84 Ga0209760_100327 3300025207 Bacteria 14335
85 Ga0209784_100013 3300025224 Bacteria 518664
86 Ga0209674_100014 3300025226 Bacteria 704989
87 Ga0209672_102696 3300025228 Bacteria 4129
88 Ga0207427_100030 3300025231 Bacteria 358045
89 Ga0207427_100101 3300025231 Bacteria 120866
90 Ga0207427_100645 3300025231 Bacteria 16905
91 Ga0209437_100012 3300025233 Bacteria 792625
92 Ga0209437_100090 3300025233 Bacteria 247138
93 Ga0209437_100162 3300025233 Bacteria 147864
94 Ga0209258_100019 3300025242 Bacteria 566728
95 Ga0209258_101702 3300025242 Bacteria 6875
96 Ga0209258_101890 3300025242 Bacteria 6245
97 Ga0209646_1000901 3300025246 Bacteria 9637
98 Ga0209646_1018212 3300025246 Bacteria 1030
99 Ga0209026_1000015 3300025250 Bacteria 395555
100 Ga0209148_1000001 3300025254 Bacteria 2545271
101 Ga0209148_1000005 3300025254 Bacteria 1806504
102 Ga0209759_1000367 3300025256 Bacteria 56530
103 Ga0209759_1005419 3300025256 Bacteria 4476
104 Ga0209233_1000002 3300025261 Bacteria 2501366
105 Ga0209233_1000077 3300025261 Bacteria 349570
106 Ga0209233_1015675 3300025261 Bacteria 2106
107 Ga0209455_1000027 3300025272 Bacteria 566710
108 Ga0209455_1008483 3300025272 Bacteria 2789
109 Ga0207692_10165376 3300025898 Bacteria 1278
110 Ga0207647_10007558 3300025904 Bacteria 7841
111 Ga0207684_10731067 3300025910 Bacteria 840
112 Ga0207695_10000312 3300025913 Bacteria 117260
113 Ga0207695_10004667 3300025913 Bacteria 18566
114 Ga0207693_10265965 3300025915 Bacteria 1344
115 Ga0207650_10613026 3300025925 Bacteria 916
116 Ga0207664_10003938 3300025929 Bacteria 9986
117 Ga0207670_10001001 3300025936 Bacteria 14944
118 Ga0207665_10100577 3300025939 Bacteria 2017
119 Ga0207711_10444847 3300025941 Bacteria 1206
120 Ga0207667_10033630 3300025949 Bacteria 5511
121 Ga0207667_10318750 3300025949 Bacteria 1588
122 Ga0207712_10305773 3300025961 Bacteria 1307
123 Ga0207639_10018371 3300026041 Bacteria 4968
124 Ga0207678_10302241 3300026067 Bacteria 1375
125 Ga0207678_10345499 3300026067 Bacteria 1283
126 Ga0207641_10015688 3300026088 Bacteria 6208
127 Ga0207676_10088590 3300026095 Bacteria 2534
128 Ga0207674_10223282 3300026116 Bacteria 1832
129 Ga0207675_100797920 3300026118 Bacteria 957
130 Ga0265354_1001019 3300028016 Bacteria 4366
131 Ga0268266_10096622 3300028379 Bacteria 2597
132 Ga0268265_10405183 3300028380 Bacteria 1262
133 Ga0268265_10526578 3300028380 Bacteria 1118
134 Ga0268264_10099137 3300028381 Bacteria 2528
135 Ga0265338_10037137 3300028800 Bacteria 4644
136 Ga0314311_1039021 3300030733 Unclassified 849
137 Ga0265762_1009026 3300030760 Bacteria 1777
138 Ga0265770_1000051 3300030878 Bacteria 12358
139 Ga0265760_10000676 3300031090 Bacteria 9709
140 Ga0265760_10137667 3300031090 Bacteria 793
141 Ga0265332_10139775 3300031238 Bacteria 1015
142 Ga0265340_10003708 3300031247 Bacteria 8602
143 Ga0265339_10000783 3300031249 Bacteria 24576
144 Ga0307408_100024038 3300031548 Bacteria 4156
145 Ga0265342_10000224 3300031712 Bacteria 64135
146 Ga0307516_10000288 3300031730 Bacteria 65317
147 Ga0307516_10044582 3300031730 Bacteria 4386
148 Ga0307405_10091603 3300031731 Bacteria 2015
149 Ga0307406_10000553 3300031901 Bacteria 21521
150 Ga0307406_10041090 3300031901 Bacteria 2880
151 Ga0373936_0003382 3300035113 Bacteria 5979
152 Ga0373933_0046371 3300035724 Plasmid 2581
153 Ga0395899_0108427 3300037312 Bacteria 1998
154 Ga0395899_0210331 3300037312 Bacteria 1352
155 Ga0395900_0000439 3300037418 Bacteria 59811
156 Ga0395900_0153517 3300037418 Bacteria 2352
157 Ga0395898_0000853 3300037466 Bacteria 50024
158 Ga0395898_0106722 3300037466 Bacteria 2686
159 Ga0395905_0000038 3300037471 Bacteria 253600
160 Ga0395905_0059133 3300037471 Bacteria 3583
161 Ga0436364_0534772 3300037853 Bacteria 5313
162 Ga0395901_0009119 3300038443 Bacteria 10047
163 Ga0439436_0004537 3300041404 Bacteria 4258
164 Ga0439436_0015169 3300041404 Unclassified 2319
165 Ga0451793_1918916 3300041452 Unclassified 1548
166 Ga0451807_0167431 3300041486 Unclassified 2241
167 Ga0439431_0090554 3300041997 Bacteria 833
168 Ga0439445_0000859 3300042004 Bacteria 6443
169 Ga0439448_0053532 3300042005 Bacteria 1325
170 Ga0439455_0030757 3300042012 Bacteria 1334
171 Ga0466959_0050907 3300045049 Bacteria 3040
172 Ga0451576_0813521 3300045051 Bacteria 981
173 Ga0495629_0279562 3300046459 Unclassified 1146
174 Ga0495638_0000650 3300046460 Bacteria 38037
175 Ga0495638_0000657 3300046460 Bacteria 37781
176 Ga0495650_0000849 3300046471 Bacteria 36705
177 Ga0495606_0002283 3300046507 Bacteria 22684
178 Ga0495652_0004657 3300046529 Bacteria 13082
179 Ga0495646_0006259 3300046680 Bacteria 7548
180 Ga0495658_0281919 3300046683 Bacteria 1049
181 Ga0495649_0011318 3300046694 Bacteria 5237
182 Ga0495649_0061144 3300046694 Bacteria 2025
183 Ga0495680_0071897 3300047322 Bacteria 2632
184 Ga0495679_101693 3300047446 Bacteria 798
185 Ga0496104_0338909 3300048907 Bacteria 1416
186 Ga0496105_0008837 3300048908 Bacteria 7847
187 Ga0496107_0063897 3300048910 Bacteria 2668
188 Ga0496115_0000170 3300048918 Bacteria 60309
189 Ga0496115_0001755 3300048918 Bacteria 15546
190 Ga0496115_0065038 3300048918 Bacteria 2945
191 Ga0496115_0153973 3300048918 Bacteria 1899
192 Ga0496116_0131303 3300048919 Bacteria 1427
193 Ga0496117_0036910 3300048920 Bacteria 3648
194 Ga0496117_0081225 3300048920 Bacteria 2128
195 Ga0496117_0084866 3300048920 Bacteria 2064
196 Ga0496118_0000779 3300048921 Bacteria 51068
197 Ga0496118_0012592 3300048921 Bacteria 8097
198 Ga0496118_0170480 3300048921 Bacteria 1330
199 Ga0496119_0000218 3300048922 Bacteria 81458
200 Ga0496120_0000322 3300048923 Bacteria 79400
201 Ga0496121_0000883 3300048924 Bacteria 54178
202 Ga0496121_0025126 3300048924 Bacteria 5667
203 Ga0496126_0002101 3300048929 Bacteria 27893
204 Ga0496126_0040031 3300048929 Bacteria 4346
205 Ga0496126_0220190 3300048929 Bacteria 1594
206 Ga0495678_025594 3300049459 Bacteria 2532
207 Ga0495682_0019181 3300049460 Bacteria 2573
208 Ga0501031_0046969 3300049568 Bacteria 2815
209 Ga0501032_0356779 3300049569 Bacteria 941
210 Ga0501033_0001461 3300049570 Bacteria 20955
211 Ga0501033_0128899 3300049570 Bacteria 1833
212 Ga0501033_0477453 3300049570 Bacteria 864
213 Ga0501034_0636595 3300049571 Bacteria 969
214 Ga0501036_0019026 3300049572 Bacteria 5762
215 Ga0501036_0197719 3300049572 Bacteria 1691
216 Ga0501037_0021419 3300049573 Bacteria 4776
217 Ga0501037_0215716 3300049573 Bacteria 1352
218 Ga0501038_0043788 3300049574 Bacteria 3891
219 Ga0501039_0075277 3300049575 Bacteria 2624
220 Ga0501043_0001543 3300049579 Bacteria 20071
221 Ga0501046_0432732 3300049580 Bacteria 947
222 Ga0501047_0118987 3300049581 Bacteria 2523
223 Ga0501047_0212492 3300049581 Bacteria 1792
224 Ga0501048_0057583 3300049582 Bacteria 2756
225 Ga0501070_0641564 3300049586 Bacteria 844
226 Ga0501225_0001030 3300049705 Bacteria 8743
227 Ga0501080_0149803 3300049742 Bacteria 2157
228 Ga0501035_0048793 3300049822 Bacteria 3795
229 Ga0501035_0250625 3300049822 Bacteria 1504
230 Ga0501035_0310692 3300049822 Bacteria 1326
231 Ga0501035_0320422 3300049822 Bacteria 1302
232 Ga0501035_0325620 3300049822 Bacteria 1290
233 Ga0501035_0480695 3300049822 Bacteria 1024
234 Ga0501044_0000183 3300049823 Bacteria 77954
235 Ga0501044_0077165 3300049823 Bacteria 3379
236 Ga0501044_0144769 3300049823 Bacteria 2363
237 Ga0501044_0448814 3300049823 Bacteria 1196
238 Ga0500643_024708 3300053087 Bacteria 1904
239 Ga0500555_010965 3300053103 Unclassified 2602
240 Ga0500595_005479 3300053119 Bacteria 5538
241 Ga0500564_011769 3300053138 Unclassified 3870
242 Ga0500636_0089523 3300053177 Bacteria 1764
243 Ga0500636_0259646 3300053177 Unclassified 880
244 Ga0500661_006428 3300055283 Unclassified 2186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100504376 Ga0070680_1005043762 201
2 3300005458 Ga0070681_10141804 Ga0070681_101418042 201
3 3300005458 Ga0070681_10380868 Ga0070681_103808682 201
4 3300005530 Ga0070679_100073735 Ga0070679_1000737356 201
5 3300005563 Ga0068855_100024004 Ga0068855_1000240049 201
6 3300013102 Ga0157371_10689008 Ga0157371_106890081 201
7 3300025949 Ga0207667_10318750 Ga0207667_103187502 201
8 3300026067 Ga0207678_10302241 Ga0207678_103022412 201
9 3300037418 Ga0395900_0000439 Ga0395900_0000439_24324_24929 201
10 3300037418 Ga0395900_0153517 Ga0395900_0153517_302_928 201
11 3300037466 Ga0395898_0106722 Ga0395898_0106722_1978_2583 201
12 3300037471 Ga0395905_0059133 Ga0395905_0059133_959_1657 201
13 3300046683 Ga0495658_0281919 Ga0495658_0281919_377_985 202
14 3300005455 Ga0070663_100246073 Ga0070663_1002460733 203
15 3300005539 Ga0068853_100004383 Ga0068853_1000043835 203
16 3300005563 Ga0068855_100020705 Ga0068855_1000207052 203
17 3300005577 Ga0068857_100160143 Ga0068857_1001601433 203
18 3300005841 Ga0068863_100008424 Ga0068863_1000084244 203
19 3300009553 Ga0105249_10267044 Ga0105249_102670441 203
20 3300010375 Ga0105239_10006908 Ga0105239_1000690813 203
21 3300025949 Ga0207667_10033630 Ga0207667_100336305 203
22 3300025961 Ga0207712_10305773 Ga0207712_103057733 203
23 3300026041 Ga0207639_10018371 Ga0207639_100183714 203
24 3300026067 Ga0207678_10345499 Ga0207678_103454992 203
25 3300026116 Ga0207674_10223282 Ga0207674_102232823 203
26 3300037312 Ga0395899_0210331 Ga0395899_0210331_534_1148 203
27 3300041452 Ga0451793_1918916 Ga0451793_1918916_501_1178 203
28 3300041486 Ga0451807_0167431 Ga0451807_0167431_752_1429 203
29 3300042005 Ga0439448_0053532 Ga0439448_0053532_352_966 203
30 3300053087 Ga0500643_024708 Ga0500643_024708_820_1431 203
31 3300042012 Ga0439455_0030757 Ga0439455_0030757_225_842 204
32 3300047322 Ga0495680_0071897 Ga0495680_0071897_154_768 204
33 3300053177 Ga0500636_0259646 Ga0500636_0259646_201_815 204
34 3300005290 Ga0065712_10247310 Ga0065712_102473101 205
35 3300005367 Ga0070667_100259930 Ga0070667_1002599303 205
36 3300005618 Ga0068864_100092570 Ga0068864_1000925702 205
37 3300005719 Ga0068861_101073872 Ga0068861_1010738721 205
38 3300005841 Ga0068863_100014125 Ga0068863_1000141256 205
39 3300005843 Ga0068860_100649911 Ga0068860_1006499112 205
40 3300005844 Ga0068862_100028987 Ga0068862_1000289872 205
41 3300009553 Ga0105249_10054035 Ga0105249_100540352 205
42 3300009553 Ga0105249_10060375 Ga0105249_100603753 205
43 3300013308 Ga0157375_10667723 Ga0157375_106677232 205
44 3300014325 Ga0163163_10692235 Ga0163163_106922352 205
45 3300025925 Ga0207650_10613026 Ga0207650_106130262 205
46 3300025941 Ga0207711_10444847 Ga0207711_104448472 205
47 3300026088 Ga0207641_10015688 Ga0207641_100156884 205
48 3300026095 Ga0207676_10088590 Ga0207676_100885904 205
49 3300026118 Ga0207675_100797920 Ga0207675_1007979201 205
50 3300028380 Ga0268265_10405183 Ga0268265_104051832 205
51 3300031901 Ga0307406_10041090 Ga0307406_100410902 205
52 3300046459 Ga0495629_0279562 Ga0495629_0279562_403_1020 205
53 3300053138 Ga0500564_011769 Ga0500564_011769_2121_2774 205
54 3300055283 Ga0500661_006428 Ga0500661_006428_174_809 205
55 3300005467 Ga0070706_100794391 Ga0070706_1007943911 206
56 3300025910 Ga0207684_10731067 Ga0207684_107310671 206
57 3300037853 Ga0436364_0534772 Ga0436364_0534772_4442_5062 206
58 3300003316 rootH1_10142730 rootH1_101427302 207
59 3300005435 Ga0070714_100250378 Ga0070714_1002503783 207
60 3300006028 Ga0070717_10002605 Ga0070717_100026052 207
61 3300006175 Ga0070712_100084695 Ga0070712_1000846953 207
62 3300025915 Ga0207693_10265965 Ga0207693_102659652 207
63 3300025939 Ga0207665_10100577 Ga0207665_101005772 207
64 3300031730 Ga0307516_10000288 Ga0307516_100002887 207
65 3300053103 Ga0500555_010965 Ga0500555_010965_927_1550 207
66 3300003187 JGI25151J46595_10000008 JGI25151J46595_1000000848 208
67 3300005548 Ga0070665_100125118 Ga0070665_1001251181 208
68 3300028379 Ga0268266_10096622 Ga0268266_100966221 208
69 3300030733 Ga0314311_1039021 Ga0314311_10390211 208
70 3300031730 Ga0307516_10044582 Ga0307516_100445823 208
71 3300041404 Ga0439436_0015169 Ga0439436_0015169_94_720 208
72 3300041997 Ga0439431_0090554 Ga0439431_0090554_130_822 208
73 3300042004 Ga0439445_0000859 Ga0439445_0000859_4749_5441 208
74 3300045051 Ga0451576_0813521 Ga0451576_0813521_227_871 208
75 3300049705 Ga0501225_0001030 Ga0501225_0001030_28_654 208
76 3300053119 Ga0500595_005479 Ga0500595_005479_2053_2679 208
77 3300006195 Ga0075366_10046140 Ga0075366_100461403 209
78 3300009978 Ga0105148_107405 Ga0105148_1074051 209
79 3300035724 Ga0373933_0046371 Ga0373933_0046371_39_668 209
80 3300007265 Ga0099794_10272055 Ga0099794_102720551 210
81 3300013100 Ga0157373_10024546 Ga0157373_100245462 210
82 3300028800 Ga0265338_10037137 Ga0265338_100371372 210
83 3300031247 Ga0265340_10003708 Ga0265340_100037082 210
84 3300031249 Ga0265339_10000783 Ga0265339_1000078315 210
85 3300031712 Ga0265342_10000224 Ga0265342_1000022415 210
86 3300031731 Ga0307405_10091603 Ga0307405_100916032 210
87 3300035113 Ga0373936_0003382 Ga0373936_0003382_891_1523 210
88 3300053177 Ga0500636_0089523 Ga0500636_0089523_282_914 210
89 iso_pu_bacteria 2739367700 2739733971 210
90 3300006173 Ga0070716_100208573 Ga0070716_1002085731 211
91 3300049568 Ga0501031_0046969 Ga0501031_0046969_29_667 212
92 3300049569 Ga0501032_0356779 Ga0501032_0356779_172_810 212
93 3300049570 Ga0501033_0001461 Ga0501033_0001461_14424_15062 212
94 3300049571 Ga0501034_0636595 Ga0501034_0636595_299_937 212
95 3300049572 Ga0501036_0019026 Ga0501036_0019026_2664_3302 212
96 3300049573 Ga0501037_0021419 Ga0501037_0021419_2342_2980 212
97 3300049574 Ga0501038_0043788 Ga0501038_0043788_1634_2272 212
98 3300049579 Ga0501043_0001543 Ga0501043_0001543_3969_4607 212
99 3300049580 Ga0501046_0432732 Ga0501046_0432732_73_711 212
100 3300049581 Ga0501047_0118987 Ga0501047_0118987_21_659 212
101 3300049582 Ga0501048_0057583 Ga0501048_0057583_1796_2434 212
102 3300049586 Ga0501070_0641564 Ga0501070_0641564_78_716 212
103 3300049742 Ga0501080_0149803 Ga0501080_0149803_130_768 212
104 3300049822 Ga0501035_0048793 Ga0501035_0048793_765_1403 212
105 iso_pu_bacteria 2928963466 2928966131 212
106 3300003760 Ga0055527_1010872 Ga0055527_10108722 214
107 3300005340 Ga0070689_100001372 Ga0070689_10000137211 214
108 3300005843 Ga0068860_100323214 Ga0068860_1003232142 214
109 3300009551 Ga0105238_10051483 Ga0105238_100514835 214
110 3300025228 Ga0209672_102696 Ga0209672_1026962 214
111 3300025272 Ga0209455_1008483 Ga0209455_10084832 214
112 3300025936 Ga0207670_10001001 Ga0207670_1000100113 214
113 3300028380 Ga0268265_10526578 Ga0268265_105265782 214
114 3300028381 Ga0268264_10099137 Ga0268264_100991374 214
115 3300046460 Ga0495638_0000650 Ga0495638_0000650_25395_26039 214
116 3300046460 Ga0495638_0000657 Ga0495638_0000657_7268_7924 214
117 3300046471 Ga0495650_0000849 Ga0495650_0000849_29002_29658 214
118 3300046507 Ga0495606_0002283 Ga0495606_0002283_19237_19881 214
119 3300046694 Ga0495649_0011318 Ga0495649_0011318_2190_2834 214
120 3300046694 Ga0495649_0061144 Ga0495649_0061144_147_791 214
121 3300047446 Ga0495679_101693 Ga0495679_101693_65_709 214
122 3300048918 Ga0496115_0001755 Ga0496115_0001755_602_1246 214
123 3300048918 Ga0496115_0065038 Ga0496115_0065038_443_1087 214
124 3300048929 Ga0496126_0040031 Ga0496126_0040031_541_1185 214
125 3300048929 Ga0496126_0220190 Ga0496126_0220190_680_1324 214
126 3300049459 Ga0495678_025594 Ga0495678_025594_81_725 214
127 3300049460 Ga0495682_0019181 Ga0495682_0019181_275_919 214
128 3300049575 Ga0501039_0075277 Ga0501039_0075277_1271_1915 214
129 3300049822 Ga0501035_0480695 Ga0501035_0480695_10_654 214
130 3300049823 Ga0501044_0448814 Ga0501044_0448814_114_758 214
131 3300009093 Ga0105240_10000123 Ga0105240_1000012351 215
132 3300025913 Ga0207695_10000312 Ga0207695_1000031279 215
133 3300028016 Ga0265354_1001019 Ga0265354_10010194 215
134 3300030878 Ga0265770_1000051 Ga0265770_100005110 215
135 3300031090 Ga0265760_10000676 Ga0265760_100006764 215
136 3300031548 Ga0307408_100024038 Ga0307408_1000240384 215
137 3300037466 Ga0395898_0000853 Ga0395898_0000853_12167_12814 215
138 3300038443 Ga0395901_0009119 Ga0395901_0009119_5209_5856 215
139 3300041404 Ga0439436_0004537 Ga0439436_0004537_2624_3271 215
140 3300002737 JGI25162J39368_1002131 JGI25162J39368_10021312 216
141 3300003762 Ga0055542_1001057 Ga0055542_100105716 216
142 3300005365 Ga0070688_100026082 Ga0070688_1000260822 216
143 3300005617 Ga0068859_100588478 Ga0068859_1005884782 216
144 3300006931 Ga0097620_100588502 Ga0097620_1005885022 216
145 3300009093 Ga0105240_10001969 Ga0105240_100019693 216
146 3300010375 Ga0105239_10000090 Ga0105239_1000009013 216
147 3300014969 Ga0157376_10044260 Ga0157376_100442604 216
148 3300025231 Ga0207427_100645 Ga0207427_10064514 216
149 3300025233 Ga0209437_100162 Ga0209437_10016241 216
150 3300025242 Ga0209258_101702 Ga0209258_1017025 216
151 3300025254 Ga0209148_1000005 Ga0209148_10000051572 216
152 3300025256 Ga0209759_1005419 Ga0209759_10054195 216
153 3300025261 Ga0209233_1015675 Ga0209233_10156753 216
154 3300025913 Ga0207695_10004667 Ga0207695_100046673 216
155 3300037471 Ga0395905_0000038 Ga0395905_0000038_176967_177617 216
156 3300045049 Ga0466959_0050907 Ga0466959_0050907_1597_2247 216
157 3300048907 Ga0496104_0338909 Ga0496104_0338909_181_831 216
158 3300048908 Ga0496105_0008837 Ga0496105_0008837_5786_6436 216
159 3300048910 Ga0496107_0063897 Ga0496107_0063897_453_1103 216
160 3300048919 Ga0496116_0131303 Ga0496116_0131303_273_923 216
161 3300048920 Ga0496117_0036910 Ga0496117_0036910_1343_1993 216
162 3300048920 Ga0496117_0081225 Ga0496117_0081225_1424_2074 216
163 3300048920 Ga0496117_0084866 Ga0496117_0084866_832_1482 216
164 3300048921 Ga0496118_0000779 Ga0496118_0000779_29477_30127 216
165 3300048921 Ga0496118_0012592 Ga0496118_0012592_4652_5302 216
166 3300048921 Ga0496118_0170480 Ga0496118_0170480_235_885 216
167 3300048922 Ga0496119_0000218 Ga0496119_0000218_46782_47432 216
168 3300048923 Ga0496120_0000322 Ga0496120_0000322_21207_21857 216
169 3300048924 Ga0496121_0000883 Ga0496121_0000883_15095_15745 216
170 3300048924 Ga0496121_0025126 Ga0496121_0025126_2513_3163 216
171 3300048929 Ga0496126_0002101 Ga0496126_0002101_23776_24426 216
172 3300002705 JGI25156J39149_1012477 JGI25156J39149_10124771 217
173 3300002737 JGI25162J39368_1000066 JGI25162J39368_100006683 217
174 3300002737 JGI25162J39368_1001441 JGI25162J39368_10014416 217
175 3300002738 JGI25154J39366_1009578 JGI25154J39366_10095782 217
176 3300002741 JGI25157J39369_1000050 JGI25157J39369_100005083 217
177 3300002771 JGI25163J39215_1000224 JGI25163J39215_100022415 217
178 3300002772 JGI25164J39214_1000056 JGI25164J39214_100005623 217
179 3300002772 JGI25164J39214_1000923 JGI25164J39214_10009233 217
180 3300003214 JGI25165J46597_1000009 JGI25165J46597_100000983 217
181 3300003214 JGI25165J46597_1001435 JGI25165J46597_10014356 217
182 3300003751 Ga0055538_1000797 Ga0055538_10007976 217
183 3300003761 Ga0055535_1000045 Ga0055535_100004583 217
184 3300003762 Ga0055542_1000079 Ga0055542_100007983 217
185 3300003763 Ga0055529_1000122 Ga0055529_100012223 217
186 3300005435 Ga0070714_100000439 Ga0070714_1000004396 217
187 3300005437 Ga0070710_10084295 Ga0070710_100842953 217
188 3300013100 Ga0157373_10016477 Ga0157373_100164776 217
189 3300013104 Ga0157370_10021678 Ga0157370_100216788 217
190 3300014497 Ga0182008_10031586 Ga0182008_100315863 217
191 3300014497 Ga0182008_10038537 Ga0182008_100385373 217
192 3300015261 Ga0182006_1027564 Ga0182006_10275643 217
193 3300015262 Ga0182007_10065485 Ga0182007_100654852 217
194 3300015685 Ga0183369_1003 Ga0183369_100334 217
195 3300025207 Ga0209760_100327 Ga0209760_10032710 217
196 3300025224 Ga0209784_100013 Ga0209784_100013412 217
197 3300025231 Ga0207427_100030 Ga0207427_100030213 217
198 3300025231 Ga0207427_100101 Ga0207427_100101124 217
199 3300025233 Ga0209437_100012 Ga0209437_100012663 217
200 3300025233 Ga0209437_100090 Ga0209437_100090229 217
201 3300025242 Ga0209258_100019 Ga0209258_100019126 217
202 3300025246 Ga0209646_1000901 Ga0209646_10009014 217
203 3300025250 Ga0209026_1000015 Ga0209026_1000015307 217
204 3300025254 Ga0209148_1000001 Ga0209148_10000012174 217
205 3300025256 Ga0209759_1000367 Ga0209759_100036713 217
206 3300025261 Ga0209233_1000002 Ga0209233_1000002126 217
207 3300025261 Ga0209233_1000077 Ga0209233_1000077326 217
208 3300025272 Ga0209455_1000027 Ga0209455_1000027420 217
209 3300025898 Ga0207692_10165376 Ga0207692_101653762 217
210 3300025929 Ga0207664_10003938 Ga0207664_100039387 217
211 3300031901 Ga0307406_10000553 Ga0307406_100005538 217
212 3300037312 Ga0395899_0108427 Ga0395899_0108427_625_1278 217
213 3300049570 Ga0501033_0128899 Ga0501033_0128899_550_1203 217
214 3300049572 Ga0501036_0197719 Ga0501036_0197719_307_960 217
215 3300049573 Ga0501037_0215716 Ga0501037_0215716_19_672 217
216 3300049581 Ga0501047_0212492 Ga0501047_0212492_123_776 217
217 3300049822 Ga0501035_0250625 Ga0501035_0250625_295_948 217
218 3300049822 Ga0501035_0320422 Ga0501035_0320422_100_753 217
219 3300049823 Ga0501044_0077165 Ga0501044_0077165_222_875 217
220 3300049823 Ga0501044_0144769 Ga0501044_0144769_1289_1942 217
221 3300005614 Ga0068856_100327681 Ga0068856_1003276812 218
222 3300048918 Ga0496115_0153973 Ga0496115_0153973_294_1019 218
223 3300031090 Ga0265760_10137667 Ga0265760_101376671 219
224 3300031238 Ga0265332_10139775 Ga0265332_101397751 219
225 3300046529 Ga0495652_0004657 Ga0495652_0004657_2520_3179 219
226 3300046680 Ga0495646_0006259 Ga0495646_0006259_1880_2539 219
227 3300049570 Ga0501033_0477453 Ga0501033_0477453_135_794 219
228 3300049822 Ga0501035_0310692 Ga0501035_0310692_514_1173 219
229 3300049822 Ga0501035_0325620 Ga0501035_0325620_460_1119 219
230 3300049823 Ga0501044_0000183 Ga0501044_0000183_8693_9352 219
231 3300003316 rootH1_10095801 rootH1_100958011 220
232 3300003320 rootH2_10094653 rootH2_100946534 220
233 3300003323 rootH1_10045431 rootH1_100454314 220
234 iso_pu_bacteria 2852680915 2852683610 221
235 3300013105 Ga0157369_10111073 Ga0157369_101110733 223
236 3300025242 Ga0209258_101890 Ga0209258_1018906 223
237 3300025246 Ga0209646_1018212 Ga0209646_10182121 223
238 3300030760 Ga0265762_1009026 Ga0265762_10090262 224
239 3300001989 JGI24739J22299_10031810 JGI24739J22299_100318102 225
240 3300001990 JGI24737J22298_10005270 JGI24737J22298_100052704 225
241 3300002067 JGI24735J21928_10005311 JGI24735J21928_100053115 225
242 3300003756 Ga0055533_1000225 Ga0055533_100022542 225
243 3300013105 Ga0157369_10113603 Ga0157369_101136032 225
244 3300015687 Ga0183368_1002 Ga0183368_1002937 225
245 3300025226 Ga0209674_100014 Ga0209674_100014526 225
246 3300025904 Ga0207647_10007558 Ga0207647_100075586 225
247 3300048918 Ga0496115_0000170 Ga0496115_0000170_11957_12634 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

33

97

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

24

95

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

33

100

0.87

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

122

219

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zb6-assembly1.cif.gz_A crystal structure of lolium rigidum gstf in complex with s-(p-nitrobenzyl) glutathione 0.9174 2 201
6riv-assembly1.cif.gz_A crystal structure of alopecurus myosuroides gstf 0.9171 2 201
7obo-assembly1.cif.gz_AAA-2 gstf1 from alopecurus myosuroides 0.9149 2 201
6tk8-assembly1.cif.gz_AAA-2 gstf1 f122t variant from alopecurus myosuroides 0.9142 2 201
7odm-assembly1.cif.gz_AAA-2 amgstf1 y118s variant 0.9065 2 201
ID Description Score Start End Superfamily
af_F1R9R0_45_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9703 2 75 3.40.30.10
af_K7TUZ4_3_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9691 2 63 3.40.30.10
af_Q9FHE1_1_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.968 2 74 3.40.30.10
af_D3Z8I7_45_138_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9643 2 77 3.40.30.10
af_Q7JYX0_7_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.961 3 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1V3NXJ4-F1-model_v4 Glutathione S-transferase 0.994 1 204 GO:0016740
AF-A0A1V3NXJ4-F1-model_v4 Glutathione S-transferase 0.9892 1 204 GO:0016740
AF-A0A7V8YEU5-F1-model_v4 Glutathione S-transferase family protein 0.9533 1 199 GO:0005737
GO:0016740
AF-A0A6J4PL94-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9479 1 204 GO:0004364
AF-A0A3B4CE34-F1-model_v4 deleted 0.9457 32 208

Feature Viewer

pLDDT pTM Quality
91.53 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map