F358895

General Info

Members Datasets Scaffolds Average Seq Length
247 139 494 117

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_11204030|Ga0075365_112040301
Length 119
Sequence MPVIGVGIDVVDIERFGESLERTRGLAARLFTPGEIDRPLASLAARFAAKEALAKALGAPVGLHWHDAEVVSEESGRPLFTLRGSVAARAAELGAVHVHLSLSHDAGIASAVVVLESSR

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
72 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
73 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
74 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
75 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
127 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
128 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
129 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
130 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
131 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2643221615 Nocardioides sp. Root224 Isolate Unclassified
137 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
138 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
139 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 0
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.77
Nodule 0.4
Rhizoplane 12.55
Rhizosphere 68.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_11204030 3300006038 Bacteria 533
2 Ga0070683_100644959 3300005329 Bacteria 1014
3 Ga0070660_100016123 3300005339 Bacteria 5417
4 Ga0070668_100412980 3300005347 Bacteria 1154
5 Ga0070668_100577708 3300005347 Bacteria 981
6 Ga0070669_100941681 3300005353 Bacteria 739
7 Ga0070671_100765395 3300005355 Bacteria 840
8 Ga0070674_100178241 3300005356 Bacteria 1626
9 Ga0070659_101052095 3300005366 Bacteria 716
10 Ga0070700_100244120 3300005441 Bacteria 1285
11 Ga0070678_101210723 3300005456 Bacteria 700
12 Ga0070684_100046389 3300005535 Bacteria 3765
13 Ga0070684_100059747 3300005535 Bacteria 3334
14 Ga0070684_101146889 3300005535 Bacteria 731
15 Ga0070684_101824633 3300005535 Bacteria 574
16 Ga0070665_100386093 3300005548 Bacteria 1408
17 Ga0068864_100960400 3300005618 Bacteria 846
18 Ga0068866_10288889 3300005718 Bacteria 1019
19 Ga0068861_100454148 3300005719 Bacteria 1149
20 Ga0068861_101749154 3300005719 Bacteria 616
21 Ga0075365_10037194 3300006038 Bacteria 3159
22 Ga0075365_10106477 3300006038 Bacteria 1924
23 Ga0075365_10121341 3300006038 Bacteria 1803
24 Ga0075365_10124541 3300006038 Bacteria 1780
25 Ga0075365_10167578 3300006038 Bacteria 1533
26 Ga0075365_10439910 3300006038 Bacteria 921
27 Ga0075365_10572705 3300006038 Bacteria 799
28 Ga0075368_10033935 3300006042 Bacteria 1987
29 Ga0075364_10057825 3300006051 Bacteria 2541
30 Ga0075364_10084893 3300006051 Bacteria 2096
31 Ga0075364_10128851 3300006051 Bacteria 1697
32 Ga0075364_10570342 3300006051 Bacteria 773
33 Ga0075367_10059568 3300006178 Bacteria 2274
34 Ga0097621_100724256 3300006237 Bacteria 917
35 Ga0068865_101232421 3300006881 Bacteria 663
36 Ga0111539_10517272 3300009094 Bacteria 1390
37 Ga0105245_11144052 3300009098 Bacteria 825
38 Ga0105243_10112615 3300009148 Bacteria 2280
39 Ga0105243_10195801 3300009148 Bacteria 1769
40 Ga0105242_10285698 3300009176 Bacteria 1500
41 Ga0105238_11949289 3300009551 Bacteria 621
42 Ga0105249_10272647 3300009553 Bacteria 1686
43 Ga0105249_11340493 3300009553 Bacteria 787
44 Ga0105239_12004686 3300010375 Bacteria 672
45 Ga0157370_10919977 3300013104 Bacteria 793
46 Ga0157378_11660771 3300013297 Bacteria 685
47 Ga0163162_11531574 3300013306 Bacteria 760
48 Ga0157372_10663237 3300013307 Bacteria 1214
49 Ga0157375_10059808 3300013308 Bacteria 3776
50 Ga0157375_10133176 3300013308 Bacteria 2607
51 Ga0157375_10263649 3300013308 Bacteria 1884
52 Ga0157375_10872960 3300013308 Bacteria 1045
53 Ga0157375_12298032 3300013308 Bacteria 643
54 Ga0163163_10270651 3300014325 Bacteria 1750
55 Ga0163163_10744136 3300014325 Bacteria 1044
56 Ga0157380_10370581 3300014326 Bacteria 1347
57 Ga0157380_11610322 3300014326 Bacteria 705
58 Ga0157377_10259060 3300014745 Bacteria 1131
59 Ga0163161_10009078 3300017792 Bacteria 6875
60 Ga0163161_10429012 3300017792 Bacteria 1065
61 Ga0207642_10182475 3300025899 Bacteria 1145
62 Ga0207688_10370183 3300025901 Bacteria 885
63 Ga0207645_10611486 3300025907 Bacteria 740
64 Ga0207705_10100959 3300025909 Bacteria 2122
65 Ga0207662_10232165 3300025918 Bacteria 1205
66 Ga0207657_10061467 3300025919 Bacteria 3220
67 Ga0207657_10268491 3300025919 Bacteria 1356
68 Ga0207644_10743927 3300025931 Bacteria 819
69 Ga0207709_10136415 3300025935 Bacteria 1680
70 Ga0207709_10818134 3300025935 Bacteria 753
71 Ga0207669_10163397 3300025937 Bacteria 1576
72 Ga0207704_10442091 3300025938 Bacteria 1036
73 Ga0207691_10185754 3300025940 Bacteria 1815
74 Ga0207661_10016031 3300025944 Bacteria 5525
75 Ga0207661_10279139 3300025944 Bacteria 1493
76 Ga0207668_10218251 3300025972 Bacteria 1530
77 Ga0207678_10613570 3300026067 Bacteria 954
78 Ga0207708_10438892 3300026075 Bacteria 1085
79 Ga0207675_100045715 3300026118 Bacteria 4091
80 Ga0207675_102576168 3300026118 Bacteria 518
81 Ga0207683_10372461 3300026121 Bacteria 1312
82 Ga0207428_10760352 3300027907 Bacteria 690
83 Ga0268266_10426368 3300028379 Bacteria 1258
84 Ga0268264_10000716 3300028381 Bacteria 38128
85 Ga0268264_11236352 3300028381 Bacteria 757
86 Ga0307408_101922071 3300031548 Bacteria 568
87 Ga0307405_10342722 3300031731 Bacteria 1150
88 Ga0307405_10715407 3300031731 Bacteria 831
89 Ga0307405_10920910 3300031731 Bacteria 741
90 Ga0307413_10726594 3300031824 Bacteria 828
91 Ga0307413_12052914 3300031824 Bacteria 516
92 Ga0307410_10191720 3300031852 Bacteria 1555
93 Ga0307410_11306735 3300031852 Bacteria 634
94 Ga0307410_11533280 3300031852 Bacteria 588
95 Ga0326468_10085933 3300031889 Bacteria 553
96 Ga0307407_10108724 3300031903 Bacteria 1737
97 Ga0307412_10329133 3300031911 Bacteria 1219
98 Ga0307409_100083828 3300031995 Bacteria 2586
99 Ga0307409_100146980 3300031995 Bacteria 2040
100 Ga0307409_100405914 3300031995 Bacteria 1303
101 Ga0307409_101080585 3300031995 Bacteria 823
102 Ga0307409_101583992 3300031995 Bacteria 683
103 Ga0307409_102173162 3300031995 Bacteria 584
104 Ga0307409_102841535 3300031995 Bacteria 512
105 Ga0307416_100058298 3300032002 Bacteria 3130
106 Ga0307416_100627962 3300032002 Bacteria 1157
107 Ga0307416_101118151 3300032002 Bacteria 893
108 Ga0307414_10383256 3300032004 Bacteria 1216
109 Ga0307414_11636795 3300032004 Bacteria 600
110 Ga0307414_11783028 3300032004 Bacteria 574
111 Ga0307411_10626294 3300032005 Bacteria 928
112 Ga0307415_100133459 3300032126 Bacteria 1884
113 Ga0307415_100660123 3300032126 Bacteria 939
114 Ga0307415_100790580 3300032126 Bacteria 865
115 Ga0307415_101606433 3300032126 Bacteria 625
116 Ga0395901_0683276 3300038443 Bacteria 1026
117 Ga0395901_0884569 3300038443 Bacteria 876
118 Ga0436365_1267254 3300039437 Bacteria 988
119 Ga0439465_0122058 3300041413 Bacteria 914
120 Ga0451791_1777929 3300041451 Bacteria 553
121 Ga0451837_0772046 3300041494 Bacteria 552
122 Ga0451851_0114900 3300041507 Bacteria 503
123 Ga0451843_0192423 3300041509 Bacteria 521
124 Ga0451843_0249553 3300041509 Bacteria 518
125 Ga0451853_1221134 3300041512 Bacteria 1251
126 Ga0451853_4117309 3300041512 Bacteria 917
127 Ga0439431_0121901 3300041997 Bacteria 728
128 Ga0450920_121805 3300042122 Bacteria 548
129 Ga0466970_0140115 3300044765 Bacteria 1332
130 Ga0466970_0396509 3300044765 Bacteria 787
131 Ga0466960_0187259 3300044901 Bacteria 1125
132 Ga0466967_1931401 3300045976 Bacteria 587
133 Ga0495608_0084183 3300046511 Bacteria 2064
134 Ga0495652_0909758 3300046529 Bacteria 580
135 Ga0495680_0704219 3300047322 Bacteria 667
136 Ga0496100_0020141 3300048903 Bacteria 3994
137 Ga0496101_0077218 3300048904 Bacteria 2454
138 Ga0496101_0749248 3300048904 Bacteria 771
139 Ga0496102_0023698 3300048905 Bacteria 5454
140 Ga0496102_0084842 3300048905 Bacteria 2924
141 Ga0496102_0249317 3300048905 Bacteria 1674
142 Ga0496102_0887560 3300048905 Bacteria 813
143 Ga0496102_1361995 3300048905 Bacteria 629
144 Ga0496103_0013588 3300048906 Bacteria 4830
145 Ga0496104_0007813 3300048907 Bacteria 9480
146 Ga0496105_0048018 3300048908 Bacteria 3523
147 Ga0496106_0148436 3300048909 Bacteria 1848
148 Ga0496106_0717014 3300048909 Bacteria 796
149 Ga0496107_0170959 3300048910 Bacteria 1613
150 Ga0496107_0292906 3300048910 Bacteria 1211
151 Ga0496108_0351989 3300048911 Bacteria 1285
152 Ga0496108_0378703 3300048911 Bacteria 1236
153 Ga0496108_0702521 3300048911 Bacteria 877
154 Ga0496108_1436317 3300048911 Bacteria 576
155 Ga0496109_0171969 3300048912 Bacteria 2033
156 Ga0496109_0289995 3300048912 Bacteria 1543
157 Ga0496109_0554185 3300048912 Bacteria 1084
158 Ga0496109_0727359 3300048912 Bacteria 930
159 Ga0496109_1884161 3300048912 Bacteria 530
160 Ga0496111_1066004 3300048914 Bacteria 577
161 Ga0496113_0197901 3300048916 Bacteria 1597
162 Ga0496114_0015807 3300048917 Bacteria 6073
163 Ga0496114_1257610 3300048917 Bacteria 627
164 Ga0496115_0001500 3300048918 Bacteria 16756
165 Ga0496115_0139163 3300048918 Bacteria 2002
166 Ga0496124_0019185 3300048927 Bacteria 6378
167 Ga0501031_0039760 3300049568 Bacteria 3070
168 Ga0501031_0402472 3300049568 Bacteria 885
169 Ga0501032_0241636 3300049569 Bacteria 1173
170 Ga0501036_0227311 3300049572 Bacteria 1566
171 Ga0501036_0612000 3300049572 Bacteria 903
172 Ga0501038_0425414 3300049574 Bacteria 1024
173 Ga0501038_1347380 3300049574 Bacteria 514
174 Ga0501039_0045596 3300049575 Bacteria 3387
175 Ga0501039_0079097 3300049575 Bacteria 2558
176 Ga0501040_0189330 3300049576 Bacteria 1460
177 Ga0501040_0335645 3300049576 Bacteria 1082
178 Ga0501040_0953720 3300049576 Bacteria 622
179 Ga0501041_0045279 3300049577 Bacteria 2674
180 Ga0501041_0177979 3300049577 Bacteria 1331
181 Ga0501041_0338724 3300049577 Bacteria 950
182 Ga0501041_1001245 3300049577 Bacteria 538
183 Ga0501042_0029096 3300049578 Bacteria 3897
184 Ga0501042_0054136 3300049578 Bacteria 2862
185 Ga0501042_0477241 3300049578 Bacteria 905
186 Ga0501042_0938367 3300049578 Bacteria 630
187 Ga0501048_0100519 3300049582 Bacteria 2040
188 Ga0501048_0266194 3300049582 Bacteria 1218
189 Ga0501067_0211878 3300049583 Bacteria 1079
190 Ga0501067_0270730 3300049583 Bacteria 946
191 Ga0501067_0626370 3300049583 Bacteria 604
192 Ga0501068_0483210 3300049584 Bacteria 803
193 Ga0501069_0043842 3300049585 Bacteria 2477
194 Ga0501071_0017220 3300049587 Bacteria 4981
195 Ga0501071_0302356 3300049587 Bacteria 1213
196 Ga0501071_1022398 3300049587 Bacteria 638
197 Ga0501072_0163779 3300049588 Bacteria 1774
198 Ga0501072_0171455 3300049588 Bacteria 1732
199 Ga0501072_0394811 3300049588 Bacteria 1097
200 Ga0501075_0194666 3300049591 Bacteria 1546
201 Ga0501076_0057485 3300049592 Bacteria 3089
202 Ga0501076_0125151 3300049592 Bacteria 2083
203 Ga0501076_0424248 3300049592 Bacteria 1094
204 Ga0501076_1208283 3300049592 Bacteria 622
205 Ga0501079_0253895 3300049741 Bacteria 1374
206 Ga0501079_0274802 3300049741 Bacteria 1317
207 Ga0501081_0073104 3300049743 Bacteria 2391
208 Ga0501081_0389530 3300049743 Bacteria 1031
209 Ga0501083_0102204 3300049744 Bacteria 1890
210 Ga0501035_0045051 3300049822 Bacteria 3970
211 Ga0501035_1284512 3300049822 Bacteria 565
212 Ga0501044_0415090 3300049823 Bacteria 1257
213 Ga0501045_0231709 3300049824 Bacteria 1375
214 Ga0501045_0388686 3300049824 Bacteria 1038
215 Ga0501045_0511445 3300049824 Bacteria 892
216 Ga0501045_0642782 3300049824 Bacteria 784
217 Ga0501045_1057396 3300049824 Bacteria 594
218 nmdc:mga03683_656967_c1 3300050489 Bacteria 516
219 nmdc:mga00v17_22213_c1 3300050491 Bacteria 3658
220 nmdc:mga00v17_237156_c1 3300050491 Bacteria 1182
221 nmdc:mga00v17_28106_c1 3300050491 Bacteria 3291
222 nmdc:mga00v17_75564_c1 3300050491 Bacteria 2095
223 nmdc:mga00v17_836651_c1 3300050491 Bacteria 585
224 nmdc:mga0yw44_199753_c1 3300050492 Bacteria 1320
225 nmdc:mga0yw44_2224_c1 3300050492 Bacteria 8178
226 nmdc:mga0yw44_32781_c1 3300050492 Bacteria 3030
227 nmdc:mga0yw44_35592_c1 3300050492 Bacteria 2927
228 nmdc:mga0yw44_363552_c1 3300050492 Bacteria 975
229 nmdc:mga0yw44_596203_c1 3300050492 Bacteria 751
230 nmdc:mga0yw44_726839_c1 3300050492 Bacteria 674
231 nmdc:mga0yw44_91395_c1 3300050492 Bacteria 1924
232 nmdc:mga06z11_212226_c1 3300050494 Bacteria 1128
233 Ga0495655_0156950 3300053083 Bacteria 719
234 Ga0500643_000239 3300053087 Bacteria 51005
235 Ga0500556_0002998 3300053104 Bacteria 5091
236 Ga0500593_000560 3300053117 Bacteria 14415
237 Ga0500568_0201006 3300053139 Bacteria 730
238 Ga0500573_0414363 3300053140 Bacteria 634
239 Ga0501084_0895633 3300054114 Bacteria 746
240 Ga0590075_098936 3300059424 Bacteria 759
241 Ga0501082_0028865 3300060353 Bacteria 4780
242 Ga0530510_0320615 3300061734 Bacteria 1162
243 Ga0530510_1005340 3300061734 Bacteria 638
244 2644091164 2643221615 Bacteria 5487866
245 2644320967 2643221657 Bacteria 5490246
246 2857482926 2857481737 Bacteria 4761446
247 8054613804 8054609563 Bacteria 5170090
248 Ga0075365_11204030
249 Ga0070683_100644959
250 Ga0070660_100016123
251 Ga0070668_100412980
252 Ga0070668_100577708
253 Ga0070669_100941681
254 Ga0070671_100765395
255 Ga0070674_100178241
256 Ga0070659_101052095
257 Ga0070700_100244120
258 Ga0070678_101210723
259 Ga0070684_100046389
260 Ga0070684_100059747
261 Ga0070684_101146889
262 Ga0070684_101824633
263 Ga0070665_100386093
264 Ga0068864_100960400
265 Ga0068866_10288889
266 Ga0068861_100454148
267 Ga0068861_101749154
268 Ga0075365_10037194
269 Ga0075365_10106477
270 Ga0075365_10121341
271 Ga0075365_10124541
272 Ga0075365_10167578
273 Ga0075365_10439910
274 Ga0075365_10572705
275 Ga0075368_10033935
276 Ga0075364_10057825
277 Ga0075364_10084893
278 Ga0075364_10128851
279 Ga0075364_10570342
280 Ga0075367_10059568
281 Ga0097621_100724256
282 Ga0068865_101232421
283 Ga0111539_10517272
284 Ga0105245_11144052
285 Ga0105243_10112615
286 Ga0105243_10195801
287 Ga0105242_10285698
288 Ga0105238_11949289
289 Ga0105249_10272647
290 Ga0105249_11340493
291 Ga0105239_12004686
292 Ga0157370_10919977
293 Ga0157378_11660771
294 Ga0163162_11531574
295 Ga0157372_10663237
296 Ga0157375_10059808
297 Ga0157375_10133176
298 Ga0157375_10263649
299 Ga0157375_10872960
300 Ga0157375_12298032
301 Ga0163163_10270651
302 Ga0163163_10744136
303 Ga0157380_10370581
304 Ga0157380_11610322
305 Ga0157377_10259060
306 Ga0163161_10009078
307 Ga0163161_10429012
308 Ga0207642_10182475
309 Ga0207688_10370183
310 Ga0207645_10611486
311 Ga0207705_10100959
312 Ga0207662_10232165
313 Ga0207657_10061467
314 Ga0207657_10268491
315 Ga0207644_10743927
316 Ga0207709_10136415
317 Ga0207709_10818134
318 Ga0207669_10163397
319 Ga0207704_10442091
320 Ga0207691_10185754
321 Ga0207661_10016031
322 Ga0207661_10279139
323 Ga0207668_10218251
324 Ga0207678_10613570
325 Ga0207708_10438892
326 Ga0207675_100045715
327 Ga0207675_102576168
328 Ga0207683_10372461
329 Ga0207428_10760352
330 Ga0268266_10426368
331 Ga0268264_10000716
332 Ga0268264_11236352
333 Ga0307408_101922071
334 Ga0307405_10342722
335 Ga0307405_10715407
336 Ga0307405_10920910
337 Ga0307413_10726594
338 Ga0307413_12052914
339 Ga0307410_10191720
340 Ga0307410_11306735
341 Ga0307410_11533280
342 Ga0326468_10085933
343 Ga0307407_10108724
344 Ga0307412_10329133
345 Ga0307409_100083828
346 Ga0307409_100146980
347 Ga0307409_100405914
348 Ga0307409_101080585
349 Ga0307409_101583992
350 Ga0307409_102173162
351 Ga0307409_102841535
352 Ga0307416_100058298
353 Ga0307416_100627962
354 Ga0307416_101118151
355 Ga0307414_10383256
356 Ga0307414_11636795
357 Ga0307414_11783028
358 Ga0307411_10626294
359 Ga0307415_100133459
360 Ga0307415_100660123
361 Ga0307415_100790580
362 Ga0307415_101606433
363 Ga0395901_0683276
364 Ga0395901_0884569
365 Ga0436365_1267254
366 Ga0439465_0122058
367 Ga0451791_1777929
368 Ga0451837_0772046
369 Ga0451851_0114900
370 Ga0451843_0192423
371 Ga0451843_0249553
372 Ga0451853_1221134
373 Ga0451853_4117309
374 Ga0439431_0121901
375 Ga0450920_121805
376 Ga0466970_0140115
377 Ga0466970_0396509
378 Ga0466960_0187259
379 Ga0466967_1931401
380 Ga0495608_0084183
381 Ga0495652_0909758
382 Ga0495680_0704219
383 Ga0496100_0020141
384 Ga0496101_0077218
385 Ga0496101_0749248
386 Ga0496102_0023698
387 Ga0496102_0084842
388 Ga0496102_0249317
389 Ga0496102_0887560
390 Ga0496102_1361995
391 Ga0496103_0013588
392 Ga0496104_0007813
393 Ga0496105_0048018
394 Ga0496106_0148436
395 Ga0496106_0717014
396 Ga0496107_0170959
397 Ga0496107_0292906
398 Ga0496108_0351989
399 Ga0496108_0378703
400 Ga0496108_0702521
401 Ga0496108_1436317
402 Ga0496109_0171969
403 Ga0496109_0289995
404 Ga0496109_0554185
405 Ga0496109_0727359
406 Ga0496109_1884161
407 Ga0496111_1066004
408 Ga0496113_0197901
409 Ga0496114_0015807
410 Ga0496114_1257610
411 Ga0496115_0001500
412 Ga0496115_0139163
413 Ga0496124_0019185
414 Ga0501031_0039760
415 Ga0501031_0402472
416 Ga0501032_0241636
417 Ga0501036_0227311
418 Ga0501036_0612000
419 Ga0501038_0425414
420 Ga0501038_1347380
421 Ga0501039_0045596
422 Ga0501039_0079097
423 Ga0501040_0189330
424 Ga0501040_0335645
425 Ga0501040_0953720
426 Ga0501041_0045279
427 Ga0501041_0177979
428 Ga0501041_0338724
429 Ga0501041_1001245
430 Ga0501042_0029096
431 Ga0501042_0054136
432 Ga0501042_0477241
433 Ga0501042_0938367
434 Ga0501048_0100519
435 Ga0501048_0266194
436 Ga0501067_0211878
437 Ga0501067_0270730
438 Ga0501067_0626370
439 Ga0501068_0483210
440 Ga0501069_0043842
441 Ga0501071_0017220
442 Ga0501071_0302356
443 Ga0501071_1022398
444 Ga0501072_0163779
445 Ga0501072_0171455
446 Ga0501072_0394811
447 Ga0501075_0194666
448 Ga0501076_0057485
449 Ga0501076_0125151
450 Ga0501076_0424248
451 Ga0501076_1208283
452 Ga0501079_0253895
453 Ga0501079_0274802
454 Ga0501081_0073104
455 Ga0501081_0389530
456 Ga0501083_0102204
457 Ga0501035_0045051
458 Ga0501035_1284512
459 Ga0501044_0415090
460 Ga0501045_0231709
461 Ga0501045_0388686
462 Ga0501045_0511445
463 Ga0501045_0642782
464 Ga0501045_1057396
465 nmdc:mga03683_656967_c1
466 nmdc:mga00v17_22213_c1
467 nmdc:mga00v17_237156_c1
468 nmdc:mga00v17_28106_c1
469 nmdc:mga00v17_75564_c1
470 nmdc:mga00v17_836651_c1
471 nmdc:mga0yw44_199753_c1
472 nmdc:mga0yw44_2224_c1
473 nmdc:mga0yw44_32781_c1
474 nmdc:mga0yw44_35592_c1
475 nmdc:mga0yw44_363552_c1
476 nmdc:mga0yw44_596203_c1
477 nmdc:mga0yw44_726839_c1
478 nmdc:mga0yw44_91395_c1
479 nmdc:mga06z11_212226_c1
480 Ga0495655_0156950
481 Ga0500643_000239
482 Ga0500556_0002998
483 Ga0500593_000560
484 Ga0500568_0201006
485 Ga0500573_0414363
486 Ga0501084_0895633
487 Ga0590075_098936
488 Ga0501082_0028865
489 Ga0530510_0320615
490 Ga0530510_1005340
491 2644091164
492 2644320967
493 2857482926
494 8054613804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

5

113

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wds-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor h110a acps mutant in complex with cofactor coa at 1.3 a 0.9742 1 117
2wdy-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor d111a acps mutant in complex with cofactor coa at 1.4 a 0.9738 1 117
2wds-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor h110a acps mutant in complex with cofactor coa at 1.3 a 0.9661 1 117
2jca-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor holo- [acyl-carrier-protein] synthase (acps) at 2 a. 0.966 1 117
2wdy-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor d111a acps mutant in complex with cofactor coa at 1.4 a 0.9657 1 117
ID Description Score Start End Superfamily
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9738 1 117 3.90.470.20
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9657 1 117 3.90.470.20
af_Q552R4_1_166_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9044 2 117 3.90.470.20
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9041 2 117 3.90.470.20
af_Q552R4_1_166_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8899 2 117 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A6L9S3X9-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9973 2 116 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A7K3M2L3-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9967 2 116 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A1H2M775-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9962 2 115 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A838K5P6-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9961 2 117 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A3N0GZ19-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9961 2 117 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map