F358810

General Info

Members Datasets Scaffolds Average Seq Length
247 186 214 187

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10088521|Ga0070681_100885215
Length 207
Sequence LREFSHEITRNNTNEVNQYLNEMKKELSAKQSEELLSVLKTRFEKNMNRHEGVEWDKVEAKLEANPAKLWSLSEMERTGGEPDVVGSDKKTGEYIFYDCSAESPKGRRSVCYDRAALEARKEHKPADSAIDMAAAMGIEILTEEQYRALQKLGAFDLKTSSWIMTPAAIRKLGGALFCDRRYDTVFTYHNGADSYYAARGFRGSLSV

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
6 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
7 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
8 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
9 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
10 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
11 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
12 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
13 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
14 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
15 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
16 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
17 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
18 2738541283 Pedobacter sp. OK701 Isolate Unclassified
19 2738543010 Bacillus sp. YR335 Isolate Unclassified
20 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
21 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
22 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
23 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
24 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
25 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
26 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
27 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
28 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
29 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
30 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
31 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
32 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
33 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
135 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
171 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
172 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
175 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
180 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
181 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
185 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.64
Metatranscriptomes 0
Isolates 13.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0.4
Rhizoplane 0
Rhizosphere 80.57
Stem 0
Stem Tuber 0
Unclassified 17.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10142869 3300003320 Bacteria 6160
2 rootL2_10156889 3300003322 Bacteria 1769
3 rootH1_10112374 3300003323 Bacteria 2299
4 Ga0065714_10371642 3300005288 Bacteria 615
5 Ga0065704_10012905 3300005289 Bacteria 1945
6 Ga0065704_10083006 3300005289 Bacteria 3521
7 Ga0065715_10095939 3300005293 Bacteria 3976
8 Ga0065715_10110409 3300005293 Bacteria 2611
9 Ga0065715_10215635 3300005293 Bacteria 1237
10 Ga0070658_10149778 3300005327 Bacteria 1953
11 Ga0070690_100232455 3300005330 Bacteria 1297
12 Ga0070670_100034925 3300005331 Bacteria 4327
13 Ga0070670_100139153 3300005331 Bacteria 2099
14 Ga0070666_10805349 3300005335 Bacteria 692
15 Ga0070682_100020134 3300005337 Bacteria 3923
16 Ga0070682_100563126 3300005337 Bacteria 894
17 Ga0068868_100081303 3300005338 Bacteria 2597
18 Ga0070660_100182064 3300005339 Bacteria 1700
19 Ga0070661_100032565 3300005344 Bacteria 3774
20 Ga0070668_100058129 3300005347 Bacteria 2991
21 Ga0070668_100211796 3300005347 Bacteria 1595
22 Ga0070675_101315915 3300005354 Bacteria 666
23 Ga0070673_101148278 3300005364 Bacteria 727
24 Ga0070667_100137123 3300005367 Bacteria 2140
25 Ga0070713_100486898 3300005436 Unclassified 1162
26 Ga0070663_100269016 3300005455 Bacteria 1354
27 Ga0070681_10088521 3300005458 Bacteria 3048
28 Ga0070681_10430542 3300005458 Bacteria 1231
29 Ga0068867_100220136 3300005459 Bacteria 1529
30 Ga0070685_10035742 3300005466 Bacteria 2805
31 Ga0070679_100148657 3300005530 Bacteria 2320
32 Ga0070684_100313238 3300005535 Bacteria 1441
33 Ga0068853_100020584 3300005539 Bacteria 5487
34 Ga0068853_100043967 3300005539 Bacteria 3822
35 Ga0068853_100174429 3300005539 Bacteria 1947
36 Ga0068855_100078188 3300005563 Bacteria 3838
37 Ga0070664_100059321 3300005564 Bacteria 3255
38 Ga0068854_100157177 3300005578 Bacteria 1758
39 Ga0068859_100053979 3300005617 Bacteria 4041
40 Ga0068864_100433863 3300005618 Bacteria 1254
41 Ga0068866_10005460 3300005718 Bacteria 5247
42 Ga0068861_101512486 3300005719 Bacteria 659
43 Ga0097621_100027606 3300006237 Bacteria 4466
44 Ga0068871_100881138 3300006358 Bacteria 829
45 Ga0097620_100053979 3300006931 Bacteria 4041
46 Ga0105244_10000764 3300009036 Bacteria 27477
47 Ga0105242_10089340 3300009176 Bacteria 2589
48 Ga0105237_10005378 3300009545 Bacteria 14473
49 Ga0105237_10674558 3300009545 Bacteria 1040
50 Ga0105237_10973976 3300009545 Bacteria 855
51 Ga0105239_11620767 3300010375 Bacteria 748
52 Ga0105246_10058512 3300011119 Bacteria 2670
53 Ga0157373_10222956 3300013100 Unclassified 1330
54 Ga0157371_10005892 3300013102 Bacteria 10236
55 Ga0157371_10017759 3300013102 Bacteria 5278
56 Ga0157370_10005230 3300013104 Bacteria 14608
57 Ga0157370_10079252 3300013104 Bacteria 3093
58 Ga0157370_10348604 3300013104 Bacteria 1365
59 Ga0157370_10430880 3300013104 Bacteria 1213
60 Ga0157378_10217411 3300013297 Bacteria 1815
61 Ga0157372_10007442 3300013307 Bacteria 11645
62 Ga0157372_10025542 3300013307 Bacteria 6425
63 Ga0157372_10126161 3300013307 Bacteria 2943
64 Ga0157372_10181128 3300013307 Bacteria 2439
65 Ga0157372_10217396 3300013307 Bacteria 2215
66 Ga0157372_11081609 3300013307 Bacteria 928
67 Ga0157376_10191959 3300014969 Bacteria 1873
68 Ga0182006_1000109 3300015261 Bacteria 89541
69 Ga0182005_1038681 3300015265 Bacteria 1298
70 Ga0163161_10001003 3300017792 Bacteria 21495
71 Ga0163161_10001683 3300017792 Bacteria 16226
72 Ga0213873_10000001 3300021358 Bacteria 1657979
73 Ga0213876_10000002 3300021384 Bacteria 1168769
74 Ga0213876_10051838 3300021384 Unclassified 2168
75 Ga0209675_1000033 3300025291 Bacteria 271576
76 Ga0207655_1001261 3300025728 Bacteria 24132
77 Ga0207645_10000979 3300025907 Bacteria 23614
78 Ga0207707_10171123 3300025912 Bacteria 1898
79 Ga0207707_10367034 3300025912 Bacteria 1239
80 Ga0207671_10027556 3300025914 Bacteria 4248
81 Ga0207657_10210459 3300025919 Bacteria 1561
82 Ga0207649_10193939 3300025920 Bacteria 1430
83 Ga0207652_10092286 3300025921 Bacteria 2663
84 Ga0207681_10004756 3300025923 Bacteria 8357
85 Ga0207650_10105496 3300025925 Bacteria 2176
86 Ga0207650_10317745 3300025925 Bacteria 1275
87 Ga0207659_10152200 3300025926 Bacteria 1807
88 Ga0207659_10207034 3300025926 Bacteria 1570
89 Ga0207700_10110671 3300025928 Unclassified 2209
90 Ga0207690_10644726 3300025932 Bacteria 867
91 Ga0207706_10131454 3300025933 Bacteria 2202
92 Ga0207686_10109472 3300025934 Bacteria 1860
93 Ga0207709_10034289 3300025935 Bacteria 2990
94 Ga0207704_10113396 3300025938 Bacteria 1838
95 Ga0207691_10244911 3300025940 Bacteria 1549
96 Ga0207679_11291707 3300025945 Bacteria 670
97 Ga0207667_10679383 3300025949 Bacteria 1033
98 Ga0207668_10236738 3300025972 Bacteria 1475
99 Ga0207640_11047114 3300025981 Bacteria 720
100 Ga0207658_10025303 3300025986 Bacteria 4156
101 Ga0207677_10022314 3300026023 Bacteria 3888
102 Ga0207639_11273083 3300026041 Bacteria 690
103 Ga0207678_10281062 3300026067 Bacteria 1428
104 Ga0207678_10654641 3300026067 Bacteria 923
105 Ga0207648_10028250 3300026089 Bacteria 4974
106 Ga0207648_10045118 3300026089 Bacteria 3867
107 Ga0207676_10425002 3300026095 Bacteria 1247
108 Ga0207674_10139497 3300026116 Bacteria 2384
109 Ga0207674_10275445 3300026116 Bacteria 1630
110 Ga0207674_10499978 3300026116 Bacteria 1175
111 Ga0207675_100211640 3300026118 Bacteria 1865
112 Ga0207683_10004452 3300026121 Bacteria 12100
113 Ga0207683_10618713 3300026121 Bacteria 1003
114 Ga0307509_10041707 3300031507 Bacteria 4978
115 Ga0307408_100127893 3300031548 Unclassified 1978
116 Ga0316576_10004932 3300031727 Bacteria 8078
117 Ga0307405_10659844 3300031731 Bacteria 861
118 Ga0316577_10359502 3300031733 Bacteria 827
119 Ga0307410_10077854 3300031852 Bacteria 2319
120 Ga0307412_10000012 3300031911 Bacteria 404180
121 Ga0307412_10000451 3300031911 Bacteria 24824
122 Ga0307412_10009549 3300031911 Bacteria 5571
123 Ga0307412_10016259 3300031911 Bacteria 4429
124 Ga0307412_10030176 3300031911 Bacteria 3410
125 Ga0307409_100038791 3300031995 Bacteria 3527
126 Ga0307409_100365200 3300031995 Bacteria 1367
127 Ga0307409_100376803 3300031995 Bacteria 1347
128 Ga0307416_100000039 3300032002 Bacteria 133298
129 Ga0307416_100008332 3300032002 Bacteria 6677
130 Ga0307416_100025768 3300032002 Bacteria 4319
131 Ga0307416_100135554 3300032002 Bacteria 2226
132 Ga0307414_10000004 3300032004 Bacteria 472218
133 Ga0307414_10239904 3300032004 Bacteria 1500
134 Ga0307411_10016951 3300032005 Bacteria 4135
135 Ga0307415_100022506 3300032126 Bacteria 3891
136 Ga0307415_100088763 3300032126 Bacteria 2231
137 Ga0395900_0401450 3300037418 Bacteria 1335
138 Ga0395905_0000322 3300037471 Bacteria 69113
139 Ga0436365_0862132 3300039437 Bacteria 257735
140 Ga0436365_1006620 3300039437 Bacteria 5442
141 Ga0436361_0005690 3300039447 Bacteria 1679
142 Ga0436362_0842419 3300039453 Bacteria 317447
143 Ga0451851_0561110 3300041507 Bacteria 649
144 Ga0451855_0259562 3300041511 Bacteria 1018
145 Ga0451855_0906492 3300041511 Unclassified 1013
146 Ga0451855_1015983 3300041511 Unclassified 1179
147 Ga0439445_0001722 3300042004 Bacteria 4812
148 Ga0451577_0000250 3300042876 Bacteria 105934
149 Ga0466963_0579180 3300044694 Unclassified 793
150 Ga0466971_0002003 3300044719 Bacteria 8631
151 Ga0466957_0004677 3300044842 Bacteria 7654
152 Ga0466957_0102996 3300044842 Bacteria 1802
153 Ga0495627_000003 3300046453 Bacteria 704557
154 Ga0495627_017984 3300046453 Bacteria 2393
155 Ga0495596_0011948 3300046500 Bacteria 3727
156 Ga0495606_0020505 3300046507 Bacteria 4870
157 Ga0495610_0000001 3300046512 Bacteria 1620061
158 Ga0495632_0003489 3300046519 Bacteria 11122
159 Ga0495643_0032488 3300046522 Bacteria 2897
160 Ga0495663_0078183 3300046525 Bacteria 1062
161 Ga0495654_0000001 3300046530 Bacteria 1513197
162 Ga0495598_0005649 3300046537 Bacteria 2785
163 Ga0495633_0000008 3300046558 Bacteria 301830
164 Ga0495633_0005990 3300046558 Bacteria 7306
165 Ga0495625_0001202 3300046660 Bacteria 32933
166 Ga0495660_0031200 3300046810 Bacteria 2998
167 Ga0495672_0007622 3300047320 Bacteria 8122
168 Ga0495679_040119 3300047446 Bacteria 1457
169 Ga0495686_0001041 3300047472 Bacteria 33277
170 Ga0496116_0000022 3300048919 Bacteria 482506
171 Ga0496117_0000064 3300048920 Bacteria 254248
172 Ga0496117_0211800 3300048920 Bacteria 1086
173 Ga0496118_0002371 3300048921 Bacteria 25492
174 Ga0496119_0000025 3300048922 Bacteria 257069
175 Ga0496120_0087104 3300048923 Bacteria 1677
176 Ga0496121_0494217 3300048924 Bacteria 778
177 Ga0496122_0000109 3300048925 Bacteria 190828
178 Ga0496122_0001362 3300048925 Bacteria 39760
179 Ga0496122_0001579 3300048925 Bacteria 35800
180 Ga0496122_0004443 3300048925 Bacteria 17404
181 Ga0496122_0006972 3300048925 Bacteria 12720
182 Ga0496122_0011333 3300048925 Bacteria 9047
183 Ga0496123_0000897 3300048926 Bacteria 47137
184 Ga0496123_0004805 3300048926 Bacteria 13947
185 Ga0496123_0028687 3300048926 Bacteria 4113
186 Ga0496123_0035439 3300048926 Bacteria 3556
187 Ga0496124_0000287 3300048927 Bacteria 95238
188 Ga0496125_0000662 3300048928 Bacteria 57446
189 Ga0496125_0010764 3300048928 Bacteria 9213
190 Ga0496125_0023490 3300048928 Bacteria 5690
191 Ga0496125_0028469 3300048928 Bacteria 5046
192 Ga0496126_0001868 3300048929 Bacteria 30681
193 Ga0501032_0107948 3300049569 Unclassified 1843
194 Ga0501034_0001019 3300049571 Bacteria 40140
195 Ga0501034_0121746 3300049571 Unclassified 2595
196 Ga0501047_0040052 3300049581 Bacteria 4531
197 Ga0501047_0430980 3300049581 Bacteria 1149
198 Ga0501198_021531 3300049649 Bacteria 1028
199 Ga0501217_047004 3300049661 Bacteria 1116
200 Ga0501233_009179 3300049668 Bacteria 1925
201 Ga0501235_011204 3300049669 Bacteria 1964
202 Ga0501242_009953 3300049674 Bacteria 1130
203 Ga0501243_014744 3300049675 Bacteria 1251
204 Ga0501249_034856 3300049679 Bacteria 1130
205 Ga0501221_021399 3300049704 Bacteria 1273
206 Ga0501225_0027793 3300049705 Bacteria 1555
207 Ga0501234_008900 3300049707 Bacteria 1565
208 Ga0501241_000203 3300049758 Bacteria 13378
209 Ga0501268_022275 3300049765 Bacteria 1093
210 Ga0501035_0792697 3300049822 Bacteria 757
211 Ga0501044_0084495 3300049823 Bacteria 3208
212 Ga0500578_0000024 3300053086 Bacteria 151503
213 Ga0500593_000764 3300053117 Bacteria 12038
214 Ga0466962_0000047 3300061719 Bacteria 50198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_1015983 Ga0451855_1015983_115_633 168
2 3300041511 Ga0451855_0906492 Ga0451855_0906492_295_816 169
3 3300010375 Ga0105239_11620767 Ga0105239_116207671 171
4 3300041511 Ga0451855_0259562 Ga0451855_0259562_228_749 171
5 3300044842 Ga0466957_0102996 Ga0466957_0102996_1237_1782 172
6 3300005535 Ga0070684_100313238 Ga0070684_1003132382 176
7 iso_pu_bacteria 2511231000 2511231191 179
8 iso_pu_bacteria 2582581281 2585156653 179
9 iso_pu_bacteria 2582581282 2585161044 179
10 3300005327 Ga0070658_10149778 Ga0070658_101497783 180
11 3300005466 Ga0070685_10035742 Ga0070685_100357423 180
12 3300013307 Ga0157372_10007442 Ga0157372_1000744213 180
13 3300026095 Ga0207676_10425002 Ga0207676_104250022 180
14 3300053117 Ga0500593_000764 Ga0500593_000764_359_913 180
15 iso_pu_bacteria 2582581278 2585141389 180
16 iso_pu_bacteria 2585428182 2588208006 180
17 iso_pu_bacteria 2585428183 2588213417 180
18 iso_pu_bacteria 2585428184 2588220019 180
19 iso_pu_bacteria 2585428185 2588223683 180
20 iso_pu_bacteria 2738541283 2738759428 180
21 iso_pu_bacteria 2765235839 2765572823 180
22 iso_pu_bacteria 2816332188 2816873156 180
23 iso_pu_bacteria 2871720351 2871722721 180
24 iso_pu_bacteria 2889290771 2889291471 180
25 iso_pu_bacteria 2585428045 2587678370 181
26 iso_pu_bacteria 2585428060 2587749410 181
27 iso_pu_bacteria 2585428115 2587942812 181
28 iso_pu_bacteria 2585428187 2588233357 181
29 iso_pu_bacteria 2588253712 2588446622 181
30 iso_pu_bacteria 2588254255 2590600594 181
31 iso_pu_bacteria 2588254257 2590612132 181
32 iso_pu_bacteria 2643221667 2644371902 181
33 iso_pu_bacteria 2728369107 2729198760 181
34 iso_pu_bacteria 2739367874 2740057918 181
35 iso_pu_bacteria 2751185877 2753672500 181
36 iso_pu_bacteria 2772190705 2772604335 181
37 iso_pu_bacteria 2842083920 2842084357 181
38 iso_pu_bacteria 2905999023 2906001886 181
39 iso_pu_bacteria 2919399522 2919403084 181
40 iso_pu_bacteria 2945924605 2945927186 181
41 iso_pu_bacteria 2946019816 2946021584 181
42 iso_pu_bacteria 2993372514 2993373428 181
43 3300005436 Ga0070713_100486898 Ga0070713_1004868982 182
44 3300021358 Ga0213873_10000001 Ga0213873_100000011375 182
45 3300021384 Ga0213876_10000002 Ga0213876_10000002164 182
46 3300025928 Ga0207700_10110671 Ga0207700_101106714 182
47 3300037418 Ga0395900_0401450 Ga0395900_0401450_512_1072 182
48 3300039437 Ga0436365_0862132 Ga0436365_0862132_192077_192643 182
49 3300039453 Ga0436362_0842419 Ga0436362_0842419_259003_259569 182
50 3300049571 Ga0501034_0121746 Ga0501034_0121746_1443_2000 182
51 3300005455 Ga0070663_100269016 Ga0070663_1002690163 183
52 3300005458 Ga0070681_10430542 Ga0070681_104305422 183
53 3300005530 Ga0070679_100148657 Ga0070679_1001486574 183
54 3300005539 Ga0068853_100020584 Ga0068853_1000205848 183
55 3300013104 Ga0157370_10348604 Ga0157370_103486042 183
56 3300013307 Ga0157372_10217396 Ga0157372_102173962 183
57 3300025912 Ga0207707_10367034 Ga0207707_103670342 183
58 3300025921 Ga0207652_10092286 Ga0207652_100922863 183
59 3300025932 Ga0207690_10644726 Ga0207690_106447261 183
60 3300026067 Ga0207678_10281062 Ga0207678_102810623 183
61 3300026116 Ga0207674_10139497 Ga0207674_101394972 183
62 3300026116 Ga0207674_10275445 Ga0207674_102754452 183
63 3300037471 Ga0395905_0000322 Ga0395905_0000322_20721_21278 183
64 3300046810 Ga0495660_0031200 Ga0495660_0031200_1724_2281 183
65 3300047446 Ga0495679_040119 Ga0495679_040119_864_1421 183
66 3300049822 Ga0501035_0792697 Ga0501035_0792697_186_743 183
67 3300053086 Ga0500578_0000024 Ga0500578_0000024_66291_66848 183
68 iso_pu_bacteria 2919509842 2919512827 183
69 3300003320 rootH2_10142869 rootH2_101428696 184
70 3300003322 rootL2_10156889 rootL2_101568892 184
71 3300003323 rootH1_10112374 rootH1_101123743 184
72 3300005288 Ga0065714_10371642 Ga0065714_103716421 184
73 3300005289 Ga0065704_10012905 Ga0065704_100129051 184
74 3300005289 Ga0065704_10083006 Ga0065704_100830065 184
75 3300005293 Ga0065715_10095939 Ga0065715_100959392 184
76 3300005293 Ga0065715_10110409 Ga0065715_101104092 184
77 3300005293 Ga0065715_10215635 Ga0065715_102156352 184
78 3300005330 Ga0070690_100232455 Ga0070690_1002324552 184
79 3300005331 Ga0070670_100034925 Ga0070670_1000349258 184
80 3300005331 Ga0070670_100139153 Ga0070670_1001391532 184
81 3300005335 Ga0070666_10805349 Ga0070666_108053491 184
82 3300005337 Ga0070682_100020134 Ga0070682_1000201342 184
83 3300005337 Ga0070682_100563126 Ga0070682_1005631261 184
84 3300005338 Ga0068868_100081303 Ga0068868_1000813034 184
85 3300005339 Ga0070660_100182064 Ga0070660_1001820642 184
86 3300005344 Ga0070661_100032565 Ga0070661_1000325655 184
87 3300005347 Ga0070668_100058129 Ga0070668_1000581293 184
88 3300005347 Ga0070668_100211796 Ga0070668_1002117963 184
89 3300005354 Ga0070675_101315915 Ga0070675_1013159151 184
90 3300005364 Ga0070673_101148278 Ga0070673_1011482781 184
91 3300005367 Ga0070667_100137123 Ga0070667_1001371233 184
92 3300005458 Ga0070681_10088521 Ga0070681_100885215 184
93 3300005459 Ga0068867_100220136 Ga0068867_1002201362 184
94 3300005539 Ga0068853_100043967 Ga0068853_1000439676 184
95 3300005539 Ga0068853_100174429 Ga0068853_1001744294 184
96 3300005563 Ga0068855_100078188 Ga0068855_1000781885 184
97 3300005564 Ga0070664_100059321 Ga0070664_1000593215 184
98 3300005578 Ga0068854_100157177 Ga0068854_1001571772 184
99 3300005617 Ga0068859_100053979 Ga0068859_1000539796 184
100 3300005618 Ga0068864_100433863 Ga0068864_1004338632 184
101 3300005718 Ga0068866_10005460 Ga0068866_100054603 184
102 3300005719 Ga0068861_101512486 Ga0068861_1015124861 184
103 3300006237 Ga0097621_100027606 Ga0097621_1000276062 184
104 3300006358 Ga0068871_100881138 Ga0068871_1008811381 184
105 3300006931 Ga0097620_100053979 Ga0097620_1000539796 184
106 3300009036 Ga0105244_10000764 Ga0105244_1000076423 184
107 3300009176 Ga0105242_10089340 Ga0105242_100893404 184
108 3300009545 Ga0105237_10005378 Ga0105237_100053785 184
109 3300009545 Ga0105237_10674558 Ga0105237_106745582 184
110 3300009545 Ga0105237_10973976 Ga0105237_109739761 184
111 3300011119 Ga0105246_10058512 Ga0105246_100585122 184
112 3300013100 Ga0157373_10222956 Ga0157373_102229563 184
113 3300013102 Ga0157371_10005892 Ga0157371_100058927 184
114 3300013102 Ga0157371_10017759 Ga0157371_100177595 184
115 3300013104 Ga0157370_10005230 Ga0157370_100052306 184
116 3300013104 Ga0157370_10079252 Ga0157370_100792522 184
117 3300013104 Ga0157370_10430880 Ga0157370_104308802 184
118 3300013297 Ga0157378_10217411 Ga0157378_102174112 184
119 3300013307 Ga0157372_10025542 Ga0157372_100255424 184
120 3300013307 Ga0157372_10126161 Ga0157372_101261612 184
121 3300013307 Ga0157372_10181128 Ga0157372_101811282 184
122 3300013307 Ga0157372_11081609 Ga0157372_110816091 184
123 3300014969 Ga0157376_10191959 Ga0157376_101919593 184
124 3300015261 Ga0182006_1000109 Ga0182006_10001096 184
125 3300015265 Ga0182005_1038681 Ga0182005_10386811 184
126 3300017792 Ga0163161_10001003 Ga0163161_1000100310 184
127 3300017792 Ga0163161_10001683 Ga0163161_100016836 184
128 3300021384 Ga0213876_10051838 Ga0213876_100518384 184
129 3300025291 Ga0209675_1000033 Ga0209675_1000033251 184
130 3300025728 Ga0207655_1001261 Ga0207655_100126121 184
131 3300025907 Ga0207645_10000979 Ga0207645_100009797 184
132 3300025912 Ga0207707_10171123 Ga0207707_101711231 184
133 3300025914 Ga0207671_10027556 Ga0207671_100275564 184
134 3300025919 Ga0207657_10210459 Ga0207657_102104592 184
135 3300025920 Ga0207649_10193939 Ga0207649_101939393 184
136 3300025923 Ga0207681_10004756 Ga0207681_100047565 184
137 3300025925 Ga0207650_10105496 Ga0207650_101054963 184
138 3300025925 Ga0207650_10317745 Ga0207650_103177452 184
139 3300025926 Ga0207659_10152200 Ga0207659_101522002 184
140 3300025926 Ga0207659_10207034 Ga0207659_102070342 184
141 3300025933 Ga0207706_10131454 Ga0207706_101314543 184
142 3300025934 Ga0207686_10109472 Ga0207686_101094723 184
143 3300025935 Ga0207709_10034289 Ga0207709_100342895 184
144 3300025938 Ga0207704_10113396 Ga0207704_101133963 184
145 3300025940 Ga0207691_10244911 Ga0207691_102449113 184
146 3300025945 Ga0207679_11291707 Ga0207679_112917071 184
147 3300025949 Ga0207667_10679383 Ga0207667_106793831 184
148 3300025972 Ga0207668_10236738 Ga0207668_102367382 184
149 3300025981 Ga0207640_11047114 Ga0207640_110471141 184
150 3300025986 Ga0207658_10025303 Ga0207658_100253035 184
151 3300026023 Ga0207677_10022314 Ga0207677_100223142 184
152 3300026041 Ga0207639_11273083 Ga0207639_112730831 184
153 3300026067 Ga0207678_10654641 Ga0207678_106546412 184
154 3300026089 Ga0207648_10028250 Ga0207648_100282506 184
155 3300026089 Ga0207648_10045118 Ga0207648_100451188 184
156 3300026116 Ga0207674_10499978 Ga0207674_104999782 184
157 3300026118 Ga0207675_100211640 Ga0207675_1002116402 184
158 3300026121 Ga0207683_10004452 Ga0207683_100044528 184
159 3300026121 Ga0207683_10618713 Ga0207683_106187131 184
160 3300031507 Ga0307509_10041707 Ga0307509_100417072 184
161 3300031548 Ga0307408_100127893 Ga0307408_1001278932 184
162 3300031727 Ga0316576_10004932 Ga0316576_100049328 184
163 3300031731 Ga0307405_10659844 Ga0307405_106598441 184
164 3300031733 Ga0316577_10359502 Ga0316577_103595022 184
165 3300031852 Ga0307410_10077854 Ga0307410_100778542 184
166 3300031911 Ga0307412_10000012 Ga0307412_1000001224 184
167 3300031911 Ga0307412_10000451 Ga0307412_100004518 184
168 3300031911 Ga0307412_10009549 Ga0307412_100095496 184
169 3300031911 Ga0307412_10016259 Ga0307412_100162593 184
170 3300031911 Ga0307412_10030176 Ga0307412_100301762 184
171 3300031995 Ga0307409_100038791 Ga0307409_1000387914 184
172 3300031995 Ga0307409_100365200 Ga0307409_1003652002 184
173 3300031995 Ga0307409_100376803 Ga0307409_1003768032 184
174 3300032002 Ga0307416_100000039 Ga0307416_100000039123 184
175 3300032002 Ga0307416_100008332 Ga0307416_1000083323 184
176 3300032002 Ga0307416_100025768 Ga0307416_1000257683 184
177 3300032002 Ga0307416_100135554 Ga0307416_1001355541 184
178 3300032004 Ga0307414_10000004 Ga0307414_10000004246 184
179 3300032004 Ga0307414_10239904 Ga0307414_102399042 184
180 3300032005 Ga0307411_10016951 Ga0307411_100169513 184
181 3300032126 Ga0307415_100022506 Ga0307415_1000225061 184
182 3300032126 Ga0307415_100088763 Ga0307415_1000887632 184
183 3300039437 Ga0436365_1006620 Ga0436365_1006620_3691_4254 184
184 3300039447 Ga0436361_0005690 Ga0436361_0005690_631_1188 184
185 3300041507 Ga0451851_0561110 Ga0451851_0561110_24_605 184
186 3300042004 Ga0439445_0001722 Ga0439445_0001722_3419_3979 184
187 3300042876 Ga0451577_0000250 Ga0451577_0000250_84117_84689 184
188 3300044694 Ga0466963_0579180 Ga0466963_0579180_147_710 184
189 3300044719 Ga0466971_0002003 Ga0466971_0002003_6865_7437 184
190 3300044842 Ga0466957_0004677 Ga0466957_0004677_3774_4340 184
191 3300046453 Ga0495627_000003 Ga0495627_000003_310603_311160 184
192 3300046453 Ga0495627_017984 Ga0495627_017984_1262_1819 184
193 3300046500 Ga0495596_0011948 Ga0495596_0011948_1961_2515 184
194 3300046507 Ga0495606_0020505 Ga0495606_0020505_151_708 184
195 3300046512 Ga0495610_0000001 Ga0495610_0000001_1617627_1618184 184
196 3300046519 Ga0495632_0003489 Ga0495632_0003489_2947_3504 184
197 3300046522 Ga0495643_0032488 Ga0495643_0032488_690_1247 184
198 3300046525 Ga0495663_0078183 Ga0495663_0078183_433_990 184
199 3300046530 Ga0495654_0000001 Ga0495654_0000001_809331_809888 184
200 3300046537 Ga0495598_0005649 Ga0495598_0005649_1430_1993 184
201 3300046558 Ga0495633_0000008 Ga0495633_0000008_267697_268254 184
202 3300046558 Ga0495633_0005990 Ga0495633_0005990_1096_1653 184
203 3300046660 Ga0495625_0001202 Ga0495625_0001202_2989_3546 184
204 3300047320 Ga0495672_0007622 Ga0495672_0007622_2014_2589 184
205 3300047472 Ga0495686_0001041 Ga0495686_0001041_31775_32332 184
206 3300048919 Ga0496116_0000022 Ga0496116_0000022_456937_457554 184
207 3300048920 Ga0496117_0000064 Ga0496117_0000064_222704_223321 184
208 3300048920 Ga0496117_0211800 Ga0496117_0211800_122_679 184
209 3300048921 Ga0496118_0002371 Ga0496118_0002371_16228_16845 184
210 3300048922 Ga0496119_0000025 Ga0496119_0000025_33620_34237 184
211 3300048923 Ga0496120_0087104 Ga0496120_0087104_859_1476 184
212 3300048924 Ga0496121_0494217 Ga0496121_0494217_110_664 184
213 3300048925 Ga0496122_0000109 Ga0496122_0000109_82892_83449 184
214 3300048925 Ga0496122_0001362 Ga0496122_0001362_9963_10580 184
215 3300048925 Ga0496122_0001579 Ga0496122_0001579_4920_5474 184
216 3300048925 Ga0496122_0004443 Ga0496122_0004443_2042_2599 184
217 3300048925 Ga0496122_0006972 Ga0496122_0006972_713_1279 184
218 3300048925 Ga0496122_0011333 Ga0496122_0011333_2688_3245 184
219 3300048926 Ga0496123_0000897 Ga0496123_0000897_17359_17976 184
220 3300048926 Ga0496123_0004805 Ga0496123_0004805_8230_8784 184
221 3300048926 Ga0496123_0028687 Ga0496123_0028687_1915_2481 184
222 3300048926 Ga0496123_0035439 Ga0496123_0035439_943_1500 184
223 3300048927 Ga0496124_0000287 Ga0496124_0000287_67063_67680 184
224 3300048928 Ga0496125_0000662 Ga0496125_0000662_3860_4414 184
225 3300048928 Ga0496125_0010764 Ga0496125_0010764_5356_5973 184
226 3300048928 Ga0496125_0023490 Ga0496125_0023490_1108_1668 184
227 3300048928 Ga0496125_0028469 Ga0496125_0028469_3739_4305 184
228 3300048929 Ga0496126_0001868 Ga0496126_0001868_25975_26529 184
229 3300049569 Ga0501032_0107948 Ga0501032_0107948_782_1354 184
230 3300049571 Ga0501034_0001019 Ga0501034_0001019_37342_37917 184
231 3300049581 Ga0501047_0040052 Ga0501047_0040052_3193_3759 184
232 3300049581 Ga0501047_0430980 Ga0501047_0430980_37_603 184
233 3300049649 Ga0501198_021531 Ga0501198_021531_296_865 184
234 3300049661 Ga0501217_047004 Ga0501217_047004_452_1021 184
235 3300049668 Ga0501233_009179 Ga0501233_009179_937_1512 184
236 3300049669 Ga0501235_011204 Ga0501235_011204_653_1222 184
237 3300049674 Ga0501242_009953 Ga0501242_009953_424_993 184
238 3300049675 Ga0501243_014744 Ga0501243_014744_155_724 184
239 3300049679 Ga0501249_034856 Ga0501249_034856_510_1085 184
240 3300049704 Ga0501221_021399 Ga0501221_021399_203_772 184
241 3300049705 Ga0501225_0027793 Ga0501225_0027793_856_1425 184
242 3300049707 Ga0501234_008900 Ga0501234_008900_382_951 184
243 3300049758 Ga0501241_000203 Ga0501241_000203_5808_6365 184
244 3300049765 Ga0501268_022275 Ga0501268_022275_334_903 184
245 3300049823 Ga0501044_0084495 Ga0501044_0084495_2333_2899 184
246 3300061719 Ga0466962_0000047 Ga0466962_0000047_11556_12128 184
247 iso_pu_bacteria 2738543010 2739234344 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14066

DUF4256

Protein of unknown function (DUF4256)

35

207

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sb2-assembly1.cif.gz_B high resolution structure determination of rhodocetin 0.7501 151 184
8oks-assembly1.cif.gz_A crystal structure of bdellovibrio bacteriovorus bd2740 c-terminal domain 0.724 60 182
5aoh-assembly2.cif.gz_B crystal structure of carf 0.6973 129 184
6tjv-assembly1.cif.gz_S structure of the ndh-1ms complex from thermosynechococcus elongatus 0.6748 139 174
8oks-assembly1.cif.gz_A crystal structure of bdellovibrio bacteriovorus bd2740 c-terminal domain 0.6739 60 182
ID Description Score Start End Superfamily
af_Q9VD65_22_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7656 137 168 3.40.50.300
1sb2B00 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7501 151 184 3.10.100.10
af_O75534_95_184_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7198 141 168 2.40.50.140
af_Q54UX9_49_189_2.50.20.30 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A; 0.6944 150 173 2.50.20.30
af_Q19393_35_317_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.6912 135 168 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A7T9C050-F1-model_v4 deleted 0.9973 8 184
AF-A0A3A4RTE5-F1-model_v4 DUF4256 domain-containing protein 0.9957 5 184
AF-M6Z745-F1-model_v4 PF14066 family protein 0.9952 4 184
AF-A0A0J7J108-F1-model_v4 DUF4256 domain-containing protein 0.9947 10 184
AF-A0A261QE04-F1-model_v4 YdhG-like domain-containing protein 0.9942 4 184

Feature Viewer

pLDDT pTM Quality
94 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map