F358750

General Info

Members Datasets Scaffolds Average Seq Length
247 148 494 337

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100207907|Ga0068868_1002079072
Length 377
Sequence MPLDTSFHHVSVSPECPPTQWCVPQNATVKESMSAPESRFVKACRALPVDRTPVWFMRQAGRYMPEYRAVRKQYSLIEICKRPEVAAEVTITAAEALGVDAVIIFADLLLPLEVMGLPFHFSPGEGPVIEKPVRDQADISRLRIDRAADLGYVSEAVRRVCKHFGPRLPVIGFCGAPFTLASYMIEGGSSRNYVYAKKMMYSSAAAWDELLGKLVAVVSEYAAEQVRAGADVIQVFDSWVGCLSVDDYRQYVLPRTTELVKSLQKTGVPIIYFGTDSATLLPSMKETGAEVIGLDWRIPLDQGWAAVGSGAVQGNLDPVLLFAEWKEVEASARAILRRAGGRPGHIFNLGHGILPETPVENVKALARFVQEYSAKSG

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
99 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
141 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
142 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.4
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.45
Nodule 0
Rhizoplane 4.45
Rhizosphere 90.28
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100207907 3300005338 Bacteria 1634
2 JGI25406J46586_10021476 3300003203 Bacteria 2590
3 rootL2_10019472 3300003322 Bacteria 3367
4 Ga0070683_100056812 3300005329 Bacteria 3634
5 Ga0070683_100205503 3300005329 Bacteria 1871
6 Ga0070666_10014028 3300005335 Bacteria 5095
7 Ga0070682_100004452 3300005337 Bacteria 7778
8 Ga0068868_100019031 3300005338 Bacteria 5141
9 Ga0070691_10015303 3300005341 Bacteria 3524
10 Ga0070709_10002300 3300005434 Bacteria 10371
11 Ga0070709_10218242 3300005434 Bacteria 1359
12 Ga0070714_100000122 3300005435 Bacteria 62194
13 Ga0070714_100061078 3300005435 Bacteria 3236
14 Ga0070714_100332597 3300005435 Bacteria 1423
15 Ga0070713_100001842 3300005436 Bacteria 13678
16 Ga0070711_100112191 3300005439 Bacteria 2003
17 Ga0070694_100335548 3300005444 Bacteria 1167
18 Ga0070708_100000001 3300005445 Bacteria 245117
19 Ga0070708_100000410 3300005445 Bacteria 32257
20 Ga0070708_100000715 3300005445 Bacteria 25219
21 Ga0070708_100001170 3300005445 Bacteria 20215
22 Ga0070708_100004716 3300005445 Bacteria 10741
23 Ga0070708_100018218 3300005445 Bacteria 5876
24 Ga0070708_100025971 3300005445 Bacteria 5009
25 Ga0070708_100049581 3300005445 Bacteria 3715
26 Ga0070663_100044440 3300005455 Bacteria 3132
27 Ga0070681_10017513 3300005458 Bacteria 7160
28 Ga0070706_100000004 3300005467 Bacteria 281790
29 Ga0070706_100000005 3300005467 Bacteria 264211
30 Ga0070706_100000347 3300005467 Bacteria 55956
31 Ga0070706_100002861 3300005467 Bacteria 17203
32 Ga0070706_100008286 3300005467 Bacteria 9690
33 Ga0070706_100054187 3300005467 Bacteria 3702
34 Ga0070707_100000002 3300005468 Bacteria 291540
35 Ga0070707_100000229 3300005468 Bacteria 56136
36 Ga0070707_100002283 3300005468 Bacteria 18326
37 Ga0070707_100002913 3300005468 Bacteria 16246
38 Ga0070707_100043842 3300005468 Bacteria 4282
39 Ga0070707_100084741 3300005468 Bacteria 3062
40 Ga0070707_100291208 3300005468 Bacteria 1586
41 Ga0070698_100001899 3300005471 Bacteria 23281
42 Ga0070698_100002099 3300005471 Bacteria 22129
43 Ga0070698_100025666 3300005471 Bacteria 6139
44 Ga0070698_100178937 3300005471 Bacteria 2059
45 Ga0070699_100000058 3300005518 Bacteria 106502
46 Ga0070699_100000111 3300005518 Bacteria 75509
47 Ga0070699_100000703 3300005518 Bacteria 30997
48 Ga0070699_100002074 3300005518 Bacteria 18134
49 Ga0070699_100002833 3300005518 Bacteria 15470
50 Ga0070699_100010282 3300005518 Bacteria 8092
51 Ga0070697_100000665 3300005536 Bacteria 25889
52 Ga0070697_100000965 3300005536 Bacteria 21706
53 Ga0070697_100011216 3300005536 Bacteria 7004
54 Ga0070697_100019521 3300005536 Bacteria 5355
55 Ga0070697_100023429 3300005536 Bacteria 4909
56 Ga0070697_100128983 3300005536 Bacteria 2120
57 Ga0070697_100168397 3300005536 Bacteria 1853
58 Ga0070695_100000001 3300005545 Bacteria 150757
59 Ga0070704_100000885 3300005549 Bacteria 14991
60 Ga0068854_100026114 3300005578 Unclassified 4012
61 Ga0068856_100035427 3300005614 Bacteria 4891
62 Ga0068851_10037720 3300005834 Bacteria 2423
63 Ga0068858_100060250 3300005842 Bacteria 3508
64 Ga0068860_100072631 3300005843 Unclassified 3270
65 Ga0081539_10000069 3300005985 Bacteria 236854
66 Ga0070717_10000184 3300006028 Bacteria 45456
67 Ga0070717_10000192 3300006028 Bacteria 43283
68 Ga0070717_10003501 3300006028 Bacteria 11239
69 Ga0070716_100005127 3300006173 Bacteria 6330
70 Ga0070716_100130701 3300006173 Bacteria 1587
71 Ga0075367_10002914 3300006178 Bacteria 7976
72 Ga0075366_10059424 3300006195 Bacteria 2271
73 Ga0097621_100006527 3300006237 Bacteria 8288
74 Ga0068871_100042346 3300006358 Unclassified 3655
75 Ga0075428_100091978 3300006844 Bacteria 3308
76 Ga0075428_100255912 3300006844 Bacteria 1886
77 Ga0075430_100006879 3300006846 Bacteria 9590
78 Ga0075430_100046792 3300006846 Bacteria 3653
79 Ga0075431_100001741 3300006847 Bacteria 20481
80 Ga0075431_100008809 3300006847 Bacteria 10110
81 Ga0075431_100011349 3300006847 Bacteria 8975
82 Ga0075431_100065280 3300006847 Bacteria 3759
83 Ga0075434_100123167 3300006871 Bacteria 2609
84 Ga0075429_100008605 3300006880 Bacteria 8877
85 Ga0075429_100019529 3300006880 Bacteria 5871
86 Ga0075429_100042781 3300006880 Bacteria 3942
87 Ga0075436_100005190 3300006914 Bacteria 8968
88 Ga0075436_100143873 3300006914 Bacteria 1676
89 Ga0075435_100012076 3300007076 Bacteria 6384
90 Ga0075435_100028425 3300007076 Bacteria 4386
91 Ga0105240_10007601 3300009093 Bacteria 15699
92 Ga0105245_10011013 3300009098 Bacteria 7871
93 Ga0114129_10000002 3300009147 Bacteria 204413
94 Ga0114129_10208209 3300009147 Bacteria 2645
95 Ga0105241_10002123 3300009174 Bacteria 14990
96 Ga0105248_10037424 3300009177 Bacteria 5429
97 Ga0105237_10250383 3300009545 Bacteria 1774
98 Ga0105239_10089423 3300010375 Bacteria 3396
99 Ga0105239_10292080 3300010375 Unclassified 1835
100 Ga0105246_10032136 3300011119 Bacteria 3478
101 Ga0157374_10121709 3300013296 Bacteria 2519
102 Ga0157374_10294179 3300013296 Unclassified 1605
103 Ga0157378_10000059 3300013297 Bacteria 95905
104 Ga0157378_10007101 3300013297 Bacteria 9779
105 Ga0163162_10006218 3300013306 Bacteria 11570
106 Ga0163162_10027037 3300013306 Bacteria 5673
107 Ga0182008_10009833 3300014497 Bacteria 5143
108 Ga0228598_1000061 3300024227 Bacteria 15965
109 Ga0207699_10067052 3300025906 Bacteria 2181
110 Ga0207645_10200048 3300025907 Bacteria 1314
111 Ga0207684_10000012 3300025910 Bacteria 478666
112 Ga0207684_10000021 3300025910 Bacteria 340887
113 Ga0207684_10000033 3300025910 Bacteria 291567
114 Ga0207684_10000931 3300025910 Bacteria 33094
115 Ga0207684_10002533 3300025910 Bacteria 18367
116 Ga0207684_10004233 3300025910 Bacteria 13615
117 Ga0207684_10101660 3300025910 Bacteria 2458
118 Ga0207654_10045833 3300025911 Bacteria 2491
119 Ga0207707_10174897 3300025912 Bacteria 1875
120 Ga0207695_10041729 3300025913 Bacteria 4909
121 Ga0207663_10085709 3300025916 Bacteria 2075
122 Ga0207649_10025475 3300025920 Bacteria 3448
123 Ga0207652_10237892 3300025921 Bacteria 1641
124 Ga0207652_10375942 3300025921 Bacteria 1282
125 Ga0207646_10000007 3300025922 Bacteria 478285
126 Ga0207646_10000067 3300025922 Bacteria 146410
127 Ga0207646_10002290 3300025922 Bacteria 22746
128 Ga0207646_10002865 3300025922 Bacteria 20023
129 Ga0207646_10007305 3300025922 Bacteria 11259
130 Ga0207646_10021180 3300025922 Bacteria 6011
131 Ga0207646_10023632 3300025922 Bacteria 5644
132 Ga0207646_10223935 3300025922 Bacteria 1699
133 Ga0207646_10230007 3300025922 Bacteria 1675
134 Ga0207694_10051842 3300025924 Bacteria 3180
135 Ga0207687_10010342 3300025927 Bacteria 6097
136 Ga0207700_10067743 3300025928 Bacteria 2734
137 Ga0207664_10000089 3300025929 Bacteria 85149
138 Ga0207664_10004114 3300025929 Bacteria 9821
139 Ga0207664_10022427 3300025929 Bacteria 4714
140 Ga0207664_10154363 3300025929 Bacteria 1953
141 Ga0207686_10068116 3300025934 Bacteria 2279
142 Ga0207665_10007970 3300025939 Bacteria 6993
143 Ga0207711_10457187 3300025941 Bacteria 1189
144 Ga0207679_10030393 3300025945 Bacteria 3771
145 Ga0207712_10025496 3300025961 Bacteria 3929
146 Ga0207668_10039151 3300025972 Bacteria 3188
147 Ga0207640_10019442 3300025981 Unclassified 4012
148 Ga0207677_10016756 3300026023 Unclassified 4350
149 Ga0207677_10017787 3300026023 Bacteria 4249
150 Ga0207702_10032754 3300026078 Bacteria 4337
151 Ga0207641_10014277 3300026088 Bacteria 6509
152 Ga0209966_1005665 3300027695 Bacteria 2147
153 Ga0268265_10008705 3300028380 Bacteria 6862
154 Ga0265760_10001444 3300031090 Bacteria 6996
155 Ga0265316_10040139 3300031344 Bacteria 3754
156 Ga0307408_100057198 3300031548 Bacteria 2830
157 Ga0265314_10027052 3300031711 Bacteria 4300
158 Ga0373931_0127325 3300035691 Bacteria 1462
159 Ga0373927_0016138 3300035695 Unclassified 4928
160 Ga0373947_0039748 3300035725 Bacteria 2800
161 Ga0316582_0000741 3300036647 Bacteria 13033
162 Ga0316582_0018402 3300036647 Bacteria 4066
163 Ga0373925_0034261 3300037068 Bacteria 3742
164 Ga0395901_0157150 3300038443 Bacteria 2388
165 Ga0436365_1744722 3300039437 Bacteria 1962
166 Ga0466964_0077143 3300044706 Bacteria 1422
167 Ga0453684_0072266 3300044712 Bacteria 4356
168 Ga0466958_0005628 3300045836 Bacteria 6761
169 Ga0466967_0143078 3300045976 Bacteria 2229
170 Ga0495638_0007184 3300046460 Bacteria 8017
171 Ga0495580_0007186 3300046472 Bacteria 8962
172 Ga0495663_0018794 3300046525 Bacteria 1970
173 Ga0495621_0009411 3300046539 Bacteria 2965
174 Ga0495672_0040927 3300047320 Bacteria 2807
175 Ga0496101_0025210 3300048904 Bacteria 4123
176 Ga0496102_0008278 3300048905 Bacteria 8905
177 Ga0496102_0029200 3300048905 Unclassified 4933
178 Ga0496103_0024787 3300048906 Bacteria 3620
179 Ga0496106_0088054 3300048909 Bacteria 2393
180 Ga0496106_0131147 3300048909 Bacteria 1966
181 Ga0496107_0135545 3300048910 Bacteria 1819
182 Ga0496112_0180249 3300048915 Bacteria 2076
183 Ga0496113_0242002 3300048916 Bacteria 1440
184 Ga0496114_0038596 3300048917 Bacteria 3952
185 Ga0496115_0057392 3300048918 Bacteria 3131
186 Ga0501033_0209608 3300049570 Bacteria 1390
187 Ga0501036_0114036 3300049572 Bacteria 2284
188 Ga0501038_0242613 3300049574 Bacteria 1430
189 Ga0501040_0049199 3300049576 Bacteria 2882
190 Ga0501040_0050219 3300049576 Bacteria 2852
191 Ga0501042_0033831 3300049578 Bacteria 3624
192 Ga0501048_0163934 3300049582 Bacteria 1573
193 Ga0501048_0194139 3300049582 Bacteria 1439
194 Ga0501067_0046492 3300049583 Bacteria 2409
195 Ga0501067_0105220 3300049583 Bacteria 1568
196 Ga0501069_0005043 3300049585 Bacteria 6846
197 Ga0501069_0015861 3300049585 Bacteria 4039
198 Ga0501070_0216365 3300049586 Bacteria 1572
199 Ga0501071_0027658 3300049587 Bacteria 3992
200 Ga0501072_0009647 3300049588 Bacteria 7344
201 Ga0501072_0128070 3300049588 Bacteria 2023
202 Ga0501075_0031245 3300049591 Bacteria 3951
203 Ga0501075_0201271 3300049591 Bacteria 1519
204 Ga0501076_0049457 3300049592 Bacteria 3325
205 Ga0501076_0234427 3300049592 Bacteria 1501
206 Ga0501076_0361352 3300049592 Bacteria 1193
207 Ga0501077_0007567 3300049593 Bacteria 6702
208 Ga0501077_0035926 3300049593 Bacteria 3155
209 Ga0501079_0003048 3300049741 Bacteria 12261
210 Ga0501079_0190592 3300049741 Bacteria 1600
211 Ga0501080_0263851 3300049742 Bacteria 1568
212 Ga0501081_0001922 3300049743 Bacteria 12895
213 Ga0501081_0052948 3300049743 Bacteria 2801
214 Ga0501081_0386107 3300049743 Bacteria 1035
215 Ga0501045_0160226 3300049824 Bacteria 1675
216 nmdc:mga00v17_61855_c1 3300050491 Bacteria 2302
217 nmdc:mga0yw44_154150_c1 3300050492 Bacteria 1500
218 nmdc:mga0k408_71508_c1 3300050493 Bacteria 2025
219 nmdc:mga06z11_9057_c1 3300050494 Bacteria 4181
220 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
221 nmdc:mga05p37_50218_c1 3300050507 Bacteria 5130
222 nmdc:mga05p37_86321_c1 3300050507 Bacteria 3867
223 nmdc:mga09592_184166_c1 3300050508 Bacteria 1807
224 nmdc:mga09592_311738_c1 3300050508 Bacteria 1363
225 nmdc:mga09592_3599_c1 3300050508 Bacteria 12504
226 nmdc:mga09592_42688_c1 3300050508 Bacteria 3814
227 nmdc:mga09592_52663_c1 3300050508 Bacteria 3435
228 nmdc:mga0qj67_34294_c1 3300050509 Bacteria 3964
229 nmdc:mga06r32_51178_c1 3300050510 Bacteria 3952
230 nmdc:mga06r32_695_c1 3300050510 Bacteria 29349
231 nmdc:mga08y16_51752_c1 3300050511 Bacteria 4297
232 nmdc:mga0rr50_432042_c1 3300050513 Bacteria 1115
233 nmdc:mga08x19_6338_c1 3300050514 Bacteria 7007
234 Ga0495619_0023361 3300053085 Bacteria 3964
235 Ga0500641_0011164 3300053096 Bacteria 3258
236 Ga0500555_000053 3300053103 Bacteria 58724
237 Ga0500592_001316 3300053116 Bacteria 4043
238 Ga0500568_0047053 3300053139 Bacteria 1709
239 Ga0500616_0000056 3300053153 Bacteria 281579
240 Ga0501084_0014043 3300054114 Bacteria 6631
241 Ga0501082_0020972 3300060353 Bacteria 5635
242 Ga0501082_0035475 3300060353 Bacteria 4299
243 Ga0501082_0054685 3300060353 Bacteria 3441
244 Ga0530510_0143081 3300061734 Bacteria 1763
245 Ga0530510_0143778 3300061734 Bacteria 1758
246 Ga0530510_0169301 3300061734 Bacteria 1618
247 2920113482 2920107658 Bacteria 10042636
248 Ga0068868_100207907
249 JGI25406J46586_10021476
250 rootL2_10019472
251 Ga0070683_100056812
252 Ga0070683_100205503
253 Ga0070666_10014028
254 Ga0070682_100004452
255 Ga0068868_100019031
256 Ga0070691_10015303
257 Ga0070709_10002300
258 Ga0070709_10218242
259 Ga0070714_100000122
260 Ga0070714_100061078
261 Ga0070714_100332597
262 Ga0070713_100001842
263 Ga0070711_100112191
264 Ga0070694_100335548
265 Ga0070708_100000001
266 Ga0070708_100000410
267 Ga0070708_100000715
268 Ga0070708_100001170
269 Ga0070708_100004716
270 Ga0070708_100018218
271 Ga0070708_100025971
272 Ga0070708_100049581
273 Ga0070663_100044440
274 Ga0070681_10017513
275 Ga0070706_100000004
276 Ga0070706_100000005
277 Ga0070706_100000347
278 Ga0070706_100002861
279 Ga0070706_100008286
280 Ga0070706_100054187
281 Ga0070707_100000002
282 Ga0070707_100000229
283 Ga0070707_100002283
284 Ga0070707_100002913
285 Ga0070707_100043842
286 Ga0070707_100084741
287 Ga0070707_100291208
288 Ga0070698_100001899
289 Ga0070698_100002099
290 Ga0070698_100025666
291 Ga0070698_100178937
292 Ga0070699_100000058
293 Ga0070699_100000111
294 Ga0070699_100000703
295 Ga0070699_100002074
296 Ga0070699_100002833
297 Ga0070699_100010282
298 Ga0070697_100000665
299 Ga0070697_100000965
300 Ga0070697_100011216
301 Ga0070697_100019521
302 Ga0070697_100023429
303 Ga0070697_100128983
304 Ga0070697_100168397
305 Ga0070695_100000001
306 Ga0070704_100000885
307 Ga0068854_100026114
308 Ga0068856_100035427
309 Ga0068851_10037720
310 Ga0068858_100060250
311 Ga0068860_100072631
312 Ga0081539_10000069
313 Ga0070717_10000184
314 Ga0070717_10000192
315 Ga0070717_10003501
316 Ga0070716_100005127
317 Ga0070716_100130701
318 Ga0075367_10002914
319 Ga0075366_10059424
320 Ga0097621_100006527
321 Ga0068871_100042346
322 Ga0075428_100091978
323 Ga0075428_100255912
324 Ga0075430_100006879
325 Ga0075430_100046792
326 Ga0075431_100001741
327 Ga0075431_100008809
328 Ga0075431_100011349
329 Ga0075431_100065280
330 Ga0075434_100123167
331 Ga0075429_100008605
332 Ga0075429_100019529
333 Ga0075429_100042781
334 Ga0075436_100005190
335 Ga0075436_100143873
336 Ga0075435_100012076
337 Ga0075435_100028425
338 Ga0105240_10007601
339 Ga0105245_10011013
340 Ga0114129_10000002
341 Ga0114129_10208209
342 Ga0105241_10002123
343 Ga0105248_10037424
344 Ga0105237_10250383
345 Ga0105239_10089423
346 Ga0105239_10292080
347 Ga0105246_10032136
348 Ga0157374_10121709
349 Ga0157374_10294179
350 Ga0157378_10000059
351 Ga0157378_10007101
352 Ga0163162_10006218
353 Ga0163162_10027037
354 Ga0182008_10009833
355 Ga0228598_1000061
356 Ga0207699_10067052
357 Ga0207645_10200048
358 Ga0207684_10000012
359 Ga0207684_10000021
360 Ga0207684_10000033
361 Ga0207684_10000931
362 Ga0207684_10002533
363 Ga0207684_10004233
364 Ga0207684_10101660
365 Ga0207654_10045833
366 Ga0207707_10174897
367 Ga0207695_10041729
368 Ga0207663_10085709
369 Ga0207649_10025475
370 Ga0207652_10237892
371 Ga0207652_10375942
372 Ga0207646_10000007
373 Ga0207646_10000067
374 Ga0207646_10002290
375 Ga0207646_10002865
376 Ga0207646_10007305
377 Ga0207646_10021180
378 Ga0207646_10023632
379 Ga0207646_10223935
380 Ga0207646_10230007
381 Ga0207694_10051842
382 Ga0207687_10010342
383 Ga0207700_10067743
384 Ga0207664_10000089
385 Ga0207664_10004114
386 Ga0207664_10022427
387 Ga0207664_10154363
388 Ga0207686_10068116
389 Ga0207665_10007970
390 Ga0207711_10457187
391 Ga0207679_10030393
392 Ga0207712_10025496
393 Ga0207668_10039151
394 Ga0207640_10019442
395 Ga0207677_10016756
396 Ga0207677_10017787
397 Ga0207702_10032754
398 Ga0207641_10014277
399 Ga0209966_1005665
400 Ga0268265_10008705
401 Ga0265760_10001444
402 Ga0265316_10040139
403 Ga0307408_100057198
404 Ga0265314_10027052
405 Ga0373931_0127325
406 Ga0373927_0016138
407 Ga0373947_0039748
408 Ga0316582_0000741
409 Ga0316582_0018402
410 Ga0373925_0034261
411 Ga0395901_0157150
412 Ga0436365_1744722
413 Ga0466964_0077143
414 Ga0453684_0072266
415 Ga0466958_0005628
416 Ga0466967_0143078
417 Ga0495638_0007184
418 Ga0495580_0007186
419 Ga0495663_0018794
420 Ga0495621_0009411
421 Ga0495672_0040927
422 Ga0496101_0025210
423 Ga0496102_0008278
424 Ga0496102_0029200
425 Ga0496103_0024787
426 Ga0496106_0088054
427 Ga0496106_0131147
428 Ga0496107_0135545
429 Ga0496112_0180249
430 Ga0496113_0242002
431 Ga0496114_0038596
432 Ga0496115_0057392
433 Ga0501033_0209608
434 Ga0501036_0114036
435 Ga0501038_0242613
436 Ga0501040_0049199
437 Ga0501040_0050219
438 Ga0501042_0033831
439 Ga0501048_0163934
440 Ga0501048_0194139
441 Ga0501067_0046492
442 Ga0501067_0105220
443 Ga0501069_0005043
444 Ga0501069_0015861
445 Ga0501070_0216365
446 Ga0501071_0027658
447 Ga0501072_0009647
448 Ga0501072_0128070
449 Ga0501075_0031245
450 Ga0501075_0201271
451 Ga0501076_0049457
452 Ga0501076_0234427
453 Ga0501076_0361352
454 Ga0501077_0007567
455 Ga0501077_0035926
456 Ga0501079_0003048
457 Ga0501079_0190592
458 Ga0501080_0263851
459 Ga0501081_0001922
460 Ga0501081_0052948
461 Ga0501081_0386107
462 Ga0501045_0160226
463 nmdc:mga00v17_61855_c1
464 nmdc:mga0yw44_154150_c1
465 nmdc:mga0k408_71508_c1
466 nmdc:mga06z11_9057_c1
467 nmdc:mga05p37_2_c1
468 nmdc:mga05p37_50218_c1
469 nmdc:mga05p37_86321_c1
470 nmdc:mga09592_184166_c1
471 nmdc:mga09592_311738_c1
472 nmdc:mga09592_3599_c1
473 nmdc:mga09592_42688_c1
474 nmdc:mga09592_52663_c1
475 nmdc:mga0qj67_34294_c1
476 nmdc:mga06r32_51178_c1
477 nmdc:mga06r32_695_c1
478 nmdc:mga08y16_51752_c1
479 nmdc:mga0rr50_432042_c1
480 nmdc:mga08x19_6338_c1
481 Ga0495619_0023361
482 Ga0500641_0011164
483 Ga0500555_000053
484 Ga0500592_001316
485 Ga0500568_0047053
486 Ga0500616_0000056
487 Ga0501084_0014043
488 Ga0501082_0020972
489 Ga0501082_0035475
490 Ga0501082_0054685
491 Ga0530510_0143081
492 Ga0530510_0143778
493 Ga0530510_0169301
494 2920113482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

35

372

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cyv-assembly1.cif.gz_A-2 crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism 0.9657 5 340
1j93-assembly1.cif.gz_A-2 crystal structure and substrate binding modeling of the uroporphyrinogen-iii decarboxylase from nicotiana tabacum: implications for the catalytic mechanism 0.9626 3 335
6w2o-assembly1.cif.gz_A crystal structure of uroporphyrinogen iii decarboxylate (heme) from stenotrophomonas maltophilia 0.9616 1 341
4zr8-assembly1.cif.gz_B structure of uroporphyrinogen decarboxylase from acinetobacter baumannii 0.9605 1 340
6w2o-assembly1.cif.gz_A crystal structure of uroporphyrinogen iii decarboxylate (heme) from stenotrophomonas maltophilia 0.9589 1 341
ID Description Score Start End Superfamily
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9729 3 338 3.20.20.210
af_P9WFE1_2_357_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9617 2 337 3.20.20.210
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9561 3 338 3.20.20.210
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9528 1 340 3.20.20.210
2infD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9506 6 340 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A2V6THW4-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 0.9894 66 339 GO:0004853
GO:0005829
GO:0006782
AF-A0A524JNJ6-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9849 3 341 GO:0004852
GO:0004853
GO:0005829
GO:0006782
AF-A0A2V7BI52-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9848 1 341 GO:0004853
GO:0005829
GO:0006782
AF-A0A7W1L2B7-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 0.984 3 262 GO:0004853
GO:0005829
GO:0006782
AF-A0A1F9VB45-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9831 3 341 GO:0004852
GO:0004853
GO:0005829
GO:0006782

Map