F358724

General Info

Members Datasets Scaffolds Average Seq Length
247 154 494 271

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100138671|Ga0070683_1001386713
Length 307
Sequence MKYLKLRSLAVAARNKRASFSMKSITPHIAVESGFPMAKSIEELQEIAKRIRREIITMIGEAKSGHPGGSLSAVEIVVELFFNRMRIDPKNPKWPDRDRFILSKGHACPVLYAAMAECGFTPIDQLNTLRKLGSIYQGHPDVRFIPALEASTGSLGEGLSLAIGMGLAARLDKRPFRTYAMFGDGEIQEGQIWEAAMAGAFHKMDNVVAIVDYNGIQLDGFVKDIMDVAPLADKWRAFGWHTIEIDGHSLPAIEQAFNEAEATKGKPTCIVAHTVKGKGVSFMENNPKFHGTAPNADEVKRALQELQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
92 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
93 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
94 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
109 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
154 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0.4
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 0
Rhizosphere 96.36
Stem 0
Stem Tuber 0
Unclassified 20.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100138671 3300005329 Bacteria 2304
2 Ga0070666_10000166 3300005335 Bacteria 45239
3 Ga0068868_100481092 3300005338 Bacteria 1084
4 Ga0070669_100301419 3300005353 Unclassified 1289
5 Ga0070688_100262756 3300005365 Unclassified 1233
6 Ga0070709_10258123 3300005434 Bacteria 1258
7 Ga0070714_100023231 3300005435 Bacteria 5091
8 Ga0070713_100079007 3300005436 Bacteria 2801
9 Ga0070713_100133431 3300005436 Bacteria 2192
10 Ga0070694_100000416 3300005444 Bacteria 23229
11 Ga0070662_100253355 3300005457 Unclassified 1416
12 Ga0070685_10085355 3300005466 Unclassified 1901
13 Ga0070706_100499695 3300005467 Bacteria 1132
14 Ga0070707_100034699 3300005468 Unclassified 4813
15 Ga0070707_100110233 3300005468 Bacteria 2669
16 Ga0070707_100514301 3300005468 Unclassified 1159
17 Ga0070698_100002113 3300005471 Bacteria 22090
18 Ga0070699_100291465 3300005518 Bacteria 1463
19 Ga0070679_100190441 3300005530 Bacteria 2020
20 Ga0070697_100102441 3300005536 Bacteria 2379
21 Ga0070686_100068631 3300005544 Bacteria 2313
22 Ga0070693_100059207 3300005547 Bacteria 2219
23 Ga0068854_100132265 3300005578 Bacteria 1906
24 Ga0068859_100098796 3300005617 Unclassified 2973
25 Ga0068859_100277445 3300005617 Unclassified 1769
26 Ga0068863_100143421 3300005841 Bacteria 2284
27 Ga0068858_100034953 3300005842 Bacteria 4662
28 Ga0068858_100471254 3300005842 Bacteria 1211
29 Ga0068862_100030556 3300005844 Bacteria 4541
30 Ga0070717_10297127 3300006028 Bacteria 1435
31 Ga0070717_10349895 3300006028 Unclassified 1321
32 Ga0070716_100200808 3300006173 Bacteria 1325
33 Ga0097621_100178063 3300006237 Bacteria 1836
34 Ga0075428_100019692 3300006844 Bacteria 7467
35 Ga0075428_100078543 3300006844 Unclassified 3603
36 Ga0075428_100095762 3300006844 Unclassified 3236
37 Ga0075430_100001088 3300006846 Bacteria 21571
38 Ga0075430_100055288 3300006846 Bacteria 3338
39 Ga0075434_100179004 3300006871 Bacteria 2140
40 Ga0075429_100039254 3300006880 Unclassified 4121
41 Ga0075429_100092160 3300006880 Unclassified 2643
42 Ga0075436_100037854 3300006914 Unclassified 3330
43 Ga0097620_100098795 3300006931 Unclassified 2973
44 Ga0097620_100277440 3300006931 Unclassified 1769
45 Ga0099794_10030766 3300007265 Bacteria 2509
46 Ga0099794_10189888 3300007265 Bacteria 1050
47 Ga0105240_10139116 3300009093 Bacteria 2905
48 Ga0105240_10395992 3300009093 Bacteria 1557
49 Ga0111539_10080605 3300009094 Unclassified 3829
50 Ga0111539_10498042 3300009094 Bacteria 1419
51 Ga0105245_10137134 3300009098 Bacteria 2300
52 Ga0105245_10283334 3300009098 Bacteria 1621
53 Ga0105247_10044623 3300009101 Unclassified 2719
54 Ga0114129_10017550 3300009147 Bacteria 10190
55 Ga0105248_10020319 3300009177 Bacteria 7357
56 Ga0105248_10368878 3300009177 Bacteria 1616
57 Ga0105248_10467501 3300009177 Bacteria 1422
58 Ga0105237_10008973 3300009545 Bacteria 10763
59 Ga0105238_10120018 3300009551 Bacteria 2609
60 Ga0105249_10278959 3300009553 Unclassified 1668
61 Ga0105239_10056958 3300010375 Bacteria 4287
62 Ga0105246_10123098 3300011119 Bacteria 1925
63 Ga0157378_10196993 3300013297 Bacteria 1903
64 Ga0157372_10465340 3300013307 Bacteria 1474
65 Ga0157375_10242904 3300013308 Bacteria 1960
66 Ga0157375_10810274 3300013308 Unclassified 1085
67 Ga0163163_10039011 3300014325 Bacteria 4633
68 Ga0157376_10212672 3300014969 Bacteria 1786
69 Ga0213874_10041116 3300021377 Archaea 1383
70 Ga0207684_10058694 3300025910 Unclassified 3266
71 Ga0207695_10125762 3300025913 Bacteria 2526
72 Ga0207646_10148288 3300025922 Unclassified 2115
73 Ga0207646_10265428 3300025922 Bacteria 1552
74 Ga0207646_10440316 3300025922 Unclassified 1176
75 Ga0207687_10294013 3300025927 Bacteria 1306
76 Ga0207700_10197529 3300025928 Bacteria 1693
77 Ga0207664_10315256 3300025929 Bacteria 1379
78 Ga0207665_10223130 3300025939 Bacteria 1382
79 Ga0207665_10465096 3300025939 Unclassified 972
80 Ga0207711_10088592 3300025941 Bacteria 2718
81 Ga0207711_10239947 3300025941 Bacteria 1662
82 Ga0207661_10026135 3300025944 Bacteria 4445
83 Ga0207677_10195976 3300026023 Bacteria 1602
84 Ga0207703_10564116 3300026035 Bacteria 1074
85 Ga0207639_10743228 3300026041 Unclassified 912
86 Ga0207708_10024181 3300026075 Unclassified 4593
87 Ga0207675_100069506 3300026118 Bacteria 3291
88 Ga0209588_1035964 3300027671 Unclassified 1592
89 Ga0268265_10043239 3300028380 Unclassified 3348
90 Ga0265337_1000172 3300028556 Bacteria 33853
91 Ga0265326_10019880 3300028558 Bacteria 1928
92 Ga0265318_10071888 3300028577 Bacteria 1282
93 Ga0265336_10006961 3300028666 Bacteria 4049
94 Ga0265338_10000198 3300028800 Bacteria 113584
95 Ga0265338_10001683 3300028800 Bacteria 35130
96 Ga0265338_10008653 3300028800 Bacteria 12311
97 Ga0265338_10027040 3300028800 Bacteria 5767
98 Ga0265338_10034091 3300028800 Bacteria 4928
99 Ga0265338_10049701 3300028800 Bacteria 3798
100 Ga0265338_10081928 3300028800 Unclassified 2703
101 Ga0265338_10318691 3300028800 Bacteria 1126
102 Ga0265324_10052134 3300029957 Unclassified 1405
103 Ga0265760_10000621 3300031090 Bacteria 10047
104 Ga0265328_10043443 3300031239 Unclassified 1653
105 Ga0265320_10001528 3300031240 Bacteria 16786
106 Ga0265340_10004500 3300031247 Bacteria 7779
107 Ga0265331_10012201 3300031250 Bacteria 4663
108 Ga0265331_10032892 3300031250 Unclassified 2566
109 Ga0265331_10042227 3300031250 Bacteria 2213
110 Ga0265331_10148651 3300031250 Bacteria 1064
111 Ga0265327_10007462 3300031251 Bacteria 8435
112 Ga0265316_10012254 3300031344 Bacteria 7693
113 Ga0265316_10016385 3300031344 Bacteria 6430
114 Ga0265316_10046874 3300031344 Unclassified 3421
115 Ga0265316_10070114 3300031344 Bacteria 2704
116 Ga0265316_10083787 3300031344 Unclassified 2442
117 Ga0265316_10215275 3300031344 Bacteria 1419
118 Ga0265316_10264745 3300031344 Unclassified 1260
119 Ga0316575_10097201 3300031665 Bacteria 1195
120 Ga0316579_10002189 3300031691 Bacteria 7357
121 Ga0316579_10024016 3300031691 Bacteria 2741
122 Ga0316579_10024942 3300031691 Bacteria 2695
123 Ga0316579_10034371 3300031691 Bacteria 2332
124 Ga0265314_10023857 3300031711 Bacteria 4652
125 Ga0265314_10041460 3300031711 Bacteria 3295
126 Ga0265342_10040211 3300031712 Bacteria 2837
127 Ga0316576_10068017 3300031727 Bacteria 2623
128 Ga0316578_10000759 3300031728 Bacteria 11814
129 Ga0316578_10037191 3300031728 Bacteria 2803
130 Ga0316578_10146671 3300031728 Unclassified 1421
131 Ga0316577_10005853 3300031733 Bacteria 6471
132 Ga0316577_10026436 3300031733 Bacteria 3233
133 Ga0316577_10120161 3300031733 Unclassified 1476
134 Ga0316577_10159950 3300031733 Bacteria 1270
135 Ga0316577_10183469 3300031733 Bacteria 1182
136 Ga0307410_10085982 3300031852 Bacteria 2221
137 Ga0307414_10010649 3300032004 Bacteria 5349
138 Ga0316583_10005850 3300032133 Bacteria 4423
139 Ga0316583_10027334 3300032133 Unclassified 2036
140 Ga0316585_10000661 3300032137 Bacteria 8544
141 Ga0316585_10004824 3300032137 Bacteria 3781
142 Ga0316585_10015536 3300032137 Bacteria 2285
143 Ga0316580_10001685 3300032139 Bacteria 5881
144 Ga0316580_10027617 3300032139 Bacteria 1754
145 Ga0373926_0000506 3300035083 Bacteria 10393
146 Ga0373926_0009184 3300035083 Bacteria 3300
147 Ga0373926_0011483 3300035083 Unclassified 2980
148 Ga0373951_0002951 3300035091 Bacteria 4215
149 Ga0373953_0005955 3300035117 Bacteria 3993
150 Ga0373954_0033377 3300035118 Bacteria 2382
151 Ga0373946_0059618 3300035171 Unclassified 1620
152 Ga0316574_0000940 3300035398 Bacteria 13013
153 Ga0316574_0016516 3300035398 Bacteria 4302
154 Ga0316574_0129345 3300035398 Unclassified 1624
155 Ga0373931_0114608 3300035691 Bacteria 1533
156 Ga0373927_0000874 3300035695 Bacteria 22945
157 Ga0373927_0002015 3300035695 Bacteria 14977
158 Ga0373927_0003168 3300035695 Bacteria 11868
159 Ga0373927_0059445 3300035695 Bacteria 2472
160 Ga0373947_0000564 3300035725 Bacteria 21588
161 Ga0373947_0001256 3300035725 Bacteria 15600
162 Ga0373937_0028182 3300036401 Bacteria 5081
163 Ga0373937_0091925 3300036401 Bacteria 2812
164 Ga0316582_0002688 3300036647 Bacteria 8428
165 Ga0316582_0024201 3300036647 Bacteria 3631
166 Ga0316582_0102450 3300036647 Unclassified 1897
167 Ga0316584_0036197 3300036712 Unclassified 3662
168 Ga0316584_0037564 3300036712 Unclassified 3599
169 Ga0316584_0038257 3300036712 Bacteria 3568
170 Ga0316584_0039268 3300036712 Bacteria 3523
171 Ga0316584_0045786 3300036712 Bacteria 3266
172 Ga0373925_0000062 3300037068 Bacteria 114902
173 Ga0373925_0000525 3300037068 Bacteria 38212
174 Ga0395905_0023738 3300037471 Bacteria 5789
175 Ga0395905_0487158 3300037471 Bacteria 1133
176 Ga0395901_0354083 3300038443 Unclassified 1515
177 Ga0400483_133382 3300039062 Bacteria 2740
178 Ga0400483_258368 3300039062 Bacteria 1628
179 Ga0400483_281440 3300039062 Bacteria 1632
180 Ga0400489_00556 3300039093 Bacteria 2383
181 Ga0400489_57157 3300039093 Bacteria 2545
182 Ga0436363_0698298 3300039450 Archaea 2381
183 Ga0451577_0002971 3300042876 Bacteria 19389
184 Ga0451577_0366685 3300042876 Bacteria 1307
185 Ga0451577_0414550 3300042876 Bacteria 1223
186 Ga0451577_0452546 3300042876 Bacteria 1166
187 Ga0453683_0181682 3300044673 Bacteria 1334
188 Ga0453684_0001493 3300044712 Bacteria 65902
189 Ga0453684_0005296 3300044712 Bacteria 25733
190 Ga0453684_0050879 3300044712 Bacteria 5441
191 Ga0453684_0091263 3300044712 Bacteria 3760
192 Ga0453684_0226330 3300044712 Bacteria 2162
193 Ga0453684_0234384 3300044712 Archaea 2117
194 Ga0453684_0313552 3300044712 Bacteria 1779
195 Ga0451576_0007092 3300045051 Bacteria 13535
196 Ga0451576_0050041 3300045051 Bacteria 4385
197 Ga0451576_0187211 3300045051 Bacteria 2162
198 Ga0451576_0199552 3300045051 Bacteria 2089
199 Ga0451576_0236406 3300045051 Bacteria 1908
200 Ga0451576_0387257 3300045051 Bacteria 1465
201 Ga0451576_0511800 3300045051 Bacteria 1261
202 Ga0466967_0070267 3300045976 Bacteria 3132
203 Ga0495592_0060849 3300046454 Bacteria 2776
204 Ga0495651_0126449 3300046462 Bacteria 1871
205 Ga0495653_0082277 3300046463 Bacteria 2377
206 Ga0495580_0008309 3300046472 Bacteria 8262
207 Ga0495580_0015896 3300046472 Bacteria 5664
208 Ga0495664_0011277 3300046477 Bacteria 5036
209 Ga0495608_0099562 3300046511 Unclassified 1875
210 Ga0495628_0043097 3300046516 Bacteria 3596
211 Ga0495630_0013757 3300046517 Bacteria 5885
212 Ga0495630_0014543 3300046517 Bacteria 5736
213 Ga0495630_0176607 3300046517 Bacteria 1628
214 Ga0495652_0021751 3300046529 Bacteria 5702
215 Ga0495665_0087605 3300046531 Bacteria 1636
216 Ga0495665_0164951 3300046531 Bacteria 1154
217 Ga0495640_0238243 3300046533 Bacteria 1142
218 Ga0495645_0020871 3300046543 Bacteria 4733
219 Ga0495667_0033963 3300046559 Bacteria 3411
220 Ga0495634_0048615 3300046642 Bacteria 2855
221 Ga0495635_0051894 3300046663 Bacteria 2825
222 Ga0495613_0018879 3300046689 Bacteria 5137
223 Ga0495624_0049014 3300046690 Unclassified 2679
224 Ga0495600_0014049 3300046809 Bacteria 5043
225 Ga0495604_0064227 3300047317 Bacteria 2798
226 Ga0495674_0122255 3300047319 Bacteria 2198
227 Ga0495674_0405916 3300047319 Bacteria 1099
228 Ga0495680_0038657 3300047322 Bacteria 3812
229 Ga0495675_0064149 3300047444 Bacteria 2324
230 Ga0495684_0014135 3300047471 Bacteria 6140
231 Ga0495684_0019635 3300047471 Bacteria 5207
232 Ga0495602_0131026 3300048088 Bacteria 2000
233 Ga0501034_0522352 3300049571 Bacteria 1099
234 Ga0501043_0099070 3300049579 Bacteria 2291
235 Ga0501047_0259279 3300049581 Bacteria 1586
236 Ga0501071_0203228 3300049587 Unclassified 1489
237 Ga0501076_0382650 3300049592 Bacteria 1157
238 nmdc:mga05p37_38327_c1 3300050507 Bacteria 5879
239 nmdc:mga0qj67_398106_c1 3300050509 Bacteria 1111
240 nmdc:mga0n895_248844_c1 3300050512 Bacteria 1804
241 nmdc:mga08x19_206_c1 3300050514 Bacteria 45272
242 Ga0495601_0317314 3300053077 Bacteria 1015
243 Ga0500622_0013875 3300053156 Unclassified 4339
244 Ga0501084_0493218 3300054114 Bacteria 1035
245 Ga0530510_0360624 3300061734 Unclassified 1092
246 2524003431 2523533628 Bacteria 4098242
247 2839998402 2839993093 Bacteria 5512535
248 Ga0070683_100138671
249 Ga0070666_10000166
250 Ga0068868_100481092
251 Ga0070669_100301419
252 Ga0070688_100262756
253 Ga0070709_10258123
254 Ga0070714_100023231
255 Ga0070713_100079007
256 Ga0070713_100133431
257 Ga0070694_100000416
258 Ga0070662_100253355
259 Ga0070685_10085355
260 Ga0070706_100499695
261 Ga0070707_100034699
262 Ga0070707_100110233
263 Ga0070707_100514301
264 Ga0070698_100002113
265 Ga0070699_100291465
266 Ga0070679_100190441
267 Ga0070697_100102441
268 Ga0070686_100068631
269 Ga0070693_100059207
270 Ga0068854_100132265
271 Ga0068859_100098796
272 Ga0068859_100277445
273 Ga0068863_100143421
274 Ga0068858_100034953
275 Ga0068858_100471254
276 Ga0068862_100030556
277 Ga0070717_10297127
278 Ga0070717_10349895
279 Ga0070716_100200808
280 Ga0097621_100178063
281 Ga0075428_100019692
282 Ga0075428_100078543
283 Ga0075428_100095762
284 Ga0075430_100001088
285 Ga0075430_100055288
286 Ga0075434_100179004
287 Ga0075429_100039254
288 Ga0075429_100092160
289 Ga0075436_100037854
290 Ga0097620_100098795
291 Ga0097620_100277440
292 Ga0099794_10030766
293 Ga0099794_10189888
294 Ga0105240_10139116
295 Ga0105240_10395992
296 Ga0111539_10080605
297 Ga0111539_10498042
298 Ga0105245_10137134
299 Ga0105245_10283334
300 Ga0105247_10044623
301 Ga0114129_10017550
302 Ga0105248_10020319
303 Ga0105248_10368878
304 Ga0105248_10467501
305 Ga0105237_10008973
306 Ga0105238_10120018
307 Ga0105249_10278959
308 Ga0105239_10056958
309 Ga0105246_10123098
310 Ga0157378_10196993
311 Ga0157372_10465340
312 Ga0157375_10242904
313 Ga0157375_10810274
314 Ga0163163_10039011
315 Ga0157376_10212672
316 Ga0213874_10041116
317 Ga0207684_10058694
318 Ga0207695_10125762
319 Ga0207646_10148288
320 Ga0207646_10265428
321 Ga0207646_10440316
322 Ga0207687_10294013
323 Ga0207700_10197529
324 Ga0207664_10315256
325 Ga0207665_10223130
326 Ga0207665_10465096
327 Ga0207711_10088592
328 Ga0207711_10239947
329 Ga0207661_10026135
330 Ga0207677_10195976
331 Ga0207703_10564116
332 Ga0207639_10743228
333 Ga0207708_10024181
334 Ga0207675_100069506
335 Ga0209588_1035964
336 Ga0268265_10043239
337 Ga0265337_1000172
338 Ga0265326_10019880
339 Ga0265318_10071888
340 Ga0265336_10006961
341 Ga0265338_10000198
342 Ga0265338_10001683
343 Ga0265338_10008653
344 Ga0265338_10027040
345 Ga0265338_10034091
346 Ga0265338_10049701
347 Ga0265338_10081928
348 Ga0265338_10318691
349 Ga0265324_10052134
350 Ga0265760_10000621
351 Ga0265328_10043443
352 Ga0265320_10001528
353 Ga0265340_10004500
354 Ga0265331_10012201
355 Ga0265331_10032892
356 Ga0265331_10042227
357 Ga0265331_10148651
358 Ga0265327_10007462
359 Ga0265316_10012254
360 Ga0265316_10016385
361 Ga0265316_10046874
362 Ga0265316_10070114
363 Ga0265316_10083787
364 Ga0265316_10215275
365 Ga0265316_10264745
366 Ga0316575_10097201
367 Ga0316579_10002189
368 Ga0316579_10024016
369 Ga0316579_10024942
370 Ga0316579_10034371
371 Ga0265314_10023857
372 Ga0265314_10041460
373 Ga0265342_10040211
374 Ga0316576_10068017
375 Ga0316578_10000759
376 Ga0316578_10037191
377 Ga0316578_10146671
378 Ga0316577_10005853
379 Ga0316577_10026436
380 Ga0316577_10120161
381 Ga0316577_10159950
382 Ga0316577_10183469
383 Ga0307410_10085982
384 Ga0307414_10010649
385 Ga0316583_10005850
386 Ga0316583_10027334
387 Ga0316585_10000661
388 Ga0316585_10004824
389 Ga0316585_10015536
390 Ga0316580_10001685
391 Ga0316580_10027617
392 Ga0373926_0000506
393 Ga0373926_0009184
394 Ga0373926_0011483
395 Ga0373951_0002951
396 Ga0373953_0005955
397 Ga0373954_0033377
398 Ga0373946_0059618
399 Ga0316574_0000940
400 Ga0316574_0016516
401 Ga0316574_0129345
402 Ga0373931_0114608
403 Ga0373927_0000874
404 Ga0373927_0002015
405 Ga0373927_0003168
406 Ga0373927_0059445
407 Ga0373947_0000564
408 Ga0373947_0001256
409 Ga0373937_0028182
410 Ga0373937_0091925
411 Ga0316582_0002688
412 Ga0316582_0024201
413 Ga0316582_0102450
414 Ga0316584_0036197
415 Ga0316584_0037564
416 Ga0316584_0038257
417 Ga0316584_0039268
418 Ga0316584_0045786
419 Ga0373925_0000062
420 Ga0373925_0000525
421 Ga0395905_0023738
422 Ga0395905_0487158
423 Ga0395901_0354083
424 Ga0400483_133382
425 Ga0400483_258368
426 Ga0400483_281440
427 Ga0400489_00556
428 Ga0400489_57157
429 Ga0436363_0698298
430 Ga0451577_0002971
431 Ga0451577_0366685
432 Ga0451577_0414550
433 Ga0451577_0452546
434 Ga0453683_0181682
435 Ga0453684_0001493
436 Ga0453684_0005296
437 Ga0453684_0050879
438 Ga0453684_0091263
439 Ga0453684_0226330
440 Ga0453684_0234384
441 Ga0453684_0313552
442 Ga0451576_0007092
443 Ga0451576_0050041
444 Ga0451576_0187211
445 Ga0451576_0199552
446 Ga0451576_0236406
447 Ga0451576_0387257
448 Ga0451576_0511800
449 Ga0466967_0070267
450 Ga0495592_0060849
451 Ga0495651_0126449
452 Ga0495653_0082277
453 Ga0495580_0008309
454 Ga0495580_0015896
455 Ga0495664_0011277
456 Ga0495608_0099562
457 Ga0495628_0043097
458 Ga0495630_0013757
459 Ga0495630_0014543
460 Ga0495630_0176607
461 Ga0495652_0021751
462 Ga0495665_0087605
463 Ga0495665_0164951
464 Ga0495640_0238243
465 Ga0495645_0020871
466 Ga0495667_0033963
467 Ga0495634_0048615
468 Ga0495635_0051894
469 Ga0495613_0018879
470 Ga0495624_0049014
471 Ga0495600_0014049
472 Ga0495604_0064227
473 Ga0495674_0122255
474 Ga0495674_0405916
475 Ga0495680_0038657
476 Ga0495675_0064149
477 Ga0495684_0014135
478 Ga0495684_0019635
479 Ga0495602_0131026
480 Ga0501034_0522352
481 Ga0501043_0099070
482 Ga0501047_0259279
483 Ga0501071_0203228
484 Ga0501076_0382650
485 nmdc:mga05p37_38327_c1
486 nmdc:mga0qj67_398106_c1
487 nmdc:mga0n895_248844_c1
488 nmdc:mga08x19_206_c1
489 Ga0495601_0317314
490 Ga0500622_0013875
491 Ga0501084_0493218
492 Ga0530510_0360624
493 2524003431
494 2839998402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

43

307

0.94

PF00676

E1_dh

Dehydrogenase E1 component

127

302

0.85

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

37

228

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_CCC split gene transketolase, active alpha2beta2 heterotetramer 0.9879 43 307
1qgd-assembly1.cif.gz_B transketolase from escherichia coli 0.9561 44 306
8cip-assembly2.cif.gz_D crystal structure of transketolase from geobacillus stearothermophilus 0.9538 44 306
5nd5-assembly1.cif.gz_B crystal structure of transketolase from chlamydomonas reinhardtii in complex with tpp and mg2+ 0.9535 38 306
5hht-assembly1.cif.gz_B crystal structure of e. coli transketolase triple variant ser385tyr/asp469thr/arg520gln 0.9533 44 306
ID Description Score Start End Superfamily
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9833 39 306 3.40.50.970
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9585 39 306 3.40.50.970
af_C6KSV3_9_337_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9565 47 306 3.40.50.970
af_Q2FYT8_1_292_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9502 85 305 3.40.50.970
af_Q6PHI8_1_298_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9484 35 306 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7V2LDH3-F1-model_v4 Transketolase 0.9914 41 307 GO:0016740
GO:0046872
AF-X1MKK0-F1-model_v4 Transketolase N-terminal domain-containing protein 0.991 197 307
AF-A0A7C4FV22-F1-model_v4 Transketolase 0.9909 42 137
AF-A0A523ZMS6-F1-model_v4 Transketolase 0.9907 35 282 GO:0016740
GO:0046872
AF-A0A3A9ST81-F1-model_v4 Transketolase 0.9903 39 306

Map