F358544

General Info

Members Datasets Scaffolds Average Seq Length
246 150 493 162

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_817599_c1|nmdc:mga06z11_817599_c1_50_532
Length 160
Sequence MPSFDVVSKTDQHEVMNAVDQTNREIITRFDFRGTNSSIELSKNTITLIAPTEFQIKQLDEILKSKFAKRNIDIRSLEYKDPEIKLNEARQLIEVKQGLDTERAKKLVKLIKETNLKVQAAIQGEQVRVTGKKRDDLQDVIAFLRKAKFDLPLQFENFRD

Samples

Sample ID Description Type Environment
1 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
116 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 0.81
Rhizosphere 84.15
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06z11_817599_c1 3300050494 Bacteria 568
2 rootH1_10004682 3300003316 Bacteria 2226
3 rootH1_10004682 3300003323 Bacteria 6344
4 JGI25160J50197_1004321 3300003354 Bacteria 6157
5 Ga0058862_12375009 3300004803 Bacteria 628
6 Ga0070683_100601895 3300005329 Bacteria 1052
7 Ga0070670_101082418 3300005331 Bacteria 731
8 Ga0070666_10419310 3300005335 Bacteria 964
9 Ga0070680_100349696 3300005336 Bacteria 1257
10 Ga0070680_100970701 3300005336 Bacteria 733
11 Ga0070682_100809620 3300005337 Bacteria 762
12 Ga0070673_101138508 3300005364 Bacteria 730
13 Ga0070688_100559697 3300005365 Bacteria 870
14 Ga0070659_100035182 3300005366 Bacteria 3899
15 Ga0070709_10030717 3300005434 Bacteria 3226
16 Ga0070709_10295365 3300005434 Bacteria 1182
17 Ga0070709_10592977 3300005434 Bacteria 852
18 Ga0070714_100062647 3300005435 Bacteria 3196
19 Ga0070714_100615450 3300005435 Bacteria 1044
20 Ga0070713_100092459 3300005436 Bacteria 2604
21 Ga0070710_10124121 3300005437 Bacteria 1567
22 Ga0070710_10456910 3300005437 Bacteria 867
23 Ga0070711_100052536 3300005439 Bacteria 2804
24 Ga0070711_100756207 3300005439 Bacteria 822
25 Ga0070708_100031186 3300005445 Bacteria 4612
26 Ga0070681_10001564 3300005458 Bacteria 20303
27 Ga0070681_10144710 3300005458 Bacteria 2306
28 Ga0070681_10199787 3300005458 Bacteria 1918
29 Ga0070681_10812186 3300005458 Bacteria 852
30 Ga0070681_10871044 3300005458 Bacteria 819
31 Ga0070706_100080204 3300005467 Bacteria 3022
32 Ga0070706_100243986 3300005467 Bacteria 1677
33 Ga0070706_100775461 3300005467 Bacteria 888
34 Ga0070707_100002961 3300005468 Bacteria 16114
35 Ga0070707_100652737 3300005468 Bacteria 1015
36 Ga0070698_100125763 3300005471 Bacteria 2521
37 Ga0070698_100298895 3300005471 Bacteria 1540
38 Ga0070698_100768060 3300005471 Bacteria 907
39 Ga0070699_100184842 3300005518 Bacteria 1850
40 Ga0070699_100421867 3300005518 Bacteria 1207
41 Ga0070679_100163979 3300005530 Bacteria 2196
42 Ga0070679_100233938 3300005530 Bacteria 1797
43 Ga0070679_100685330 3300005530 Bacteria 967
44 Ga0070684_100124497 3300005535 Bacteria 2321
45 Ga0070684_100712801 3300005535 Bacteria 936
46 Ga0070684_100748546 3300005535 Bacteria 912
47 Ga0070697_100344942 3300005536 Bacteria 1285
48 Ga0070697_100841500 3300005536 Bacteria 813
49 Ga0070686_100486843 3300005544 Bacteria 955
50 Ga0070696_100133606 3300005546 Bacteria 1808
51 Ga0070665_100827645 3300005548 Bacteria 939
52 Ga0068855_100992286 3300005563 Bacteria 883
53 Ga0068856_100732244 3300005614 Bacteria 1009
54 Ga0068856_101774704 3300005614 Bacteria 629
55 Ga0081455_10506625 3300005937 Bacteria 809
56 Ga0081540_1084515 3300005983 Bacteria 1416
57 Ga0081540_1107306 3300005983 Bacteria 1189
58 Ga0070717_10021682 3300006028 Bacteria 5066
59 Ga0070715_10332575 3300006163 Bacteria 824
60 Ga0070712_100018306 3300006175 Bacteria 4548
61 Ga0070712_101008396 3300006175 Bacteria 721
62 Ga0075436_100142540 3300006914 Bacteria 1684
63 Ga0099794_10121114 3300007265 Bacteria 1316
64 Ga0099795_10034857 3300007788 Bacteria 1756
65 Ga0099795_10154696 3300007788 Bacteria 942
66 Ga0105240_10767654 3300009093 Bacteria 1047
67 Ga0111539_10260512 3300009094 Bacteria 2019
68 Ga0105243_10691673 3300009148 Bacteria 993
69 Ga0105238_10403998 3300009551 Bacteria 1359
70 Ga0105238_10880626 3300009551 Bacteria 913
71 Ga0105239_10442334 3300010375 Bacteria 1474
72 Ga0105246_11064881 3300011119 Bacteria 736
73 Ga0157370_10001895 3300013104 Bacteria 25736
74 Ga0157370_10171418 3300013104 Bacteria 2017
75 Ga0157369_10020128 3300013105 Bacteria 7463
76 Ga0157369_11065612 3300013105 Bacteria 827
77 Ga0157372_10490876 3300013307 Bacteria 1432
78 Ga0182008_10051406 3300014497 Bacteria 2044
79 Ga0157379_11022187 3300014968 Bacteria 789
80 Ga0206350_10406620 3300020080 Bacteria 676
81 Ga0213873_10018459 3300021358 Bacteria 1605
82 Ga0213873_10034570 3300021358 Bacteria 1274
83 Ga0213873_10119550 3300021358 Bacteria 772
84 Ga0213873_10120586 3300021358 Bacteria 770
85 Ga0213872_10001086 3300021361 Bacteria 18698
86 Ga0213872_10078185 3300021361 Bacteria 1487
87 Ga0213874_10062326 3300021377 Bacteria 1171
88 Ga0213875_10000988 3300021388 Bacteria 20330
89 Ga0213875_10223934 3300021388 Bacteria 886
90 Ga0213871_10088718 3300021441 Bacteria 894
91 Ga0224712_10053517 3300022467 Bacteria 1581
92 Ga0209130_1000244 3300025284 Bacteria 68915
93 Ga0209025_1000224 3300025294 Bacteria 133328
94 Ga0209758_1002177 3300025297 Bacteria 20570
95 Ga0207426_1000151 3300025302 Bacteria 185103
96 Ga0207692_10130103 3300025898 Bacteria 1420
97 Ga0207699_10208399 3300025906 Bacteria 1328
98 Ga0207705_10173748 3300025909 Bacteria 1623
99 Ga0207684_10057840 3300025910 Bacteria 3290
100 Ga0207684_10523866 3300025910 Bacteria 1015
101 Ga0207684_10960410 3300025910 Bacteria 716
102 Ga0207707_10006017 3300025912 Bacteria 10615
103 Ga0207707_10044431 3300025912 Bacteria 3874
104 Ga0207707_10322277 3300025912 Bacteria 1334
105 Ga0207707_10435351 3300025912 Bacteria 1123
106 Ga0207695_10321159 3300025913 Bacteria 1438
107 Ga0207693_10008250 3300025915 Bacteria 8528
108 Ga0207693_10062102 3300025915 Bacteria 2927
109 Ga0207663_10570789 3300025916 Bacteria 886
110 Ga0207663_10659253 3300025916 Bacteria 826
111 Ga0207663_10762950 3300025916 Bacteria 769
112 Ga0207660_10458610 3300025917 Bacteria 1031
113 Ga0207660_10741635 3300025917 Bacteria 801
114 Ga0207657_10052557 3300025919 Bacteria 3535
115 Ga0207649_11016867 3300025920 Bacteria 652
116 Ga0207652_10108272 3300025921 Bacteria 2462
117 Ga0207652_10399226 3300025921 Bacteria 1241
118 Ga0207652_10909563 3300025921 Bacteria 777
119 Ga0207646_10032257 3300025922 Bacteria 4740
120 Ga0207650_10085343 3300025925 Bacteria 2402
121 Ga0207700_10317311 3300025928 Bacteria 1350
122 Ga0207700_11039468 3300025928 Bacteria 733
123 Ga0207664_10192203 3300025929 Bacteria 1758
124 Ga0207690_10048668 3300025932 Bacteria 2821
125 Ga0207661_10325413 3300025944 Bacteria 1383
126 Ga0207679_11148832 3300025945 Bacteria 713
127 Ga0207667_10353517 3300025949 Bacteria 1498
128 Ga0207708_10405629 3300026075 Bacteria 1128
129 Ga0265338_10079255 3300028800 Bacteria 2765
130 Ga0265324_10020801 3300029957 Bacteria 2357
131 Ga0265320_10003324 3300031240 Bacteria 10847
132 Ga0265325_10101003 3300031241 Bacteria 1412
133 Ga0265331_10001593 3300031250 Bacteria 16569
134 Ga0265327_10001065 3300031251 Bacteria 38232
135 Ga0265327_10002724 3300031251 Bacteria 18056
136 Ga0265316_10117574 3300031344 Bacteria 2010
137 Ga0307408_100258314 3300031548 Bacteria 1440
138 Ga0265313_10000280 3300031595 Bacteria 55923
139 Ga0316575_10010376 3300031665 Bacteria 3421
140 Ga0265314_10008269 3300031711 Bacteria 8933
141 Ga0307413_10097700 3300031824 Bacteria 1931
142 Ga0307410_10085661 3300031852 Bacteria 2224
143 Ga0307406_10077539 3300031901 Bacteria 2199
144 Ga0307407_10038131 3300031903 Bacteria 2661
145 Ga0307409_100283336 3300031995 Bacteria 1533
146 Ga0373928_0164408 3300035084 Bacteria 622
147 Ga0373934_0192932 3300035086 Bacteria 838
148 Ga0373923_0204366 3300035111 Bacteria 914
149 Ga0373953_0108499 3300035117 Bacteria 1172
150 Ga0373956_0015289 3300035119 Bacteria 3211
151 Ga0373957_0110627 3300035120 Bacteria 1106
152 Ga0373957_0178315 3300035120 Bacteria 880
153 Ga0373943_0518047 3300035170 Bacteria 698
154 Ga0373955_0272648 3300035172 Bacteria 1017
155 Ga0373924_0226396 3300035410 Bacteria 826
156 Ga0373935_0193752 3300035692 Bacteria 1401
157 Ga0373927_0378174 3300035695 Bacteria 934
158 Ga0373927_0735404 3300035695 Bacteria 652
159 Ga0373933_0013650 3300035724 Bacteria 4504
160 Ga0373933_0456222 3300035724 Bacteria 836
161 Ga0373937_0019518 3300036401 Bacteria 6065
162 Ga0373937_0049785 3300036401 Bacteria 3837
163 Ga0373937_0099553 3300036401 Bacteria 2696
164 Ga0373937_0351337 3300036401 Bacteria 1396
165 Ga0373937_1001224 3300036401 Bacteria 784
166 Ga0395898_0651445 3300037466 Bacteria 996
167 Ga0395905_0046993 3300037471 Bacteria 4047
168 Ga0436364_0207585 3300037853 Bacteria 136246
169 Ga0436364_0406898 3300037853 Bacteria 2276
170 Ga0436364_1041657 3300037853 Bacteria 1137
171 Ga0436364_1183109 3300037853 Bacteria 2228
172 Ga0436364_1445854 3300037853 Bacteria 1008
173 Ga0400485_16972 3300038735 Bacteria 9124
174 Ga0400483_040354 3300039062 Bacteria 5259
175 Ga0400483_041748 3300039062 Bacteria 1302
176 Ga0400483_047072 3300039062 Bacteria 1155
177 Ga0400483_077915 3300039062 Bacteria 2592
178 Ga0400483_090729 3300039062 Bacteria 5398
179 Ga0400483_103120 3300039062 Bacteria 57797
180 Ga0400483_166862 3300039062 Bacteria 8011
181 Ga0400483_169462 3300039062 Bacteria 3673
182 Ga0400483_208246 3300039062 Bacteria 1712
183 Ga0400483_253115 3300039062 Bacteria 57701
184 Ga0400483_289183 3300039062 Bacteria 1614
185 Ga0436365_0189340 3300039437 Bacteria 982
186 Ga0436365_0316045 3300039437 Bacteria 1153
187 Ga0436365_0340021 3300039437 Bacteria 1978
188 Ga0436365_0403810 3300039437 Bacteria 856
189 Ga0436365_0941028 3300039437 Bacteria 753
190 Ga0436365_1039787 3300039437 Bacteria 1014
191 Ga0436365_1147562 3300039437 Bacteria 1715
192 Ga0436360_0001585 3300039438 Bacteria 1554
193 Ga0436360_0145090 3300039438 Bacteria 768
194 Ga0436360_0213413 3300039438 Bacteria 5051
195 Ga0436360_0269522 3300039438 Bacteria 816
196 Ga0436360_0596548 3300039438 Bacteria 787
197 Ga0436360_0816559 3300039438 Bacteria 3905
198 Ga0436360_1228890 3300039438 Bacteria 590
199 Ga0436361_0646169 3300039447 Bacteria 1058
200 Ga0436361_0672248 3300039447 Bacteria 1484
201 Ga0436361_0706386 3300039447 Bacteria 745
202 Ga0436361_1167660 3300039447 Bacteria 2241
203 Ga0436361_1182304 3300039447 Unclassified 622
204 Ga0436363_0171491 3300039450 Bacteria 1480
205 Ga0436363_0909745 3300039450 Bacteria 773
206 Ga0436363_1317241 3300039450 Bacteria 1110
207 Ga0436362_0658727 3300039453 Bacteria 1589
208 Ga0436362_0712037 3300039453 Bacteria 1422
209 Ga0436362_0875296 3300039453 Bacteria 998
210 Ga0436362_0941533 3300039453 Bacteria 930
211 Ga0436362_1119345 3300039453 Bacteria 1105
212 Ga0439459_0154751 3300042438 Bacteria 602
213 Ga0466969_0228000 3300044656 Bacteria 847
214 Ga0466963_0782874 3300044694 Bacteria 673
215 Ga0453684_0012409 3300044712 Bacteria 14054
216 Ga0453684_0023958 3300044712 Bacteria 8950
217 Ga0453684_0560507 3300044712 Bacteria 1257
218 Ga0466958_0223786 3300045836 Bacteria 1201
219 Ga0466967_0285347 3300045976 Bacteria 1585
220 Ga0466967_0302960 3300045976 Bacteria 1538
221 Ga0466967_1464306 3300045976 Bacteria 680
222 Ga0495629_0243371 3300046459 Bacteria 1238
223 Ga0495618_0162550 3300046514 Bacteria 1423
224 Ga0495628_0816378 3300046516 Bacteria 652
225 Ga0495640_0389804 3300046533 Unclassified 856
226 Ga0495635_0107806 3300046663 Bacteria 1903
227 Ga0495635_0359311 3300046663 Bacteria 971
228 Ga0495658_0601215 3300046683 Bacteria 705
229 Ga0495649_0173749 3300046694 Bacteria 1126
230 Ga0495600_0324563 3300046809 Bacteria 968
231 Ga0496112_1605388 3300048915 Bacteria 564
232 Ga0496115_0141334 3300048918 Bacteria 1986
233 Ga0501034_0601546 3300049571 Bacteria 1005
234 Ga0501037_0362846 3300049573 Bacteria 998
235 Ga0501047_0657296 3300049581 Bacteria 867
236 Ga0501069_0244133 3300049585 Bacteria 1047
237 Ga0501070_0674625 3300049586 Bacteria 819
238 Ga0501073_1104751 3300049589 Bacteria 545
239 Ga0501074_0771380 3300049590 Bacteria 678
240 Ga0501080_1001385 3300049742 Bacteria 725
241 Ga0501080_1043057 3300049742 Bacteria 708
242 nmdc:mga08y16_273394_c1 3300050511 Bacteria 1743
243 nmdc:mga08x19_24202_c1 3300050514 Bacteria 3771
244 Ga0495601_0124232 3300053077 Bacteria 1678
245 Ga0495595_0118549 3300053084 Bacteria 1288
246 Ga0495619_0045875 3300053085 Bacteria 2872
247 Ga0495619_0117129 3300053085 Bacteria 1824
248 nmdc:mga06z11_817599_c1
249 rootH1_10004682
250 JGI25160J50197_1004321
251 Ga0058862_12375009
252 Ga0070683_100601895
253 Ga0070670_101082418
254 Ga0070666_10419310
255 Ga0070680_100349696
256 Ga0070680_100970701
257 Ga0070682_100809620
258 Ga0070673_101138508
259 Ga0070688_100559697
260 Ga0070659_100035182
261 Ga0070709_10030717
262 Ga0070709_10295365
263 Ga0070709_10592977
264 Ga0070714_100062647
265 Ga0070714_100615450
266 Ga0070713_100092459
267 Ga0070710_10124121
268 Ga0070710_10456910
269 Ga0070711_100052536
270 Ga0070711_100756207
271 Ga0070708_100031186
272 Ga0070681_10001564
273 Ga0070681_10144710
274 Ga0070681_10199787
275 Ga0070681_10812186
276 Ga0070681_10871044
277 Ga0070706_100080204
278 Ga0070706_100243986
279 Ga0070706_100775461
280 Ga0070707_100002961
281 Ga0070707_100652737
282 Ga0070698_100125763
283 Ga0070698_100298895
284 Ga0070698_100768060
285 Ga0070699_100184842
286 Ga0070699_100421867
287 Ga0070679_100163979
288 Ga0070679_100233938
289 Ga0070679_100685330
290 Ga0070684_100124497
291 Ga0070684_100712801
292 Ga0070684_100748546
293 Ga0070697_100344942
294 Ga0070697_100841500
295 Ga0070686_100486843
296 Ga0070696_100133606
297 Ga0070665_100827645
298 Ga0068855_100992286
299 Ga0068856_100732244
300 Ga0068856_101774704
301 Ga0081455_10506625
302 Ga0081540_1084515
303 Ga0081540_1107306
304 Ga0070717_10021682
305 Ga0070715_10332575
306 Ga0070712_100018306
307 Ga0070712_101008396
308 Ga0075436_100142540
309 Ga0099794_10121114
310 Ga0099795_10034857
311 Ga0099795_10154696
312 Ga0105240_10767654
313 Ga0111539_10260512
314 Ga0105243_10691673
315 Ga0105238_10403998
316 Ga0105238_10880626
317 Ga0105239_10442334
318 Ga0105246_11064881
319 Ga0157370_10001895
320 Ga0157370_10171418
321 Ga0157369_10020128
322 Ga0157369_11065612
323 Ga0157372_10490876
324 Ga0182008_10051406
325 Ga0157379_11022187
326 Ga0206350_10406620
327 Ga0213873_10018459
328 Ga0213873_10034570
329 Ga0213873_10119550
330 Ga0213873_10120586
331 Ga0213872_10001086
332 Ga0213872_10078185
333 Ga0213874_10062326
334 Ga0213875_10000988
335 Ga0213875_10223934
336 Ga0213871_10088718
337 Ga0224712_10053517
338 Ga0209130_1000244
339 Ga0209025_1000224
340 Ga0209758_1002177
341 Ga0207426_1000151
342 Ga0207692_10130103
343 Ga0207699_10208399
344 Ga0207705_10173748
345 Ga0207684_10057840
346 Ga0207684_10523866
347 Ga0207684_10960410
348 Ga0207707_10006017
349 Ga0207707_10044431
350 Ga0207707_10322277
351 Ga0207707_10435351
352 Ga0207695_10321159
353 Ga0207693_10008250
354 Ga0207693_10062102
355 Ga0207663_10570789
356 Ga0207663_10659253
357 Ga0207663_10762950
358 Ga0207660_10458610
359 Ga0207660_10741635
360 Ga0207657_10052557
361 Ga0207649_11016867
362 Ga0207652_10108272
363 Ga0207652_10399226
364 Ga0207652_10909563
365 Ga0207646_10032257
366 Ga0207650_10085343
367 Ga0207700_10317311
368 Ga0207700_11039468
369 Ga0207664_10192203
370 Ga0207690_10048668
371 Ga0207661_10325413
372 Ga0207679_11148832
373 Ga0207667_10353517
374 Ga0207708_10405629
375 Ga0265338_10079255
376 Ga0265324_10020801
377 Ga0265320_10003324
378 Ga0265325_10101003
379 Ga0265331_10001593
380 Ga0265327_10001065
381 Ga0265327_10002724
382 Ga0265316_10117574
383 Ga0307408_100258314
384 Ga0265313_10000280
385 Ga0316575_10010376
386 Ga0265314_10008269
387 Ga0307413_10097700
388 Ga0307410_10085661
389 Ga0307406_10077539
390 Ga0307407_10038131
391 Ga0307409_100283336
392 Ga0373928_0164408
393 Ga0373934_0192932
394 Ga0373923_0204366
395 Ga0373953_0108499
396 Ga0373956_0015289
397 Ga0373957_0110627
398 Ga0373957_0178315
399 Ga0373943_0518047
400 Ga0373955_0272648
401 Ga0373924_0226396
402 Ga0373935_0193752
403 Ga0373927_0378174
404 Ga0373927_0735404
405 Ga0373933_0013650
406 Ga0373933_0456222
407 Ga0373937_0019518
408 Ga0373937_0049785
409 Ga0373937_0099553
410 Ga0373937_0351337
411 Ga0373937_1001224
412 Ga0395898_0651445
413 Ga0395905_0046993
414 Ga0436364_0207585
415 Ga0436364_0406898
416 Ga0436364_1041657
417 Ga0436364_1183109
418 Ga0436364_1445854
419 Ga0400485_16972
420 Ga0400483_040354
421 Ga0400483_041748
422 Ga0400483_047072
423 Ga0400483_077915
424 Ga0400483_090729
425 Ga0400483_103120
426 Ga0400483_166862
427 Ga0400483_169462
428 Ga0400483_208246
429 Ga0400483_253115
430 Ga0400483_289183
431 Ga0436365_0189340
432 Ga0436365_0316045
433 Ga0436365_0340021
434 Ga0436365_0403810
435 Ga0436365_0941028
436 Ga0436365_1039787
437 Ga0436365_1147562
438 Ga0436360_0001585
439 Ga0436360_0145090
440 Ga0436360_0213413
441 Ga0436360_0269522
442 Ga0436360_0596548
443 Ga0436360_0816559
444 Ga0436360_1228890
445 Ga0436361_0646169
446 Ga0436361_0672248
447 Ga0436361_0706386
448 Ga0436361_1167660
449 Ga0436361_1182304
450 Ga0436363_0171491
451 Ga0436363_0909745
452 Ga0436363_1317241
453 Ga0436362_0658727
454 Ga0436362_0712037
455 Ga0436362_0875296
456 Ga0436362_0941533
457 Ga0436362_1119345
458 Ga0439459_0154751
459 Ga0466969_0228000
460 Ga0466963_0782874
461 Ga0453684_0012409
462 Ga0453684_0023958
463 Ga0453684_0560507
464 Ga0466958_0223786
465 Ga0466967_0285347
466 Ga0466967_0302960
467 Ga0466967_1464306
468 Ga0495629_0243371
469 Ga0495618_0162550
470 Ga0495628_0816378
471 Ga0495640_0389804
472 Ga0495635_0107806
473 Ga0495635_0359311
474 Ga0495658_0601215
475 Ga0495649_0173749
476 Ga0495600_0324563
477 Ga0496112_1605388
478 Ga0496115_0141334
479 Ga0501034_0601546
480 Ga0501037_0362846
481 Ga0501047_0657296
482 Ga0501069_0244133
483 Ga0501070_0674625
484 Ga0501073_1104751
485 Ga0501074_0771380
486 Ga0501080_1001385
487 Ga0501080_1043057
488 nmdc:mga08y16_273394_c1
489 nmdc:mga08x19_24202_c1
490 Ga0495601_0124232
491 Ga0495595_0118549
492 Ga0495619_0045875
493 Ga0495619_0117129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

2

159

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.9354 3 161
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.9189 3 161
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8657 1 161
8fli-assembly1.cif.gz_B cryo-em structure of a group ii intron immediately before branching 0.7122 108 158
2y9j-assembly1.cif.gz_Y three-dimensional model of salmonella's needle complex at subnanometer resolution 0.7112 99 146
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9804 99 161 3.30.70.860
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9452 9 98 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9402 9 98 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9352 9 98 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9198 9 93 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A522WJB4-F1-model_v4 DUF520 family protein 0.9956 99 161 GO:0000166
GO:0005829
AF-A0A833LR21-F1-model_v4 DUF520 family protein 0.993 105 161 GO:0000166
GO:0005829
AF-M2YF32-F1-model_v4 UPF0234 protein H261_02906 0.9872 1 161 GO:0000166
GO:0005829
AF-A0A377HXS4-F1-model_v4 Putative nucleotide-binding protein 0.9838 97 161 GO:0000166
GO:0005829
AF-A0A2V6XXA1-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9834 9 82 GO:0000166
GO:0005829

Map