F358496

General Info

Members Datasets Scaffolds Average Seq Length
246 178 492 313

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0115011|Ga0496126_0115011_259_1287
Length 342
Sequence MARSLRVIFAGTPEFAAQALEAIVAAGFPVPLVLTQPDRPAGRGMKLQASAVKHAALAHGIPVAQPPSLRREGKYPAEAVAALDLLRTTPHDVMVVAAYGLLLPQEVLDIPPLGCINIHGSLLPRWRGAAPIHRAIQAGDTRTGITIMQMDAGLDTGPMLGMSSVPIEVTDTTATLHDKLAALGAQMIVDTLTALEQKHEEHRQAGAHQACDLLHATPQPADGATYAQKIGKDEAALDWSLPADVLARQIRAFDPFPGAVARWNDAALKVWAAEVADAPGDEFALAPGTVVSASAQGIVVACGERALRLTELQKPGGKRLPARDFLAGATFGAGEKIANGTA

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
159 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
160 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
167 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
168 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
169 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
170 2643221664 Massilia sp. Root418 Isolate Unclassified
171 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
172 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
173 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
174 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
175 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
176 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
177 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
178 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.31
Metatranscriptomes 0.41
Isolates 5.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.54
Nodule 0
Rhizoplane 0.81
Rhizosphere 81.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0115011 3300048929 Bacteria 2340
2 JGI25162J39368_1001066 3300002737 Bacteria 16772
3 Ga0070658_10004166 3300005327 Bacteria 11839
4 Ga0070658_10059997 3300005327 Bacteria 3097
5 Ga0070683_100185374 3300005329 Bacteria 1975
6 Ga0070680_100001078 3300005336 Bacteria 19598
7 Ga0070660_100013419 3300005339 Bacteria 5876
8 Ga0070689_100404440 3300005340 Bacteria 1155
9 Ga0070691_10149701 3300005341 Bacteria 1196
10 Ga0070661_100016909 3300005344 Bacteria 5164
11 Ga0070675_100212549 3300005354 Bacteria 1682
12 Ga0070674_100227223 3300005356 Bacteria 1455
13 Ga0070711_100250095 3300005439 Bacteria 1390
14 Ga0070708_100075331 3300005445 Bacteria 3045
15 Ga0070678_100008923 3300005456 Bacteria 6038
16 Ga0070681_10005001 3300005458 Bacteria 12768
17 Ga0070681_10397810 3300005458 Bacteria 1289
18 Ga0070706_100122471 3300005467 Bacteria 2424
19 Ga0070698_100005429 3300005471 Bacteria 13916
20 Ga0070699_100048203 3300005518 Bacteria 3687
21 Ga0070679_100012870 3300005530 Bacteria 8008
22 Ga0070684_100072183 3300005535 Bacteria 3038
23 Ga0070697_100017879 3300005536 Bacteria 5584
24 Ga0070665_100009833 3300005548 Bacteria 9668
25 Ga0070665_100036818 3300005548 Bacteria 4920
26 Ga0070665_100403127 3300005548 Bacteria 1376
27 Ga0068855_100006227 3300005563 Bacteria 14540
28 Ga0068855_100111759 3300005563 Bacteria 3136
29 Ga0070664_100309819 3300005564 Bacteria 1428
30 Ga0068857_100015287 3300005577 Bacteria 6700
31 Ga0068857_100069889 3300005577 Bacteria 3127
32 Ga0068857_100210825 3300005577 Bacteria 1773
33 Ga0068854_100003080 3300005578 Bacteria 10382
34 Ga0068854_100278477 3300005578 Bacteria 1346
35 Ga0068856_100065216 3300005614 Bacteria 3598
36 Ga0068852_100445656 3300005616 Bacteria 1281
37 Ga0081455_10000751 3300005937 Bacteria 42140
38 Ga0081455_10001528 3300005937 Bacteria 28516
39 Ga0081455_10053195 3300005937 Bacteria 3460
40 Ga0081539_10003869 3300005985 Bacteria 17514
41 Ga0070717_10029913 3300006028 Bacteria 4375
42 Ga0075362_10003542 3300006177 Bacteria 5480
43 Ga0075367_10062831 3300006178 Bacteria 2219
44 Ga0075369_10000518 3300006186 Bacteria 12088
45 Ga0075366_10015974 3300006195 Bacteria 4310
46 Ga0075366_10069956 3300006195 Bacteria 2089
47 Ga0075429_100098837 3300006880 Bacteria 2546
48 Ga0105251_10004275 3300009011 Bacteria 9818
49 Ga0105244_10007175 3300009036 Bacteria 7110
50 Ga0111539_10435341 3300009094 Bacteria 1527
51 Ga0105245_10000121 3300009098 Bacteria 75555
52 Ga0114129_10227620 3300009147 Bacteria 2512
53 Ga0105239_10170015 3300010375 Bacteria 2437
54 Ga0157326_1000433 3300012513 Bacteria 4960
55 Ga0157371_10004487 3300013102 Bacteria 12175
56 Ga0157371_10004889 3300013102 Bacteria 11512
57 Ga0157370_10055308 3300013104 Bacteria 3781
58 Ga0182008_10000714 3300014497 Bacteria 23822
59 Ga0157376_10183708 3300014969 Bacteria 1913
60 Ga0213876_10012007 3300021384 Bacteria 4614
61 Ga0207705_10001867 3300025909 Bacteria 16531
62 Ga0207705_10067601 3300025909 Bacteria 2586
63 Ga0207707_10006487 3300025912 Bacteria 10215
64 Ga0207695_10214083 3300025913 Bacteria 1836
65 Ga0207663_10227418 3300025916 Bacteria 1361
66 Ga0207660_10004857 3300025917 Bacteria 8752
67 Ga0207652_10002046 3300025921 Bacteria 17348
68 Ga0207694_10380452 3300025924 Bacteria 1172
69 Ga0207687_10000201 3300025927 Bacteria 40521
70 Ga0207690_10056673 3300025932 Bacteria 2644
71 Ga0207670_10151844 3300025936 Bacteria 1720
72 Ga0207665_10204403 3300025939 Bacteria 1440
73 Ga0207667_10017399 3300025949 Bacteria 8090
74 Ga0207702_10114744 3300026078 Bacteria 2401
75 Ga0207674_10021817 3300026116 Bacteria 6892
76 Ga0207674_10052718 3300026116 Bacteria 4148
77 Ga0207674_10366124 3300026116 Bacteria 1393
78 Ga0207683_10010913 3300026121 Bacteria 7748
79 Ga0207698_10233899 3300026142 Bacteria 1670
80 Ga0268266_10084159 3300028379 Bacteria 2777
81 Ga0268266_10161209 3300028379 Bacteria 2029
82 Ga0268266_10393328 3300028379 Bacteria 1309
83 Ga0268264_10235370 3300028381 Bacteria 1693
84 Ga0265340_10015353 3300031247 Bacteria 3980
85 Ga0265331_10009336 3300031250 Bacteria 5512
86 Ga0265316_10113623 3300031344 Bacteria 2049
87 Ga0307509_10008115 3300031507 Bacteria 13476
88 Ga0307408_100261138 3300031548 Bacteria 1433
89 Ga0307405_10056921 3300031731 Bacteria 2454
90 Ga0307412_10043249 3300031911 Bacteria 2932
91 Ga0307412_10058541 3300031911 Bacteria 2578
92 Ga0316593_10019363 3300032168 Bacteria 2103
93 Ga0373947_0268250 3300035725 Bacteria 1133
94 Ga0373937_0062381 3300036401 Bacteria 3427
95 Ga0395899_0000646 3300037312 Bacteria 35883
96 Ga0395899_0003914 3300037312 Bacteria 11740
97 Ga0395899_0008177 3300037312 Bacteria 8059
98 Ga0395899_0178614 3300037312 Bacteria 1491
99 Ga0395900_0001572 3300037418 Bacteria 27027
100 Ga0395900_0002906 3300037418 Bacteria 18663
101 Ga0395900_0007403 3300037418 Bacteria 11347
102 Ga0395900_0106075 3300037418 Bacteria 2886
103 Ga0395900_0283319 3300037418 Bacteria 1648
104 Ga0395900_0370759 3300037418 Bacteria 1401
105 Ga0395898_0047101 3300037466 Bacteria 4232
106 Ga0395898_0066812 3300037466 Bacteria 3482
107 Ga0395901_0006644 3300038443 Bacteria 11686
108 Ga0395901_0021301 3300038443 Bacteria 6639
109 Ga0395901_0028660 3300038443 Bacteria 5727
110 Ga0395901_0132631 3300038443 Bacteria 2617
111 Ga0395901_0194905 3300038443 Bacteria 2124
112 Ga0400483_090153 3300039062 Bacteria 64577
113 Ga0400483_090801 3300039062 Bacteria 52004
114 Ga0400483_192890 3300039062 Bacteria 75427
115 Ga0400483_231919 3300039062 Bacteria 63426
116 Ga0436365_0067385 3300039437 Bacteria 10534
117 Ga0436361_0496257 3300039447 Bacteria 2112
118 Ga0436361_0983570 3300039447 Bacteria 10781
119 Ga0450904_000772 3300042139 Bacteria 5501
120 Ga0451577_0000122 3300042876 Bacteria 171004
121 Ga0453683_0000046 3300044673 Bacteria 208120
122 Ga0453684_0000369 3300044712 Bacteria 184784
123 Ga0453684_0000434 3300044712 Bacteria 170295
124 Ga0453684_0036167 3300044712 Bacteria 6811
125 Ga0453684_0150275 3300044712 Bacteria 2769
126 Ga0466957_0037626 3300044842 Bacteria 2914
127 Ga0451576_0000827 3300045051 Bacteria 60356
128 Ga0451576_0002723 3300045051 Bacteria 25665
129 Ga0451576_0003635 3300045051 Bacteria 20942
130 Ga0495617_000046 3300046452 Bacteria 115430
131 Ga0495638_0038827 3300046460 Bacteria 3024
132 Ga0495650_0037884 3300046471 Bacteria 2093
133 Ga0495650_0038475 3300046471 Bacteria 2072
134 Ga0495584_0125945 3300046491 Bacteria 1298
135 Ga0495596_0006556 3300046500 Bacteria 5343
136 Ga0495596_0101217 3300046500 Bacteria 1118
137 Ga0495583_0000888 3300046506 Bacteria 35841
138 Ga0495583_0094360 3300046506 Bacteria 1284
139 Ga0495606_0000187 3300046507 Bacteria 108140
140 Ga0495606_0001166 3300046507 Bacteria 37155
141 Ga0495616_0001115 3300046513 Bacteria 19062
142 Ga0495616_0019870 3300046513 Bacteria 3661
143 Ga0495631_0046544 3300046518 Bacteria 1906
144 Ga0495637_0003124 3300046520 Bacteria 8838
145 Ga0495637_0013318 3300046520 Bacteria 3904
146 Ga0495643_0000517 3300046522 Bacteria 48097
147 Ga0495643_0005021 3300046522 Bacteria 9064
148 Ga0495648_0035008 3300046524 Bacteria 3260
149 Ga0495642_0006666 3300046528 Bacteria 4433
150 Ga0495642_0022994 3300046528 Bacteria 2459
151 Ga0495654_0000909 3300046530 Bacteria 21993
152 Ga0495654_0041126 3300046530 Bacteria 2300
153 Ga0495586_0050033 3300046535 Bacteria 2260
154 Ga0495597_0007028 3300046542 Bacteria 5767
155 Ga0495633_0000465 3300046558 Bacteria 41465
156 Ga0495625_0100364 3300046660 Bacteria 1990
157 Ga0495661_0018901 3300046665 Bacteria 4523
158 Ga0495658_0014564 3300046683 Bacteria 4022
159 Ga0495670_0134892 3300046691 Bacteria 1288
160 Ga0495649_0119970 3300046694 Bacteria 1391
161 Ga0495660_0072668 3300046810 Bacteria 1821
162 Ga0495672_0000078 3300047320 Bacteria 164474
163 Ga0495672_0007757 3300047320 Bacteria 8031
164 Ga0495687_000917 3300047443 Bacteria 30658
165 Ga0495677_0011086 3300047445 Bacteria 3300
166 Ga0495673_0030909 3300047469 Bacteria 2511
167 Ga0495686_0000387 3300047472 Bacteria 70185
168 Ga0495686_0048785 3300047472 Bacteria 2668
169 Ga0495686_0050108 3300047472 Bacteria 2624
170 Ga0495626_0007721 3300048091 Bacteria 5961
171 Ga0495626_0128618 3300048091 Bacteria 1083
172 Ga0496102_0015224 3300048905 Bacteria 6695
173 Ga0496106_0288537 3300048909 Bacteria 1315
174 Ga0496116_0004581 3300048919 Bacteria 13107
175 Ga0496117_0005883 3300048920 Bacteria 12676
176 Ga0496118_0016775 3300048921 Bacteria 6695
177 Ga0496124_0022237 3300048927 Bacteria 5819
178 Ga0496126_0066493 3300048929 Bacteria 3223
179 Ga0495682_0005344 3300049460 Bacteria 5349
180 Ga0501031_0079815 3300049568 Bacteria 2132
181 Ga0501031_0083314 3300049568 Bacteria 2084
182 Ga0501032_0009600 3300049569 Bacteria 7012
183 Ga0501033_0053671 3300049570 Bacteria 2985
184 Ga0501034_0008352 3300049571 Bacteria 10950
185 Ga0501034_0016588 3300049571 Bacteria 7552
186 Ga0501034_0095761 3300049571 Bacteria 2965
187 Ga0501034_0100462 3300049571 Bacteria 2887
188 Ga0501036_0267617 3300049572 Bacteria 1431
189 Ga0501037_0006331 3300049573 Bacteria 8656
190 Ga0501037_0281667 3300049573 Bacteria 1158
191 Ga0501038_0003147 3300049574 Bacteria 15407
192 Ga0501038_0045606 3300049574 Bacteria 3805
193 Ga0501039_0014273 3300049575 Bacteria 6081
194 Ga0501039_0078279 3300049575 Bacteria 2572
195 Ga0501040_0006481 3300049576 Bacteria 7602
196 Ga0501041_0038769 3300049577 Bacteria 2889
197 Ga0501042_0007749 3300049578 Bacteria 7054
198 Ga0501046_0026642 3300049580 Bacteria 4722
199 Ga0501046_0054529 3300049580 Bacteria 3144
200 Ga0501070_0409696 3300049586 Bacteria 1096
201 Ga0501071_0060897 3300049587 Bacteria 2733
202 Ga0501071_0440585 3300049587 Bacteria 997
203 Ga0501072_0039601 3300049588 Bacteria 3699
204 Ga0501073_0008301 3300049589 Bacteria 7704
205 Ga0501075_0002507 3300049591 Bacteria 12236
206 Ga0501076_0021587 3300049592 Bacteria 4940
207 Ga0501079_0003113 3300049741 Bacteria 12155
208 Ga0501080_0053237 3300049742 Bacteria 3767
209 Ga0501081_0176821 3300049743 Bacteria 1542
210 Ga0501083_0066635 3300049744 Bacteria 2397
211 Ga0501035_0025565 3300049822 Bacteria 5411
212 Ga0501044_0063533 3300049823 Bacteria 3771
213 Ga0501044_0396755 3300049823 Bacteria 1293
214 Ga0501045_0027820 3300049824 Bacteria 4077
215 nmdc:mga03683_4302_c1 3300050489 Bacteria 4705
216 nmdc:mga0yw44_31921_c1 3300050492 Bacteria 3066
217 nmdc:mga0yw44_44382_c1 3300050492 Bacteria 2658
218 nmdc:mga0yw44_985_c1 3300050492 Bacteria 10866
219 nmdc:mga0k408_13265_c1 3300050493 Bacteria 3262
220 nmdc:mga0k408_81996_c1 3300050493 Bacteria 1889
221 nmdc:mga06z11_56958_c1 3300050494 Bacteria 2023
222 nmdc:mga07m45_4576_c1 3300050496 Bacteria 6776
223 nmdc:mga05p37_441737_c1 3300050507 Bacteria 1508
224 nmdc:mga0sz30_25490_c1 3300050516 Bacteria 2418
225 nmdc:mga0sz30_5442_c1 3300050516 Bacteria 4670
226 Ga0500644_0044723 3300053088 Bacteria 1488
227 Ga0500641_0015181 3300053096 Bacteria 2853
228 Ga0500658_0012722 3300053134 Bacteria 3106
229 Ga0500568_0003477 3300053139 Bacteria 8757
230 Ga0500616_0005435 3300053153 Bacteria 8646
231 Ga0501084_0017488 3300054114 Bacteria 5961
232 Ga0501082_0008726 3300060353 Bacteria 8740
233 Ga0530510_0018696 3300061734 Bacteria 4914
234 2511436667 2511231035 Bacteria 5341610
235 2643730017 2643221541 Bacteria 5498788
236 2644039800 2643221605 Bacteria 4772303
237 2644045503 2643221606 Bacteria 5588032
238 2644358337 2643221664 Bacteria 7272945
239 2644392871 2643221671 Bacteria 5496681
240 2691332683 2690315857 Bacteria 4396207
241 2881717071 2881714928 Bacteria 2469486
242 2894510893 2894510363 Bacteria 5121143
243 2919538481 2919534386 Bacteria 4577686
244 2919691740 2919688452 Bacteria 4595932
245 2939606206 2939602548 Bacteria 4950493
246 2989392745 2989392574 Bacteria 4554005
247 Ga0496126_0115011
248 JGI25162J39368_1001066
249 Ga0070658_10004166
250 Ga0070658_10059997
251 Ga0070683_100185374
252 Ga0070680_100001078
253 Ga0070660_100013419
254 Ga0070689_100404440
255 Ga0070691_10149701
256 Ga0070661_100016909
257 Ga0070675_100212549
258 Ga0070674_100227223
259 Ga0070711_100250095
260 Ga0070708_100075331
261 Ga0070678_100008923
262 Ga0070681_10005001
263 Ga0070681_10397810
264 Ga0070706_100122471
265 Ga0070698_100005429
266 Ga0070699_100048203
267 Ga0070679_100012870
268 Ga0070684_100072183
269 Ga0070697_100017879
270 Ga0070665_100009833
271 Ga0070665_100036818
272 Ga0070665_100403127
273 Ga0068855_100006227
274 Ga0068855_100111759
275 Ga0070664_100309819
276 Ga0068857_100015287
277 Ga0068857_100069889
278 Ga0068857_100210825
279 Ga0068854_100003080
280 Ga0068854_100278477
281 Ga0068856_100065216
282 Ga0068852_100445656
283 Ga0081455_10000751
284 Ga0081455_10001528
285 Ga0081455_10053195
286 Ga0081539_10003869
287 Ga0070717_10029913
288 Ga0075362_10003542
289 Ga0075367_10062831
290 Ga0075369_10000518
291 Ga0075366_10015974
292 Ga0075366_10069956
293 Ga0075429_100098837
294 Ga0105251_10004275
295 Ga0105244_10007175
296 Ga0111539_10435341
297 Ga0105245_10000121
298 Ga0114129_10227620
299 Ga0105239_10170015
300 Ga0157326_1000433
301 Ga0157371_10004487
302 Ga0157371_10004889
303 Ga0157370_10055308
304 Ga0182008_10000714
305 Ga0157376_10183708
306 Ga0213876_10012007
307 Ga0207705_10001867
308 Ga0207705_10067601
309 Ga0207707_10006487
310 Ga0207695_10214083
311 Ga0207663_10227418
312 Ga0207660_10004857
313 Ga0207652_10002046
314 Ga0207694_10380452
315 Ga0207687_10000201
316 Ga0207690_10056673
317 Ga0207670_10151844
318 Ga0207665_10204403
319 Ga0207667_10017399
320 Ga0207702_10114744
321 Ga0207674_10021817
322 Ga0207674_10052718
323 Ga0207674_10366124
324 Ga0207683_10010913
325 Ga0207698_10233899
326 Ga0268266_10084159
327 Ga0268266_10161209
328 Ga0268266_10393328
329 Ga0268264_10235370
330 Ga0265340_10015353
331 Ga0265331_10009336
332 Ga0265316_10113623
333 Ga0307509_10008115
334 Ga0307408_100261138
335 Ga0307405_10056921
336 Ga0307412_10043249
337 Ga0307412_10058541
338 Ga0316593_10019363
339 Ga0373947_0268250
340 Ga0373937_0062381
341 Ga0395899_0000646
342 Ga0395899_0003914
343 Ga0395899_0008177
344 Ga0395899_0178614
345 Ga0395900_0001572
346 Ga0395900_0002906
347 Ga0395900_0007403
348 Ga0395900_0106075
349 Ga0395900_0283319
350 Ga0395900_0370759
351 Ga0395898_0047101
352 Ga0395898_0066812
353 Ga0395901_0006644
354 Ga0395901_0021301
355 Ga0395901_0028660
356 Ga0395901_0132631
357 Ga0395901_0194905
358 Ga0400483_090153
359 Ga0400483_090801
360 Ga0400483_192890
361 Ga0400483_231919
362 Ga0436365_0067385
363 Ga0436361_0496257
364 Ga0436361_0983570
365 Ga0450904_000772
366 Ga0451577_0000122
367 Ga0453683_0000046
368 Ga0453684_0000369
369 Ga0453684_0000434
370 Ga0453684_0036167
371 Ga0453684_0150275
372 Ga0466957_0037626
373 Ga0451576_0000827
374 Ga0451576_0002723
375 Ga0451576_0003635
376 Ga0495617_000046
377 Ga0495638_0038827
378 Ga0495650_0037884
379 Ga0495650_0038475
380 Ga0495584_0125945
381 Ga0495596_0006556
382 Ga0495596_0101217
383 Ga0495583_0000888
384 Ga0495583_0094360
385 Ga0495606_0000187
386 Ga0495606_0001166
387 Ga0495616_0001115
388 Ga0495616_0019870
389 Ga0495631_0046544
390 Ga0495637_0003124
391 Ga0495637_0013318
392 Ga0495643_0000517
393 Ga0495643_0005021
394 Ga0495648_0035008
395 Ga0495642_0006666
396 Ga0495642_0022994
397 Ga0495654_0000909
398 Ga0495654_0041126
399 Ga0495586_0050033
400 Ga0495597_0007028
401 Ga0495633_0000465
402 Ga0495625_0100364
403 Ga0495661_0018901
404 Ga0495658_0014564
405 Ga0495670_0134892
406 Ga0495649_0119970
407 Ga0495660_0072668
408 Ga0495672_0000078
409 Ga0495672_0007757
410 Ga0495687_000917
411 Ga0495677_0011086
412 Ga0495673_0030909
413 Ga0495686_0000387
414 Ga0495686_0048785
415 Ga0495686_0050108
416 Ga0495626_0007721
417 Ga0495626_0128618
418 Ga0496102_0015224
419 Ga0496106_0288537
420 Ga0496116_0004581
421 Ga0496117_0005883
422 Ga0496118_0016775
423 Ga0496124_0022237
424 Ga0496126_0066493
425 Ga0495682_0005344
426 Ga0501031_0079815
427 Ga0501031_0083314
428 Ga0501032_0009600
429 Ga0501033_0053671
430 Ga0501034_0008352
431 Ga0501034_0016588
432 Ga0501034_0095761
433 Ga0501034_0100462
434 Ga0501036_0267617
435 Ga0501037_0006331
436 Ga0501037_0281667
437 Ga0501038_0003147
438 Ga0501038_0045606
439 Ga0501039_0014273
440 Ga0501039_0078279
441 Ga0501040_0006481
442 Ga0501041_0038769
443 Ga0501042_0007749
444 Ga0501046_0026642
445 Ga0501046_0054529
446 Ga0501070_0409696
447 Ga0501071_0060897
448 Ga0501071_0440585
449 Ga0501072_0039601
450 Ga0501073_0008301
451 Ga0501075_0002507
452 Ga0501076_0021587
453 Ga0501079_0003113
454 Ga0501080_0053237
455 Ga0501081_0176821
456 Ga0501083_0066635
457 Ga0501035_0025565
458 Ga0501044_0063533
459 Ga0501044_0396755
460 Ga0501045_0027820
461 nmdc:mga03683_4302_c1
462 nmdc:mga0yw44_31921_c1
463 nmdc:mga0yw44_44382_c1
464 nmdc:mga0yw44_985_c1
465 nmdc:mga0k408_13265_c1
466 nmdc:mga0k408_81996_c1
467 nmdc:mga06z11_56958_c1
468 nmdc:mga07m45_4576_c1
469 nmdc:mga05p37_441737_c1
470 nmdc:mga0sz30_25490_c1
471 nmdc:mga0sz30_5442_c1
472 Ga0500644_0044723
473 Ga0500641_0015181
474 Ga0500658_0012722
475 Ga0500568_0003477
476 Ga0500616_0005435
477 Ga0501084_0017488
478 Ga0501082_0008726
479 Ga0530510_0018696
480 2511436667
481 2643730017
482 2644039800
483 2644045503
484 2644358337
485 2644392871
486 2691332683
487 2881717071
488 2894510893
489 2919538481
490 2919691740
491 2939606206
492 2989392745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

229

330

0.97

PF00551

Formyl_trans_N

Formyl transferase

4

192

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.9799 1 311
3r8x-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from yersinia pestis complexed with l-methionine 0.9755 1 310
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.9735 1 311
1fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase from escherichia coli 0.9714 1 311
1fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase from escherichia coli 0.9622 1 311
ID Description Score Start End Superfamily
3q0iA02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9914 207 310 3.10.25.10
3q0iA02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9727 207 310 3.10.25.10
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.96 1 205 3.40.50.170
3tqqA02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9571 207 311 3.10.25.10
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9503 1 205 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A447KN32-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9796 98 310 GO:0004479
GO:0005829
AF-A0A4Q8WVE6-F1-model_v4 deleted 0.9793 1 108
AF-A0A534VMK3-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9783 155 310 GO:0004479
GO:0005829
AF-A0A376FF32-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9771 1 205 GO:0004479
GO:0005829
AF-A0A447KN32-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9751 98 310 GO:0004479
GO:0005829

Map