F358380

General Info

Members Datasets Scaffolds Average Seq Length
246 195 224 256

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0000017|Ga0466969_0000017_6105_6980
Length 291
Sequence MDRGRQRAGAGRHLAAGARALTQQLHQRTAMDLGLAGKWALVCAASKGLGKGCATALVREGANVVITARGEEALQRTAHELRALGRGEVRAVAGDITTPEGRAAALAACPQVDILVNNAGGPPPGDFRDWSREDWLKAVEGNMLTPIELIKATVDGMAERGFGRIVNITSSSVKAPIETLGLSNGARSGLTGFVAGLARQARLASRNVTINNLLPGQFDTDRLRGTTRAAAERAGRDFDGWWQQRQQAIPARRFGTAEEFGAVCAFLCSAQAGYLTGQNLLLDGGAYPGTF

Samples

Sample ID Description Type Environment
1 2511231018 Pseudomonas sp. GM60 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
5 2643221660 Methylibium sp. Root1272 Isolate Unclassified
6 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
7 2738543013 Variovorax sp. BT01 Isolate Unclassified
8 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
9 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
10 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
11 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
12 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
13 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
14 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
15 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
16 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
17 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
18 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
193 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
194 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
195 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.06
Metatranscriptomes 0
Isolates 8.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.98
Nodule 1.22
Rhizoplane 7.72
Rhizosphere 73.98
Stem 0
Stem Tuber 0
Unclassified 6.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10151705 3300003320 Bacteria 1928
2 JGI25160J50197_1000043 3300003354 Bacteria 146498
3 Ga0055524_1000125 3300003775 Bacteria 90042
4 Ga0055536_1027972 3300003781 Bacteria 1546
5 Ga0055534_1002000 3300003784 Bacteria 7427
6 Ga0055528_1003774 3300003790 Bacteria 7473
7 Ga0055530_10002565 3300003791 Bacteria 11531
8 Ga0055540_1000011 3300003792 Bacteria 282927
9 Ga0055540_1033223 3300003792 Bacteria 1170
10 Ga0065165_1001828 3300005262 Bacteria 20811
11 Ga0065715_10153268 3300005293 Bacteria 1694
12 Ga0070677_10045635 3300005333 Bacteria 1749
13 Ga0068869_100015951 3300005334 Bacteria 5056
14 Ga0070666_10031806 3300005335 Bacteria 3485
15 Ga0068868_100032043 3300005338 Bacteria 4041
16 Ga0070689_100113768 3300005340 Bacteria 2155
17 Ga0070668_100020785 3300005347 Bacteria 4958
18 Ga0070669_100008890 3300005353 Bacteria 7166
19 Ga0070669_100062948 3300005353 Bacteria 2729
20 Ga0070671_100047039 3300005355 Bacteria 3588
21 Ga0070671_100247170 3300005355 Bacteria 1515
22 Ga0070674_100167026 3300005356 Bacteria 1675
23 Ga0070673_100009936 3300005364 Bacteria 6413
24 Ga0070694_100042385 3300005444 Bacteria 3040
25 Ga0070678_100016510 3300005456 Bacteria 4726
26 Ga0070672_100101315 3300005543 Bacteria 2336
27 Ga0070695_100026141 3300005545 Bacteria 3609
28 Ga0070695_100033055 3300005545 Bacteria 3235
29 Ga0070665_100034457 3300005548 Bacteria 5091
30 Ga0070664_100031722 3300005564 Bacteria 4417
31 Ga0068859_100036995 3300005617 Bacteria 4899
32 Ga0068859_100079768 3300005617 Bacteria 3314
33 Ga0068864_100134774 3300005618 Bacteria 2222
34 Ga0068864_100474688 3300005618 Bacteria 1200
35 Ga0068864_100957099 3300005618 Bacteria 847
36 Ga0068858_100019783 3300005842 Bacteria 6293
37 Ga0068858_100765275 3300005842 Bacteria 941
38 Ga0075364_10024914 3300006051 Bacteria 3804
39 Ga0097621_100026698 3300006237 Bacteria 4533
40 Ga0068871_100061221 3300006358 Bacteria 3073
41 Ga0075428_100497563 3300006844 Bacteria 1304
42 Ga0075431_100026178 3300006847 Bacteria 5983
43 Ga0075433_10234012 3300006852 Bacteria 1631
44 Ga0075434_100000002 3300006871 Bacteria 135661
45 Ga0075434_100496854 3300006871 Bacteria 1241
46 Ga0075429_100242954 3300006880 Bacteria 1577
47 Ga0075436_100222967 3300006914 Bacteria 1338
48 Ga0097620_100036994 3300006931 Bacteria 4899
49 Ga0097620_100079769 3300006931 Bacteria 3314
50 Ga0105240_10224411 3300009093 Bacteria 2187
51 Ga0111539_10657183 3300009094 Bacteria 1221
52 Ga0114129_10165149 3300009147 Bacteria 3022
53 Ga0114129_10671972 3300009147 Bacteria 1334
54 Ga0105248_10024928 3300009177 Bacteria 6648
55 Ga0105237_10127299 3300009545 Bacteria 2541
56 Ga0105249_10130181 3300009553 Bacteria 2401
57 Ga0157374_10100550 3300013296 Bacteria 2772
58 Ga0163162_10681039 3300013306 Bacteria 1151
59 Ga0157376_10274300 3300014969 Bacteria 1586
60 Ga0182006_1070126 3300015261 Bacteria 1302
61 Ga0163161_10020067 3300017792 Bacteria 4688
62 Ga0213872_10053377 3300021361 Bacteria 1833
63 Ga0209148_1000659 3300025254 Bacteria 29691
64 Ga0209565_1001884 3300025263 Bacteria 8316
65 Ga0209455_1001231 3300025272 Bacteria 12111
66 Ga0209673_1000061 3300025273 Bacteria 262274
67 Ga0209130_1004421 3300025284 Bacteria 5343
68 Ga0209675_1024243 3300025291 Bacteria 1553
69 Ga0209676_1005731 3300025292 Bacteria 6374
70 Ga0209025_1000040 3300025294 Bacteria 376228
71 Ga0209564_1005333 3300025295 Bacteria 7391
72 Ga0209050_1000583 3300025298 Bacteria 59089
73 Ga0209050_1012384 3300025298 Bacteria 3919
74 Ga0209050_1038777 3300025298 Bacteria 1352
75 Ga0209256_1000113 3300025299 Bacteria 175296
76 Ga0207426_1000014 3300025302 Bacteria 649413
77 Ga0209051_1000020 3300025303 Bacteria 508628
78 Ga0209051_1009840 3300025303 Bacteria 4891
79 Ga0209257_1000085 3300025304 Bacteria 291117
80 Ga0207697_10010615 3300025315 Bacteria 3930
81 Ga0207682_10076992 3300025893 Bacteria 1422
82 Ga0207680_10025965 3300025903 Bacteria 3239
83 Ga0207645_10015335 3300025907 Bacteria 5095
84 Ga0207643_10145577 3300025908 Bacteria 1417
85 Ga0207695_10250859 3300025913 Bacteria 1669
86 Ga0207695_10360362 3300025913 Bacteria 1340
87 Ga0207671_10074250 3300025914 Bacteria 2541
88 Ga0207681_10200254 3300025923 Bacteria 1533
89 Ga0207650_10179563 3300025925 Bacteria 1686
90 Ga0207691_10014015 3300025940 Bacteria 7648
91 Ga0207691_10195840 3300025940 Bacteria 1761
92 Ga0207711_10087920 3300025941 Bacteria 2727
93 Ga0207689_10050774 3300025942 Bacteria 3418
94 Ga0207679_10048655 3300025945 Bacteria 3088
95 Ga0207651_10058767 3300025960 Bacteria 2659
96 Ga0207658_10090150 3300025986 Bacteria 2376
97 Ga0207677_10022071 3300026023 Bacteria 3904
98 Ga0207703_10442918 3300026035 Bacteria 1212
99 Ga0207639_10428083 3300026041 Bacteria 1198
100 Ga0207641_10078803 3300026088 Bacteria 2854
101 Ga0207641_10134021 3300026088 Bacteria 2228
102 Ga0207648_10000263 3300026089 Bacteria 56886
103 Ga0207648_10029095 3300026089 Bacteria 4899
104 Ga0207676_10406581 3300026095 Bacteria 1273
105 Ga0207683_10019535 3300026121 Bacteria 5787
106 Ga0207683_10022034 3300026121 Bacteria 5466
107 Ga0207683_10288492 3300026121 Bacteria 1500
108 Ga0207683_10338035 3300026121 Bacteria 1381
109 Ga0207428_10037838 3300027907 Bacteria 3924
110 Ga0207428_10390870 3300027907 Bacteria 1019
111 Ga0268265_10041962 3300028380 Bacteria 3391
112 Ga0268265_10360388 3300028380 Bacteria 1331
113 Ga0268264_10094382 3300028381 Bacteria 2586
114 Ga0265328_10008268 3300031239 Bacteria 4302
115 Ga0265316_10192368 3300031344 Bacteria 1515
116 Ga0307408_100000221 3300031548 Bacteria 60975
117 Ga0307406_10001423 3300031901 Bacteria 13269
118 Ga0373954_0000014 3300035118 Bacteria 71012
119 Ga0373924_0019639 3300035410 Bacteria 2619
120 Ga0373931_0416257 3300035691 Bacteria 853
121 Ga0373927_0002728 3300035695 Bacteria 12880
122 Ga0373933_0002300 3300035724 Bacteria 10867
123 Ga0373937_0000218 3300036401 Bacteria 55605
124 Ga0373925_0345503 3300037068 Bacteria 1207
125 Ga0373925_0420856 3300037068 Bacteria 1091
126 Ga0395900_0169699 3300037418 Bacteria 2222
127 Ga0395905_0107411 3300037471 Bacteria 2620
128 Ga0395905_0108817 3300037471 Bacteria 2602
129 Ga0436361_0289897 3300039447 Bacteria 1895
130 Ga0450914_011683 3300042118 Bacteria 868
131 Ga0439435_0070910 3300042436 Bacteria 1031
132 Ga0466969_0000017 3300044656 Bacteria 103792
133 Ga0466966_0001817 3300044684 Bacteria 13843
134 Ga0466966_0051404 3300044684 Bacteria 2619
135 Ga0466961_0001407 3300044693 Bacteria 14912
136 Ga0466961_0011409 3300044693 Bacteria 5683
137 Ga0466961_0118114 3300044693 Bacteria 1666
138 Ga0453684_0004531 3300044712 Bacteria 29152
139 Ga0453684_0006707 3300044712 Bacteria 21712
140 Ga0453684_0269522 3300044712 Bacteria 1946
141 Ga0466970_0006747 3300044765 Bacteria 5744
142 Ga0466957_0020079 3300044842 Bacteria 3932
143 Ga0466957_0090390 3300044842 Bacteria 1917
144 Ga0466957_0121227 3300044842 Bacteria 1667
145 Ga0466959_0001240 3300045049 Bacteria 15427
146 Ga0466958_0010356 3300045836 Bacteria 5221
147 Ga0466967_0018520 3300045976 Bacteria 5568
148 Ga0466967_0651098 3300045976 Bacteria 1042
149 Ga0466967_0790672 3300045976 Bacteria 942
150 Ga0495603_0001694 3300046455 Bacteria 12959
151 Ga0495590_0005981 3300046457 Bacteria 4771
152 Ga0495590_0010230 3300046457 Bacteria 3533
153 Ga0495590_0017702 3300046457 Bacteria 2560
154 Ga0495650_0014022 3300046471 Bacteria 4200
155 Ga0495580_0004173 3300046472 Bacteria 12154
156 Ga0495605_0002328 3300046474 Bacteria 11837
157 Ga0495662_0303460 3300046476 Bacteria 785
158 Ga0495583_0012339 3300046506 Bacteria 4842
159 Ga0495606_0007275 3300046507 Bacteria 9975
160 Ga0495631_0214357 3300046518 Bacteria 822
161 Ga0495648_0011014 3300046524 Bacteria 6851
162 Ga0495665_0027378 3300046531 Bacteria 3059
163 Ga0495625_0036420 3300046660 Bacteria 3617
164 Ga0495647_0016263 3300046681 Bacteria 2616
165 Ga0495613_0569421 3300046689 Bacteria 756
166 Ga0495670_0310272 3300046691 Bacteria 846
167 Ga0495671_0045862 3300046692 Bacteria 2187
168 Ga0495649_0010926 3300046694 Bacteria 5348
169 Ga0495649_0026647 3300046694 Bacteria 3212
170 Ga0495589_0028407 3300046794 Bacteria 2823
171 Ga0495604_0178077 3300047317 Bacteria 1489
172 Ga0495674_0004252 3300047319 Bacteria 13794
173 Ga0495676_0059176 3300047321 Bacteria 3011
174 Ga0495683_0000561 3300047323 Bacteria 28045
175 Ga0495687_008981 3300047443 Bacteria 5650
176 Ga0495687_016806 3300047443 Bacteria 3669
177 Ga0495685_036921 3300047447 Bacteria 1677
178 Ga0495673_0002394 3300047469 Bacteria 13258
179 Ga0495681_0211651 3300047470 Bacteria 781
180 Ga0496100_0000139 3300048903 Bacteria 40188
181 Ga0496100_0006117 3300048903 Bacteria 6542
182 Ga0496101_0000243 3300048904 Bacteria 40099
183 Ga0496101_0009338 3300048904 Bacteria 6444
184 Ga0496102_0000179 3300048905 Bacteria 86002
185 Ga0496103_0000369 3300048906 Bacteria 40485
186 Ga0496104_0008430 3300048907 Bacteria 9166
187 Ga0496104_0019114 3300048907 Bacteria 6263
188 Ga0496104_0053365 3300048907 Bacteria 3818
189 Ga0496105_0001659 3300048908 Bacteria 15865
190 Ga0496105_0032129 3300048908 Bacteria 4306
191 Ga0496105_0463885 3300048908 Bacteria 998
192 Ga0496106_0564179 3300048909 Bacteria 913
193 Ga0496108_0135432 3300048911 Bacteria 2119
194 Ga0496112_0011627 3300048915 Bacteria 8051
195 Ga0496113_0059232 3300048916 Bacteria 2884
196 Ga0496114_0004650 3300048917 Bacteria 10672
197 Ga0496114_0254656 3300048917 Bacteria 1545
198 Ga0496115_0131025 3300048918 Bacteria 2067
199 Ga0496117_0001138 3300048920 Bacteria 40074
200 Ga0496118_0001176 3300048921 Bacteria 40395
201 Ga0496121_0001521 3300048924 Bacteria 38915
202 Ga0496121_0006794 3300048924 Bacteria 14016
203 Ga0496121_0015558 3300048924 Bacteria 7953
204 Ga0495682_0006617 3300049460 Bacteria 4683
205 Ga0501033_0026902 3300049570 Bacteria 4328
206 Ga0501034_0069484 3300049571 Bacteria 3533
207 Ga0501034_0900501 3300049571 Bacteria 772
208 Ga0501047_0009658 3300049581 Bacteria 9118
209 Ga0501047_0049209 3300049581 Bacteria 4070
210 Ga0501266_000123 3300049763 Bacteria 9596
211 Ga0501035_0029376 3300049822 Bacteria 5013
212 Ga0501044_0000987 3300049823 Bacteria 34197
213 nmdc:mga05p37_428624_c1 3300050507 Bacteria 1537
214 nmdc:mga09592_42692_c1 3300050508 Bacteria 3814
215 nmdc:mga0qj67_217117_c1 3300050509 Bacteria 1553
216 nmdc:mga0qj67_49270_c1 3300050509 Bacteria 3330
217 nmdc:mga06r32_66035_c1 3300050510 Bacteria 3491
218 nmdc:mga08y16_14146_c1 3300050511 Bacteria 8398
219 nmdc:mga0n895_6398_c1 3300050512 Bacteria 9997
220 nmdc:mga0n895_682276_c1 3300050512 Bacteria 1024
221 nmdc:mga08x19_106857_c1 3300050514 Bacteria 1862
222 nmdc:mga0a205_163287_c1 3300050515 Bacteria 2123
223 Ga0466962_0002649 3300061719 Bacteria 8514
224 Ga0530510_0343980 3300061734 Bacteria 1120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042118 Ga0450914_011683 Ga0450914_011683_22_771 179
2 3300048908 Ga0496105_0463885 Ga0496105_0463885_160_867 192
3 3300044693 Ga0466961_0011409 Ga0466961_0011409_1812_2600 194
4 3300049571 Ga0501034_0900501 Ga0501034_0900501_35_742 194
5 3300035410 Ga0373924_0019639 Ga0373924_0019639_35_745 195
6 3300035691 Ga0373931_0416257 Ga0373931_0416257_27_737 195
7 3300037068 Ga0373925_0420856 Ga0373925_0420856_366_1076 195
8 3300046476 Ga0495662_0303460 Ga0495662_0303460_35_745 195
9 3300046518 Ga0495631_0214357 Ga0495631_0214357_28_738 195
10 3300046681 Ga0495647_0016263 Ga0495647_0016263_1868_2578 195
11 3300046689 Ga0495613_0569421 Ga0495613_0569421_21_731 195
12 3300046691 Ga0495670_0310272 Ga0495670_0310272_74_784 195
13 3300047317 Ga0495604_0178077 Ga0495604_0178077_34_744 195
14 3300047470 Ga0495681_0211651 Ga0495681_0211651_28_738 195
15 3300037418 Ga0395900_0169699 Ga0395900_0169699_1389_2168 196
16 3300045976 Ga0466967_0790672 Ga0466967_0790672_28_807 196
17 3300025913 Ga0207695_10360362 Ga0207695_103603621 197
18 3300047321 Ga0495676_0059176 Ga0495676_0059176_1876_2658 199
19 3300021361 Ga0213872_10053377 Ga0213872_100533772 200
20 3300039447 Ga0436361_0289897 Ga0436361_0289897_604_1392 200
21 3300006847 Ga0075431_100026178 Ga0075431_1000261787 201
22 3300006880 Ga0075429_100242954 Ga0075429_1002429542 201
23 3300050509 nmdc:mga0qj67_49270_c1 nmdc:mga0qj67_49270_c1_2521_3300 201
24 3300050510 nmdc:mga06r32_66035_c1 nmdc:mga06r32_66035_c1_30_809 201
25 3300005340 Ga0070689_100113768 Ga0070689_1001137682 203
26 3300005347 Ga0070668_100020785 Ga0070668_1000207854 203
27 3300005353 Ga0070669_100062948 Ga0070669_1000629482 203
28 3300005355 Ga0070671_100047039 Ga0070671_1000470392 203
29 3300005356 Ga0070674_100167026 Ga0070674_1001670262 203
30 3300005364 Ga0070673_100009936 Ga0070673_1000099364 203
31 3300005456 Ga0070678_100016510 Ga0070678_1000165104 203
32 3300005842 Ga0068858_100019783 Ga0068858_1000197835 203
33 3300009147 Ga0114129_10671972 Ga0114129_106719721 203
34 3300009553 Ga0105249_10130181 Ga0105249_101301812 203
35 3300013296 Ga0157374_10100550 Ga0157374_101005503 203
36 3300014969 Ga0157376_10274300 Ga0157376_102743002 203
37 3300015261 Ga0182006_1070126 Ga0182006_10701261 203
38 3300025315 Ga0207697_10010615 Ga0207697_100106153 203
39 3300025907 Ga0207645_10015335 Ga0207645_100153352 203
40 3300025960 Ga0207651_10058767 Ga0207651_100587672 203
41 3300026035 Ga0207703_10442918 Ga0207703_104429182 203
42 3300026088 Ga0207641_10078803 Ga0207641_100788032 203
43 3300026121 Ga0207683_10022034 Ga0207683_100220343 203
44 3300031548 Ga0307408_100000221 Ga0307408_10000022115 206
45 3300031901 Ga0307406_10001423 Ga0307406_100014237 206
46 3300044684 Ga0466966_0001817 Ga0466966_0001817_5037_5822 206
47 3300044693 Ga0466961_0001407 Ga0466961_0001407_6902_7687 206
48 3300045836 Ga0466958_0010356 Ga0466958_0010356_1985_2770 206
49 3300045976 Ga0466967_0018520 Ga0466967_0018520_3437_4222 206
50 3300046507 Ga0495606_0007275 Ga0495606_0007275_5254_6003 206
51 3300005293 Ga0065715_10153268 Ga0065715_101532682 207
52 3300005333 Ga0070677_10045635 Ga0070677_100456352 207
53 3300005335 Ga0070666_10031806 Ga0070666_100318064 207
54 3300005338 Ga0068868_100032043 Ga0068868_1000320435 207
55 3300005543 Ga0070672_100101315 Ga0070672_1001013153 207
56 3300005548 Ga0070665_100034457 Ga0070665_1000344575 207
57 3300005617 Ga0068859_100036995 Ga0068859_1000369953 207
58 3300005618 Ga0068864_100957099 Ga0068864_1009570991 207
59 3300006237 Ga0097621_100026698 Ga0097621_1000266982 207
60 3300006358 Ga0068871_100061221 Ga0068871_1000612214 207
61 3300006931 Ga0097620_100036994 Ga0097620_1000369943 207
62 3300009177 Ga0105248_10024928 Ga0105248_100249283 207
63 3300013306 Ga0163162_10681039 Ga0163162_106810392 207
64 3300017792 Ga0163161_10020067 Ga0163161_100200677 207
65 3300025893 Ga0207682_10076992 Ga0207682_100769922 207
66 3300025903 Ga0207680_10025965 Ga0207680_100259653 207
67 3300025908 Ga0207643_10145577 Ga0207643_101455772 207
68 3300025940 Ga0207691_10014015 Ga0207691_100140158 207
69 3300025941 Ga0207711_10087920 Ga0207711_100879203 207
70 3300025942 Ga0207689_10050774 Ga0207689_100507742 207
71 3300026023 Ga0207677_10022071 Ga0207677_100220715 207
72 3300026041 Ga0207639_10428083 Ga0207639_104280832 207
73 3300026089 Ga0207648_10000263 Ga0207648_1000026327 207
74 3300028380 Ga0268265_10041962 Ga0268265_100419624 207
75 3300028381 Ga0268264_10094382 Ga0268264_100943822 207
76 3300031239 Ga0265328_10008268 Ga0265328_100082683 207
77 3300031344 Ga0265316_10192368 Ga0265316_101923682 207
78 3300044842 Ga0466957_0121227 Ga0466957_0121227_899_1651 207
79 3300048911 Ga0496108_0135432 Ga0496108_0135432_983_1762 207
80 3300044712 Ga0453684_0006707 Ga0453684_0006707_8752_9531 208
81 3300005334 Ga0068869_100015951 Ga0068869_1000159512 210
82 3300009545 Ga0105237_10127299 Ga0105237_101272993 210
83 3300025914 Ga0207671_10074250 Ga0207671_100742503 210
84 iso_pu_bacteria 2889306138 2889306314 214
85 iso_pu_bacteria 2511231018 2511336118 215
86 iso_pu_bacteria 2513237166 2514048282 215
87 iso_pu_bacteria 2521172590 2521558763 215
88 iso_pu_bacteria 2562617112 2563056876 215
89 iso_pu_bacteria 2643221660 2644338748 215
90 iso_pu_bacteria 2711768613 2713481106 215
91 iso_pu_bacteria 2738543013 2739248029 215
92 iso_pu_bacteria 2818991449 2819614010 215
93 iso_pu_bacteria 2904439833 2904443942 215
94 iso_pu_bacteria 2904530477 2904534509 215
95 iso_pu_bacteria 2904584206 2904584400 215
96 iso_pu_bacteria 2904589729 2904590868 215
97 iso_pu_bacteria 2904601388 2904603291 215
98 iso_pu_bacteria 2919046199 2919050182 215
99 iso_pu_bacteria 2919079590 2919080704 215
100 iso_pu_bacteria 2919130084 2919133070 215
101 iso_pu_bacteria 2929195423 2929195880 215
102 iso_pu_bacteria 8021622325 8021623195 215
103 iso_pu_bacteria 8021626552 8021626967 215
104 iso_pu_bacteria 8021648035 8021649019 215
105 iso_pu_bacteria 8055301274 8055307098 215
106 3300005444 Ga0070694_100042385 Ga0070694_1000423853 217
107 3300005545 Ga0070695_100026141 Ga0070695_1000261412 217
108 3300005545 Ga0070695_100033055 Ga0070695_1000330552 217
109 3300005618 Ga0068864_100474688 Ga0068864_1004746881 217
110 3300006844 Ga0075428_100497563 Ga0075428_1004975632 217
111 3300006852 Ga0075433_10234012 Ga0075433_102340122 217
112 3300006871 Ga0075434_100000002 Ga0075434_100000002138 217
113 3300006914 Ga0075436_100222967 Ga0075436_1002229672 217
114 3300026095 Ga0207676_10406581 Ga0207676_104065812 217
115 3300027907 Ga0207428_10037838 Ga0207428_100378382 217
116 3300035118 Ga0373954_0000014 Ga0373954_0000014_30470_31246 217
117 3300035724 Ga0373933_0002300 Ga0373933_0002300_6333_7109 217
118 3300036401 Ga0373937_0000218 Ga0373937_0000218_25526_26302 217
119 3300044712 Ga0453684_0004531 Ga0453684_0004531_47_823 217
120 3300050508 nmdc:mga09592_42692_c1 nmdc:mga09592_42692_c1_255_1031 217
121 3300050509 nmdc:mga0qj67_217117_c1 nmdc:mga0qj67_217117_c1_299_1075 217
122 3300050511 nmdc:mga08y16_14146_c1 nmdc:mga08y16_14146_c1_878_1654 217
123 3300050512 nmdc:mga0n895_6398_c1 nmdc:mga0n895_6398_c1_3763_4539 217
124 3300050514 nmdc:mga08x19_106857_c1 nmdc:mga08x19_106857_c1_589_1365 217
125 3300050515 nmdc:mga0a205_163287_c1 nmdc:mga0a205_163287_c1_754_1530 217
126 3300061734 Ga0530510_0343980 Ga0530510_0343980_88_864 217
127 3300003775 Ga0055524_1000125 Ga0055524_100012541 218
128 3300003791 Ga0055530_10002565 Ga0055530_100025657 218
129 3300003792 Ga0055540_1000011 Ga0055540_100001137 218
130 3300005564 Ga0070664_100031722 Ga0070664_1000317223 218
131 3300005617 Ga0068859_100079768 Ga0068859_1000797682 218
132 3300005618 Ga0068864_100134774 Ga0068864_1001347742 218
133 3300006871 Ga0075434_100496854 Ga0075434_1004968542 218
134 3300006931 Ga0097620_100079769 Ga0097620_1000797694 218
135 3300009094 Ga0111539_10657183 Ga0111539_106571832 218
136 3300009147 Ga0114129_10165149 Ga0114129_101651492 218
137 3300025254 Ga0209148_1000659 Ga0209148_10006597 218
138 3300025272 Ga0209455_1001231 Ga0209455_100123111 218
139 3300025291 Ga0209675_1024243 Ga0209675_10242431 218
140 3300025294 Ga0209025_1000040 Ga0209025_1000040297 218
141 3300025298 Ga0209050_1000583 Ga0209050_100058317 218
142 3300025298 Ga0209050_1012384 Ga0209050_10123843 218
143 3300025299 Ga0209256_1000113 Ga0209256_100011357 218
144 3300025303 Ga0209051_1000020 Ga0209051_100002037 218
145 3300025304 Ga0209257_1000085 Ga0209257_100008537 218
146 3300025923 Ga0207681_10200254 Ga0207681_102002541 218
147 3300025925 Ga0207650_10179563 Ga0207650_101795632 218
148 3300025945 Ga0207679_10048655 Ga0207679_100486552 218
149 3300026088 Ga0207641_10134021 Ga0207641_101340212 218
150 3300026089 Ga0207648_10029095 Ga0207648_100290953 218
151 3300026121 Ga0207683_10288492 Ga0207683_102884922 218
152 3300027907 Ga0207428_10390870 Ga0207428_103908702 218
153 3300028380 Ga0268265_10360388 Ga0268265_103603882 218
154 3300035695 Ga0373927_0002728 Ga0373927_0002728_8325_9104 218
155 3300037068 Ga0373925_0345503 Ga0373925_0345503_154_933 218
156 3300037471 Ga0395905_0108817 Ga0395905_0108817_328_1113 218
157 3300044656 Ga0466969_0000017 Ga0466969_0000017_6105_6980 218
158 3300044684 Ga0466966_0051404 Ga0466966_0051404_143_928 218
159 3300044693 Ga0466961_0118114 Ga0466961_0118114_384_1169 218
160 3300044765 Ga0466970_0006747 Ga0466970_0006747_3497_4282 218
161 3300044842 Ga0466957_0090390 Ga0466957_0090390_158_943 218
162 3300045049 Ga0466959_0001240 Ga0466959_0001240_6618_7403 218
163 3300045976 Ga0466967_0651098 Ga0466967_0651098_224_1006 218
164 3300048917 Ga0496114_0004650 Ga0496114_0004650_2903_3685 218
165 3300049570 Ga0501033_0026902 Ga0501033_0026902_976_1755 218
166 3300049571 Ga0501034_0069484 Ga0501034_0069484_2713_3492 218
167 3300049581 Ga0501047_0009658 Ga0501047_0009658_4465_5244 218
168 3300049822 Ga0501035_0029376 Ga0501035_0029376_1281_2060 218
169 3300049823 Ga0501044_0000987 Ga0501044_0000987_5370_6149 218
170 3300050507 nmdc:mga05p37_428624_c1 nmdc:mga05p37_428624_c1_303_1082 218
171 3300050512 nmdc:mga0n895_682276_c1 nmdc:mga0n895_682276_c1_170_949 218
172 3300061719 Ga0466962_0002649 Ga0466962_0002649_105_890 218
173 3300003354 JGI25160J50197_1000043 JGI25160J50197_100004329 219
174 3300003781 Ga0055536_1027972 Ga0055536_10279722 219
175 3300003784 Ga0055534_1002000 Ga0055534_10020006 219
176 3300003790 Ga0055528_1003774 Ga0055528_10037746 219
177 3300003792 Ga0055540_1033223 Ga0055540_10332232 219
178 3300005262 Ga0065165_1001828 Ga0065165_10018287 219
179 3300005353 Ga0070669_100008890 Ga0070669_1000088905 219
180 3300005355 Ga0070671_100247170 Ga0070671_1002471702 219
181 3300005842 Ga0068858_100765275 Ga0068858_1007652751 219
182 3300006051 Ga0075364_10024914 Ga0075364_100249143 219
183 3300009093 Ga0105240_10224411 Ga0105240_102244112 219
184 3300025263 Ga0209565_1001884 Ga0209565_10018842 219
185 3300025273 Ga0209673_1000061 Ga0209673_1000061163 219
186 3300025284 Ga0209130_1004421 Ga0209130_10044213 219
187 3300025292 Ga0209676_1005731 Ga0209676_10057315 219
188 3300025295 Ga0209564_1005333 Ga0209564_10053334 219
189 3300025302 Ga0207426_1000014 Ga0207426_1000014199 219
190 3300025303 Ga0209051_1009840 Ga0209051_10098402 219
191 3300025913 Ga0207695_10250859 Ga0207695_102508591 219
192 3300025940 Ga0207691_10195840 Ga0207691_101958401 219
193 3300025986 Ga0207658_10090150 Ga0207658_100901502 219
194 3300026121 Ga0207683_10019535 Ga0207683_100195352 219
195 3300026121 Ga0207683_10338035 Ga0207683_103380351 219
196 3300037471 Ga0395905_0107411 Ga0395905_0107411_1804_2586 219
197 3300042436 Ga0439435_0070910 Ga0439435_0070910_130_918 219
198 3300044712 Ga0453684_0269522 Ga0453684_0269522_234_1022 219
199 3300044842 Ga0466957_0020079 Ga0466957_0020079_2406_3194 219
200 3300046455 Ga0495603_0001694 Ga0495603_0001694_3844_4632 219
201 3300046457 Ga0495590_0005981 Ga0495590_0005981_1300_2082 219
202 3300046457 Ga0495590_0010230 Ga0495590_0010230_1817_2605 219
203 3300046457 Ga0495590_0017702 Ga0495590_0017702_541_1329 219
204 3300046471 Ga0495650_0014022 Ga0495650_0014022_2208_2996 219
205 3300046472 Ga0495580_0004173 Ga0495580_0004173_7626_8414 219
206 3300046474 Ga0495605_0002328 Ga0495605_0002328_5802_6590 219
207 3300046506 Ga0495583_0012339 Ga0495583_0012339_3194_3982 219
208 3300046524 Ga0495648_0011014 Ga0495648_0011014_3946_4734 219
209 3300046531 Ga0495665_0027378 Ga0495665_0027378_1404_2192 219
210 3300046660 Ga0495625_0036420 Ga0495625_0036420_1064_1861 219
211 3300046692 Ga0495671_0045862 Ga0495671_0045862_1312_2100 219
212 3300046694 Ga0495649_0010926 Ga0495649_0010926_3478_4266 219
213 3300046694 Ga0495649_0026647 Ga0495649_0026647_683_1471 219
214 3300046794 Ga0495589_0028407 Ga0495589_0028407_879_1667 219
215 3300047319 Ga0495674_0004252 Ga0495674_0004252_6856_7644 219
216 3300047323 Ga0495683_0000561 Ga0495683_0000561_25883_26671 219
217 3300047443 Ga0495687_008981 Ga0495687_008981_4467_5255 219
218 3300047443 Ga0495687_016806 Ga0495687_016806_1838_2626 219
219 3300047447 Ga0495685_036921 Ga0495685_036921_235_1023 219
220 3300047469 Ga0495673_0002394 Ga0495673_0002394_3794_4582 219
221 3300048903 Ga0496100_0000139 Ga0496100_0000139_12009_12797 219
222 3300048903 Ga0496100_0006117 Ga0496100_0006117_3704_4492 219
223 3300048904 Ga0496101_0000243 Ga0496101_0000243_27387_28175 219
224 3300048904 Ga0496101_0009338 Ga0496101_0009338_3497_4285 219
225 3300048905 Ga0496102_0000179 Ga0496102_0000179_73063_73851 219
226 3300048906 Ga0496103_0000369 Ga0496103_0000369_27078_27866 219
227 3300048907 Ga0496104_0008430 Ga0496104_0008430_3111_3899 219
228 3300048907 Ga0496104_0019114 Ga0496104_0019114_1355_2143 219
229 3300048907 Ga0496104_0053365 Ga0496104_0053365_2587_3375 219
230 3300048908 Ga0496105_0001659 Ga0496105_0001659_3974_4762 219
231 3300048908 Ga0496105_0032129 Ga0496105_0032129_1765_2553 219
232 3300048909 Ga0496106_0564179 Ga0496106_0564179_52_840 219
233 3300048915 Ga0496112_0011627 Ga0496112_0011627_2192_2980 219
234 3300048916 Ga0496113_0059232 Ga0496113_0059232_1633_2421 219
235 3300048917 Ga0496114_0254656 Ga0496114_0254656_727_1515 219
236 3300048918 Ga0496115_0131025 Ga0496115_0131025_16_804 219
237 3300048920 Ga0496117_0001138 Ga0496117_0001138_27347_28135 219
238 3300048921 Ga0496118_0001176 Ga0496118_0001176_12204_12992 219
239 3300048924 Ga0496121_0001521 Ga0496121_0001521_2106_2894 219
240 3300048924 Ga0496121_0006794 Ga0496121_0006794_12208_12996 219
241 3300048924 Ga0496121_0015558 Ga0496121_0015558_6877_7665 219
242 3300049460 Ga0495682_0006617 Ga0495682_0006617_565_1353 219
243 3300049581 Ga0501047_0049209 Ga0501047_0049209_1306_2097 219
244 3300049763 Ga0501266_000123 Ga0501266_000123_5926_6753 219
245 3300025298 Ga0209050_1038777 Ga0209050_10387772 222
246 3300003320 rootH2_10151705 rootH2_101517052 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

38

231

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

43

287

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z1n-assembly2.cif.gz_B crystal structure of ape0912 from aeropyrum pernix k1 0.9274 1 141
3f9i-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9215 5 141
5vps-assembly1.cif.gz_A crystal structure of an sdr from burkholderia ambifaria in complex with nadph with a tcep adduct 0.9177 1 151
2z1n-assembly1.cif.gz_A crystal structure of ape0912 from aeropyrum pernix k1 0.9156 1 141
3ai3-assembly1.cif.gz_G the crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with nadph and l-sorbose 0.9144 1 138
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9744 9 56 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9345 5 78 3.40.50.720
2z1nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9156 1 141 3.40.50.720
3ai1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9089 1 138 3.40.50.720
5va8D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9082 1 152 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8KN64-F1-model_v4 Short-chain dehydrogenase 0.9704 6 66 GO:0016020
GO:0016491
AF-A0A2V2L0T1-F1-model_v4 deleted 0.9704 5 66
AF-A0A384K484-F1-model_v4 Uncharacterized protein 0.9659 4 78 GO:0016491
AF-A0A6J4IXM9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.958 1 66 GO:0050664
AF-A0A381T439-F1-model_v4 Ketoreductase (KR) domain-containing protein 0.9566 5 66 GO:0005777
GO:0008670
GO:0009062

Feature Viewer

pLDDT pTM Quality
66.75 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map