F358287

General Info

Members Datasets Scaffolds Average Seq Length
246 192 193 238

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10015609|Ga0316576_100156093
Length 226
Sequence VIVLENISRIFQVGGESVHALDQVSLQVAKGDYLSIMGPSGSGKSTLLNVLGLLDRPDQGTYRIDGQDTTALTDDQQAAVRRHHIGFIFQFFHLVPRLTAAENVALPLVLSGVPQRERRQRVHDAMDRFGLSNRAGHRPDQLSGGQRQRVAIARATIMRPTVILADEPTGNLDRASGDEIIAAIESLKDEGLTVLIVTHDPHIGGRAARHIRMLDGRVVEDSRRTA

Samples

Sample ID Description Type Environment
1 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
4 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
5 2643221618 Ensifer sp. Root231 Isolate Unclassified
6 2643221626 Ensifer sp. Root31 Isolate Unclassified
7 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
8 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
9 2643221655 Ensifer sp. Root1252 Isolate Unclassified
10 2643221659 Ensifer sp. Root127 Isolate Unclassified
11 2643221668 Ensifer sp. Root423 Isolate Unclassified
12 2643221675 Ensifer sp. Root1298 Isolate Unclassified
13 2643221680 Ensifer sp. Root1312 Isolate Unclassified
14 2643221698 Ensifer sp. Root142 Isolate Unclassified
15 2643221712 Ensifer sp. Root258 Isolate Unclassified
16 2643221718 Rhizobium sp. Root268 Isolate Unclassified
17 2643221719 Rhizobium sp. Root274 Isolate Unclassified
18 2643221723 Ensifer sp. Root278 Isolate Unclassified
19 2643221726 Ensifer sp. Root954 Isolate Unclassified
20 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
21 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
22 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
23 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
24 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
25 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
26 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
27 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
28 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
29 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
30 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
31 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
32 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
33 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
34 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
35 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
36 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
37 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
38 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
39 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
40 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
41 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
42 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
43 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
44 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
45 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
46 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
47 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
50 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
51 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
52 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
55 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
85 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
182 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
183 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
187 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
188 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
189 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
190 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
191 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
192 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.46
Metatranscriptomes 0
Isolates 21.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 4.07
Rhizoplane 1.22
Rhizosphere 58.94
Stem 0
Stem Tuber 0
Unclassified 25.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000010 3300002704 Bacteria 207717
2 JGI25156J39149_1000102 3300002705 Bacteria 62463
3 JGI25162J39368_1001061 3300002737 Bacteria 16807
4 JGI25154J39366_1000184 3300002738 Bacteria 48243
5 JGI25157J39369_1000009 3300002741 Bacteria 207868
6 JGI25165J46597_1001126 3300003214 Bacteria 16807
7 JGI25160J50197_1000235 3300003354 Bacteria 43030
8 JGI25161J50226_1000175 3300003374 Bacteria 43039
9 Ga0055543_1000226 3300004625 Bacteria 44983
10 Ga0065165_1001345 3300005262 Bacteria 27210
11 Ga0065715_10365154 3300005293 Bacteria 929
12 Ga0070670_100166453 3300005331 Bacteria 1911
13 Ga0070709_10034626 3300005434 Bacteria 3063
14 Ga0070709_10150099 3300005434 Bacteria 1610
15 Ga0070714_100031514 3300005435 Bacteria 4424
16 Ga0070713_100045514 3300005436 Bacteria 3596
17 Ga0070713_100059337 3300005436 Bacteria 3195
18 Ga0070713_100088601 3300005436 Bacteria 2656
19 Ga0070713_100238922 3300005436 Bacteria 1654
20 Ga0070710_10016997 3300005437 Bacteria 3713
21 Ga0070710_10018651 3300005437 Bacteria 3572
22 Ga0070663_100037449 3300005455 Bacteria 3377
23 Ga0070662_100159735 3300005457 Bacteria 1762
24 Ga0070706_100233502 3300005467 Bacteria 1717
25 Ga0070707_100008759 3300005468 Bacteria 9382
26 Ga0070707_100078445 3300005468 Bacteria 3186
27 Ga0070698_100011216 3300005471 Bacteria 9521
28 Ga0070698_100077810 3300005471 Bacteria 3316
29 Ga0070698_100148000 3300005471 Bacteria 2297
30 Ga0070698_100323761 3300005471 Bacteria 1472
31 Ga0070697_100379313 3300005536 Bacteria 1224
32 Ga0068853_100190281 3300005539 Bacteria 1864
33 Ga0070665_100620902 3300005548 Bacteria 1094
34 Ga0068856_100116818 3300005614 Bacteria 2669
35 Ga0081455_10179240 3300005937 Bacteria 1606
36 Ga0081540_1010646 3300005983 Bacteria 6205
37 Ga0081540_1013583 3300005983 Bacteria 5283
38 Ga0070717_10001017 3300006028 Bacteria 18807
39 Ga0070717_10110373 3300006028 Bacteria 2346
40 Ga0070716_100096991 3300006173 Bacteria 1798
41 Ga0070712_100033733 3300006175 Bacteria 3465
42 Ga0070712_100152591 3300006175 Bacteria 1775
43 Ga0099795_10024914 3300007788 Bacteria 2000
44 Ga0111539_10352018 3300009094 Bacteria 1714
45 Ga0105239_10528153 3300010375 Bacteria 1343
46 Ga0105239_10929553 3300010375 Bacteria 999
47 Ga0163163_10613282 3300014325 Bacteria 1151
48 Ga0213872_10151748 3300021361 Bacteria 1012
49 Ga0213874_10051358 3300021377 Bacteria 1266
50 Ga0213875_10001355 3300021388 Bacteria 16107
51 Ga0213875_10002269 3300021388 Bacteria 11657
52 Ga0213875_10091638 3300021388 Bacteria 1418
53 Ga0209435_100009 3300025206 Bacteria 476614
54 Ga0209436_114705 3300025208 Bacteria 1237
55 Ga0209563_104702 3300025230 Bacteria 2574
56 Ga0209437_100057 3300025233 Bacteria 362922
57 Ga0209646_1000018 3300025246 Bacteria 476716
58 Ga0209026_1000068 3300025250 Bacteria 207601
59 Ga0209759_1000007 3300025256 Bacteria 476614
60 Ga0209233_1000134 3300025261 Bacteria 202535
61 Ga0209130_1000132 3300025284 Bacteria 119765
62 Ga0209130_1001489 3300025284 Bacteria 15214
63 Ga0209025_1060904 3300025294 Bacteria 1413
64 Ga0209256_1002945 3300025299 Bacteria 12778
65 Ga0207426_1000182 3300025302 Bacteria 155724
66 Ga0207426_1000246 3300025302 Bacteria 119765
67 Ga0207692_10149247 3300025898 Bacteria 1337
68 Ga0207684_10169201 3300025910 Bacteria 1884
69 Ga0207693_10009304 3300025915 Bacteria 8015
70 Ga0207693_10018757 3300025915 Bacteria 5505
71 Ga0207693_10138036 3300025915 Bacteria 1917
72 Ga0207663_10256035 3300025916 Bacteria 1290
73 Ga0207663_10460709 3300025916 Bacteria 982
74 Ga0207646_10004860 3300025922 Bacteria 14396
75 Ga0207646_10047894 3300025922 Bacteria 3833
76 Ga0207646_10056391 3300025922 Bacteria 3512
77 Ga0207650_10000151 3300025925 Bacteria 83229
78 Ga0207650_10077062 3300025925 Bacteria 2520
79 Ga0207700_10176595 3300025928 Bacteria 1785
80 Ga0207664_10164333 3300025929 Bacteria 1895
81 Ga0207664_10173652 3300025929 Bacteria 1846
82 Ga0207689_10164503 3300025942 Bacteria 1828
83 Ga0207668_10280601 3300025972 Bacteria 1366
84 Ga0207678_10053091 3300026067 Bacteria 3493
85 Ga0207702_10091036 3300026078 Bacteria 2670
86 Ga0207675_100244842 3300026118 Bacteria 1733
87 Ga0307515_10006431 3300028794 Bacteria 23507
88 Ga0265339_10007331 3300031249 Bacteria 7144
89 Ga0265331_10001221 3300031250 Bacteria 19325
90 Ga0307513_10444462 3300031456 Bacteria 1022
91 Ga0265313_10003987 3300031595 Bacteria 11584
92 Ga0316575_10092424 3300031665 Bacteria 1226
93 Ga0316576_10015609 3300031727 Bacteria 5102
94 Ga0307416_101687064 3300032002 Bacteria 738
95 Ga0373956_0140769 3300035119 Bacteria 1132
96 Ga0373955_0196220 3300035172 Bacteria 1201
97 Ga0373931_0167874 3300035691 Bacteria 1291
98 Ga0373927_0000019 3300035695 Bacteria 139754
99 Ga0373947_0175937 3300035725 Bacteria 1391
100 Ga0373937_0054724 3300036401 Bacteria 3662
101 Ga0373937_1145128 3300036401 Bacteria 726
102 Ga0316584_0197224 3300036712 Bacteria 1487
103 Ga0373925_0003004 3300037068 Bacteria 13268
104 Ga0373925_0113145 3300037068 Bacteria 2099
105 Ga0395900_0000056 3300037418 Bacteria 213077
106 Ga0395898_0000114 3300037466 Bacteria 213068
107 Ga0395905_0000053 3300037471 Bacteria 213077
108 Ga0395905_0012123 3300037471 Bacteria 8303
109 Ga0436364_0266271 3300037853 Bacteria 210347
110 Ga0436364_1151062 3300037853 Bacteria 1067
111 Ga0436364_1246752 3300037853 Bacteria 40716
112 Ga0436364_1374560 3300037853 Bacteria 2885
113 Ga0395901_0000037 3300038443 Bacteria 213059
114 Ga0400489_41341 3300039093 Unclassified 1209
115 Ga0436365_1463115 3300039437 Bacteria 2284
116 Ga0436360_0194301 3300039438 Bacteria 1236
117 Ga0436360_0716703 3300039438 Bacteria 1865
118 Ga0436361_0305858 3300039447 Bacteria 1733
119 Ga0436361_0411095 3300039447 Bacteria 2131
120 Ga0436361_0634798 3300039447 Bacteria 1051
121 Ga0436361_0694211 3300039447 Bacteria 1374
122 Ga0436361_0927133 3300039447 Bacteria 1511
123 Ga0436363_1415252 3300039450 Bacteria 1460
124 Ga0436363_1708711 3300039450 Bacteria 3918
125 Ga0436362_1273185 3300039453 Bacteria 4291
126 Ga0451577_0672967 3300042876 Bacteria 938
127 Ga0451576_0000400 3300045051 Bacteria 101055
128 Ga0495638_0034831 3300046460 Bacteria 3213
129 Ga0495594_0101003 3300046499 Bacteria 1623
130 Ga0495618_0010358 3300046514 Bacteria 5640
131 Ga0495667_0015475 3300046559 Bacteria 5154
132 Ga0495634_0286330 3300046642 Bacteria 999
133 Ga0495635_0014113 3300046663 Bacteria 5591
134 Ga0495599_0059008 3300046678 Bacteria 2400
135 Ga0495680_0103802 3300047322 Bacteria 2115
136 Ga0495686_0090632 3300047472 Bacteria 1856
137 Ga0495686_0212263 3300047472 Bacteria 1105
138 Ga0495686_0217707 3300047472 Bacteria 1088
139 Ga0496110_0069099 3300048913 Bacteria 3127
140 Ga0496117_0041019 3300048920 Bacteria 3397
141 Ga0496121_0000034 3300048924 Bacteria 377095
142 Ga0496122_0107399 3300048925 Bacteria 1844
143 Ga0496123_0029451 3300048926 Bacteria 4041
144 Ga0496124_0005858 3300048927 Bacteria 13630
145 Ga0496124_0061010 3300048927 Bacteria 3162
146 Ga0496124_0191646 3300048927 Bacteria 1563
147 Ga0496125_0000030 3300048928 Bacteria 375023
148 Ga0501031_0027858 3300049568 Bacteria 3683
149 Ga0501032_0107258 3300049569 Bacteria 1850
150 Ga0501033_0000120 3300049570 Bacteria 75504
151 Ga0501033_0025174 3300049570 Bacteria 4483
152 Ga0501033_0062674 3300049570 Bacteria 2738
153 Ga0501034_0034146 3300049571 Bacteria 5157
154 Ga0501034_0192307 3300049571 Bacteria 2002
155 Ga0501034_0226807 3300049571 Bacteria 1819
156 Ga0501034_0281301 3300049571 Bacteria 1603
157 Ga0501034_0832858 3300049571 Bacteria 814
158 Ga0501036_0259458 3300049572 Bacteria 1456
159 Ga0501038_0067451 3300049574 Bacteria 3044
160 Ga0501038_0077048 3300049574 Bacteria 2816
161 Ga0501039_0176429 3300049575 Bacteria 1680
162 Ga0501043_0042124 3300049579 Bacteria 3587
163 Ga0501043_0076709 3300049579 Bacteria 2626
164 Ga0501046_0259228 3300049580 Bacteria 1278
165 Ga0501047_0045778 3300049581 Bacteria 4230
166 Ga0501070_0141633 3300049586 Bacteria 1985
167 Ga0501070_0398219 3300049586 Bacteria 1114
168 Ga0501073_0227932 3300049589 Bacteria 1287
169 Ga0501077_0363751 3300049593 Bacteria 924
170 Ga0501080_0095141 3300049742 Bacteria 2766
171 Ga0501080_0253712 3300049742 Bacteria 1604
172 Ga0501083_0365008 3300049744 Bacteria 939
173 Ga0501280_002406 3300049776 Bacteria 3131
174 Ga0501035_0000954 3300049822 Bacteria 30597
175 Ga0501035_0008988 3300049822 Bacteria 9291
176 Ga0501035_0059844 3300049822 Bacteria 3392
177 Ga0501044_0045121 3300049823 Bacteria 4570
178 Ga0501044_0326838 3300049823 Bacteria 1457
179 Ga0501045_0222891 3300049824 Bacteria 1404
180 Ga0501045_0355881 3300049824 Bacteria 1090
181 nmdc:mga03683_47529_c1 3300050489 Bacteria 1781
182 nmdc:mga03n38_105990_c1 3300050490 Bacteria 1362
183 nmdc:mga00v17_6381_c1 3300050491 Bacteria 6257
184 nmdc:mga0k408_45316_c1 3300050493 Bacteria 2537
185 nmdc:mga0n895_757029_c1 3300050512 Bacteria 964
186 Ga0495601_0003848 3300053077 Bacteria 8639
187 Ga0495595_0008694 3300053084 Bacteria 4179
188 Ga0495619_0024215 3300053085 Bacteria 3893
189 Ga0500643_079733 3300053087 Bacteria 900
190 Ga0500555_002210 3300053103 Bacteria 5689
191 Ga0500642_0000919 3300053130 Bacteria 8565
192 Ga0500559_0007005 3300053136 Bacteria 5038
193 Ga0500568_0000297 3300053139 Bacteria 40273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100008759 Ga0070707_1000087592 212
2 3300005471 Ga0070698_100323761 Ga0070698_1003237612 212
3 3300005536 Ga0070697_100379313 Ga0070697_1003793131 212
4 3300025922 Ga0207646_10004860 Ga0207646_1000486010 212
5 3300021388 Ga0213875_10001355 Ga0213875_100013555 214
6 3300037853 Ga0436364_0266271 Ga0436364_0266271_149716_150438 214
7 3300005983 Ga0081540_1010646 Ga0081540_10106467 220
8 3300005539 Ga0068853_100190281 Ga0068853_1001902812 221
9 3300005937 Ga0081455_10179240 Ga0081455_101792402 221
10 3300039438 Ga0436360_0716703 Ga0436360_0716703_939_1676 222
11 3300049571 Ga0501034_0832858 Ga0501034_0832858_40_717 222
12 3300049586 Ga0501070_0398219 Ga0501070_0398219_385_1059 222
13 3300049593 Ga0501077_0363751 Ga0501077_0363751_49_723 222
14 3300049742 Ga0501080_0095141 Ga0501080_0095141_744_1418 222
15 3300049744 Ga0501083_0365008 Ga0501083_0365008_17_691 222
16 iso_pu_bacteria 2883291878 2883297018 222
17 iso_pu_bacteria 2929199973 2929205734 222
18 iso_pu_bacteria 8055909800 8055914706 222
19 3300039093 Ga0400489_41341 Ga0400489_41341_333_1010 223
20 3300005436 Ga0070713_100238922 Ga0070713_1002389222 224
21 3300005471 Ga0070698_100077810 Ga0070698_1000778103 224
22 3300014325 Ga0163163_10613282 Ga0163163_106132822 224
23 3300031249 Ga0265339_10007331 Ga0265339_100073317 224
24 3300031250 Ga0265331_10001221 Ga0265331_1000122111 224
25 3300031595 Ga0265313_10003987 Ga0265313_100039879 224
26 3300031727 Ga0316576_10015609 Ga0316576_100156093 224
27 3300035725 Ga0373947_0175937 Ga0373947_0175937_412_1086 224
28 3300036401 Ga0373937_1145128 Ga0373937_1145128_20_694 224
29 3300036712 Ga0316584_0197224 Ga0316584_0197224_439_1119 224
30 3300037068 Ga0373925_0113145 Ga0373925_0113145_830_1504 224
31 3300049742 Ga0501080_0253712 Ga0501080_0253712_472_1182 224
32 iso_pu_bacteria 2891088606 2891089004 224
33 3300035695 Ga0373927_0000019 Ga0373927_0000019_70110_70787 225
34 3300037068 Ga0373925_0003004 Ga0373925_0003004_6597_7274 225
35 iso_pu_bacteria 2894772417 2894773746 225
36 3300028794 Ga0307515_10006431 Ga0307515_1000643121 226
37 3300031456 Ga0307513_10444462 Ga0307513_104444622 226
38 3300037471 Ga0395905_0012123 Ga0395905_0012123_2750_3430 226
39 3300046460 Ga0495638_0034831 Ga0495638_0034831_1887_2567 226
40 3300049571 Ga0501034_0281301 Ga0501034_0281301_353_1033 226
41 3300049580 Ga0501046_0259228 Ga0501046_0259228_556_1236 226
42 3300049589 Ga0501073_0227932 Ga0501073_0227932_547_1248 226
43 3300049823 Ga0501044_0326838 Ga0501044_0326838_266_946 226
44 3300053136 Ga0500559_0007005 Ga0500559_0007005_499_1179 226
45 iso_pu_bacteria 2891048133 2891049244 226
46 iso_pu_bacteria 2995392953 2995396579 226
47 3300005293 Ga0065715_10365154 Ga0065715_103651541 227
48 3300005331 Ga0070670_100166453 Ga0070670_1001664533 227
49 3300005455 Ga0070663_100037449 Ga0070663_1000374494 227
50 3300005457 Ga0070662_100159735 Ga0070662_1001597352 227
51 3300005548 Ga0070665_100620902 Ga0070665_1006209022 227
52 3300010375 Ga0105239_10929553 Ga0105239_109295531 227
53 3300025925 Ga0207650_10077062 Ga0207650_100770624 227
54 3300025942 Ga0207689_10164503 Ga0207689_101645032 227
55 3300025972 Ga0207668_10280601 Ga0207668_102806012 227
56 3300026067 Ga0207678_10053091 Ga0207678_100530914 227
57 3300026118 Ga0207675_100244842 Ga0207675_1002448422 227
58 3300032002 Ga0307416_101687064 Ga0307416_1016870641 227
59 3300047472 Ga0495686_0212263 Ga0495686_0212263_403_1086 227
60 3300047472 Ga0495686_0217707 Ga0495686_0217707_88_771 227
61 3300048913 Ga0496110_0069099 Ga0496110_0069099_1860_2543 227
62 3300050493 nmdc:mga0k408_45316_c1 nmdc:mga0k408_45316_c1_1192_1875 227
63 3300050512 nmdc:mga0n895_757029_c1 nmdc:mga0n895_757029_c1_54_737 227
64 3300053103 Ga0500555_002210 Ga0500555_002210_145_828 227
65 3300009094 Ga0111539_10352018 Ga0111539_103520181 228
66 3300049569 Ga0501032_0107258 Ga0501032_0107258_927_1640 228
67 3300049570 Ga0501033_0062674 Ga0501033_0062674_1170_1883 228
68 3300049571 Ga0501034_0226807 Ga0501034_0226807_969_1661 228
69 3300049572 Ga0501036_0259458 Ga0501036_0259458_298_1011 228
70 3300049574 Ga0501038_0067451 Ga0501038_0067451_1452_2165 228
71 3300049579 Ga0501043_0042124 Ga0501043_0042124_2384_3097 228
72 3300049579 Ga0501043_0076709 Ga0501043_0076709_1501_2214 228
73 3300049581 Ga0501047_0045778 Ga0501047_0045778_2294_3007 228
74 3300049586 Ga0501070_0141633 Ga0501070_0141633_1198_1911 228
75 3300049822 Ga0501035_0008988 Ga0501035_0008988_2604_3317 228
76 3300049822 Ga0501035_0059844 Ga0501035_0059844_1296_2009 228
77 3300049823 Ga0501044_0045121 Ga0501044_0045121_805_1497 228
78 3300049824 Ga0501045_0222891 Ga0501045_0222891_393_1106 228
79 3300050489 nmdc:mga03683_47529_c1 nmdc:mga03683_47529_c1_480_1169 228
80 3300050490 nmdc:mga03n38_105990_c1 nmdc:mga03n38_105990_c1_303_992 228
81 3300053139 Ga0500568_0000297 Ga0500568_0000297_28761_29462 228
82 iso_pu_bacteria 2883577096 2883578169 228
83 3300005471 Ga0070698_100148000 Ga0070698_1001480002 229
84 3300021377 Ga0213874_10051358 Ga0213874_100513581 229
85 3300025922 Ga0207646_10056391 Ga0207646_100563912 229
86 3300039450 Ga0436363_1708711 Ga0436363_1708711_393_1115 229
87 3300049568 Ga0501031_0027858 Ga0501031_0027858_2302_2994 229
88 3300049571 Ga0501034_0192307 Ga0501034_0192307_27_722 229
89 3300049575 Ga0501039_0176429 Ga0501039_0176429_375_1070 229
90 3300021388 Ga0213875_10002269 Ga0213875_100022696 230
91 3300031665 Ga0316575_10092424 Ga0316575_100924241 230
92 3300037418 Ga0395900_0000056 Ga0395900_0000056_198859_199578 230
93 3300037466 Ga0395898_0000114 Ga0395898_0000114_198850_199569 230
94 3300037471 Ga0395905_0000053 Ga0395905_0000053_13500_14219 230
95 3300037853 Ga0436364_1151062 Ga0436364_1151062_260_985 230
96 3300037853 Ga0436364_1246752 Ga0436364_1246752_3718_4443 230
97 3300038443 Ga0395901_0000037 Ga0395901_0000037_198859_199578 230
98 3300039447 Ga0436361_0411095 Ga0436361_0411095_536_1294 230
99 3300039447 Ga0436361_0694211 Ga0436361_0694211_17_724 230
100 3300042876 Ga0451577_0672967 Ga0451577_0672967_156_875 230
101 3300045051 Ga0451576_0000400 Ga0451576_0000400_58242_58952 230
102 3300049570 Ga0501033_0025174 Ga0501033_0025174_3061_3762 230
103 3300049571 Ga0501034_0034146 Ga0501034_0034146_2034_2735 230
104 3300049574 Ga0501038_0077048 Ga0501038_0077048_906_1607 230
105 3300053130 Ga0500642_0000919 Ga0500642_0000919_2801_3514 230
106 iso_pu_bacteria 2524023250 2524611562 230
107 3300005983 Ga0081540_1013583 Ga0081540_10135833 231
108 3300025284 Ga0209130_1001489 Ga0209130_10014894 231
109 3300025302 Ga0207426_1000182 Ga0207426_100018253 231
110 3300039438 Ga0436360_0194301 Ga0436360_0194301_174_902 231
111 3300053087 Ga0500643_079733 Ga0500643_079733_12_740 231
112 iso_pu_bacteria 2597490356 2599102687 231
113 iso_pu_bacteria 2846952575 2846955408 231
114 iso_pu_bacteria 2848858292 2848861051 231
115 iso_pu_bacteria 2524023209 2524458442 232
116 iso_pu_bacteria 2599185352 2600193348 232
117 iso_pu_bacteria 2643221618 2644110171 232
118 iso_pu_bacteria 2643221626 2644150447 232
119 iso_pu_bacteria 2643221637 2644209477 232
120 iso_pu_bacteria 2643221653 2644299907 232
121 iso_pu_bacteria 2643221655 2644313051 232
122 iso_pu_bacteria 2643221659 2644336599 232
123 iso_pu_bacteria 2643221668 2644379480 232
124 iso_pu_bacteria 2643221675 2644419835 232
125 iso_pu_bacteria 2643221680 2644453192 232
126 iso_pu_bacteria 2643221698 2644546246 232
127 iso_pu_bacteria 2643221712 2644618781 232
128 iso_pu_bacteria 2643221718 2644653005 232
129 iso_pu_bacteria 2643221719 2644658134 232
130 iso_pu_bacteria 2643221723 2644677074 232
131 iso_pu_bacteria 2643221726 2644688780 232
132 iso_pu_bacteria 2657244999 2657682413 232
133 iso_pu_bacteria 2667528174 2671113498 232
134 iso_pu_bacteria 2775507266 2778173728 232
135 iso_pu_bacteria 2791355082 2792582237 232
136 iso_pu_bacteria 2802429268 2804753694 232
137 iso_pu_bacteria 2837651117 2837651267 232
138 iso_pu_bacteria 2838074704 2838078162 232
139 iso_pu_bacteria 2842298080 2842300301 232
140 iso_pu_bacteria 2842482326 2842484947 232
141 iso_pu_bacteria 2842509118 2842511733 232
142 iso_pu_bacteria 2852387548 2852391672 232
143 iso_pu_bacteria 2896384573 2896390191 232
144 iso_pu_bacteria 2920760137 2920760318 232
145 iso_pu_bacteria 2920822456 2920825951 232
146 iso_pu_bacteria 2929138655 2929141846 232
147 iso_pu_bacteria 2941499720 2941501372 232
148 iso_pu_bacteria 2989776772 2989780051 232
149 iso_pu_bacteria 3005416602 3005421645 232
150 iso_pu_bacteria 8005314921 8005319651 232
151 iso_pu_bacteria 8024486573 8024490824 232
152 iso_pu_bacteria 8049293176 8049296292 232
153 iso_pu_bacteria 8054558443 8054560213 232
154 3300025230 Ga0209563_104702 Ga0209563_1047022 233
155 3300049570 Ga0501033_0000120 Ga0501033_0000120_35877_36581 233
156 3300049822 Ga0501035_0000954 Ga0501035_0000954_20100_20804 233
157 3300005434 Ga0070709_10034626 Ga0070709_100346263 234
158 3300005434 Ga0070709_10150099 Ga0070709_101500991 234
159 3300005435 Ga0070714_100031514 Ga0070714_1000315145 234
160 3300005436 Ga0070713_100045514 Ga0070713_1000455145 234
161 3300005436 Ga0070713_100059337 Ga0070713_1000593372 234
162 3300005436 Ga0070713_100088601 Ga0070713_1000886012 234
163 3300005437 Ga0070710_10016997 Ga0070710_100169973 234
164 3300005437 Ga0070710_10018651 Ga0070710_100186512 234
165 3300005467 Ga0070706_100233502 Ga0070706_1002335021 234
166 3300005468 Ga0070707_100078445 Ga0070707_1000784452 234
167 3300005471 Ga0070698_100011216 Ga0070698_1000112162 234
168 3300006028 Ga0070717_10001017 Ga0070717_100010179 234
169 3300006028 Ga0070717_10110373 Ga0070717_101103731 234
170 3300006173 Ga0070716_100096991 Ga0070716_1000969912 234
171 3300006175 Ga0070712_100033733 Ga0070712_1000337333 234
172 3300006175 Ga0070712_100152591 Ga0070712_1001525912 234
173 3300007788 Ga0099795_10024914 Ga0099795_100249142 234
174 3300021388 Ga0213875_10091638 Ga0213875_100916381 234
175 3300025898 Ga0207692_10149247 Ga0207692_101492472 234
176 3300025910 Ga0207684_10169201 Ga0207684_101692012 234
177 3300025915 Ga0207693_10009304 Ga0207693_100093047 234
178 3300025915 Ga0207693_10018757 Ga0207693_100187572 234
179 3300025915 Ga0207693_10138036 Ga0207693_101380362 234
180 3300025916 Ga0207663_10256035 Ga0207663_102560352 234
181 3300025916 Ga0207663_10460709 Ga0207663_104607091 234
182 3300025922 Ga0207646_10047894 Ga0207646_100478943 234
183 3300025928 Ga0207700_10176595 Ga0207700_101765952 234
184 3300025929 Ga0207664_10164333 Ga0207664_101643333 234
185 3300025929 Ga0207664_10173652 Ga0207664_101736522 234
186 3300035119 Ga0373956_0140769 Ga0373956_0140769_232_969 234
187 3300035172 Ga0373955_0196220 Ga0373955_0196220_424_1161 234
188 3300035691 Ga0373931_0167874 Ga0373931_0167874_325_1062 234
189 3300036401 Ga0373937_0054724 Ga0373937_0054724_1359_2096 234
190 3300037853 Ga0436364_1374560 Ga0436364_1374560_1734_2471 234
191 3300039437 Ga0436365_1463115 Ga0436365_1463115_124_873 234
192 3300039447 Ga0436361_0305858 Ga0436361_0305858_360_1097 234
193 3300039447 Ga0436361_0634798 Ga0436361_0634798_255_992 234
194 3300039447 Ga0436361_0927133 Ga0436361_0927133_623_1399 234
195 3300039450 Ga0436363_1415252 Ga0436363_1415252_592_1329 234
196 3300039453 Ga0436362_1273185 Ga0436362_1273185_3204_3980 234
197 3300046499 Ga0495594_0101003 Ga0495594_0101003_305_1042 234
198 3300046514 Ga0495618_0010358 Ga0495618_0010358_4635_5372 234
199 3300046559 Ga0495667_0015475 Ga0495667_0015475_2666_3403 234
200 3300046642 Ga0495634_0286330 Ga0495634_0286330_100_837 234
201 3300046663 Ga0495635_0014113 Ga0495635_0014113_1905_2642 234
202 3300046678 Ga0495599_0059008 Ga0495599_0059008_401_1138 234
203 3300047322 Ga0495680_0103802 Ga0495680_0103802_18_755 234
204 3300053077 Ga0495601_0003848 Ga0495601_0003848_2367_3104 234
205 3300053084 Ga0495595_0008694 Ga0495595_0008694_2260_2997 234
206 3300053085 Ga0495619_0024215 Ga0495619_0024215_2198_2935 234
207 3300021361 Ga0213872_10151748 Ga0213872_101517481 235
208 3300002704 JGI25155J39150_1000010 JGI25155J39150_100001019 236
209 3300002705 JGI25156J39149_1000102 JGI25156J39149_100010218 236
210 3300002737 JGI25162J39368_1001061 JGI25162J39368_10010617 236
211 3300002738 JGI25154J39366_1000184 JGI25154J39366_100018449 236
212 3300002741 JGI25157J39369_1000009 JGI25157J39369_100000918 236
213 3300003214 JGI25165J46597_1001126 JGI25165J46597_100112612 236
214 3300003354 JGI25160J50197_1000235 JGI25160J50197_10002357 236
215 3300003374 JGI25161J50226_1000175 JGI25161J50226_10001757 236
216 3300004625 Ga0055543_1000226 Ga0055543_100022610 236
217 3300005262 Ga0065165_1001345 Ga0065165_10013459 236
218 3300005614 Ga0068856_100116818 Ga0068856_1001168182 236
219 3300010375 Ga0105239_10528153 Ga0105239_105281532 236
220 3300025206 Ga0209435_100009 Ga0209435_100009275 236
221 3300025208 Ga0209436_114705 Ga0209436_1147051 236
222 3300025233 Ga0209437_100057 Ga0209437_100057192 236
223 3300025246 Ga0209646_1000018 Ga0209646_1000018275 236
224 3300025250 Ga0209026_1000068 Ga0209026_100006819 236
225 3300025256 Ga0209759_1000007 Ga0209759_1000007275 236
226 3300025261 Ga0209233_1000134 Ga0209233_1000134192 236
227 3300025284 Ga0209130_1000132 Ga0209130_100013210 236
228 3300025294 Ga0209025_1060904 Ga0209025_10609042 236
229 3300025299 Ga0209256_1002945 Ga0209256_10029457 236
230 3300025302 Ga0207426_1000246 Ga0207426_100024610 236
231 3300025925 Ga0207650_10000151 Ga0207650_100001512 236
232 3300026078 Ga0207702_10091036 Ga0207702_100910364 236
233 3300047472 Ga0495686_0090632 Ga0495686_0090632_379_1089 236
234 3300048920 Ga0496117_0041019 Ga0496117_0041019_2569_3279 236
235 3300048924 Ga0496121_0000034 Ga0496121_0000034_242655_243368 236
236 3300048925 Ga0496122_0107399 Ga0496122_0107399_924_1694 236
237 3300048926 Ga0496123_0029451 Ga0496123_0029451_2812_3582 236
238 3300048927 Ga0496124_0005858 Ga0496124_0005858_1757_2470 236
239 3300048927 Ga0496124_0061010 Ga0496124_0061010_966_1676 236
240 3300048927 Ga0496124_0191646 Ga0496124_0191646_33_746 236
241 3300048928 Ga0496125_0000030 Ga0496125_0000030_131094_131864 236
242 3300049776 Ga0501280_002406 Ga0501280_002406_816_1529 236
243 3300049824 Ga0501045_0355881 Ga0501045_0355881_303_1019 236
244 3300050491 nmdc:mga00v17_6381_c1 nmdc:mga00v17_6381_c1_2878_3648 236
245 iso_pu_bacteria 8046767195 8046767205 236
246 iso_pu_bacteria 8057575449 8057581591 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

170

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9659 3 226
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.965 5 224
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9648 3 225
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9619 5 224
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9574 3 224
ID Description Score Start End Superfamily
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9734 32 224 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9734 1 221 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9729 3 224 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9703 2 221 3.40.50.300
af_Q4CYV3_7_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9696 3 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A381QZ73-F1-model_v4 ABC transporter domain-containing protein 0.9862 2 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A1Y5SKK8-F1-model_v4 Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-) 0.985 9 223 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-R9PL83-F1-model_v4 ABC transporter ATP-binding protein YvcR 0.9849 32 223 GO:0005524
GO:0016887
AF-A0A2D5TSH3-F1-model_v4 ABC transporter 0.9813 3 224 GO:0005524
GO:0016887
AF-A0A087DEU0-F1-model_v4 ATP-binding protein of ABC transporter system (EC 3.6.3.36) 0.9802 2 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
92.45 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map