F358158

General Info

Members Datasets Scaffolds Average Seq Length
246 165 243 122

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10085758|Ga0157370_100857584
Length 137
Sequence LINFEKCIFKNLLMQNIKYTTIDEYISSFPKNIQKMLGDVRSVIRKVAPDSVEAISYGIPTFKLNGNLVHFAAFKNHIGFYPAPNGIEEFEKELSVYKQGKGSVQFPVDKPLPLDLISKIVKYRVKKNSEKNSTRKK

Samples

Sample ID Description Type Environment
1 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
2 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
3 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
103 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
104 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
105 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
111 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
112 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
113 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
114 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
115 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
145 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
158 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
159 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
160 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.81
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.28
Nodule 0.41
Rhizoplane 1.22
Rhizosphere 89.02
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10198596 3300003316 Unclassified 1268
2 rootH2_10182324 3300003320 Bacteria 5368
3 rootL2_10044949 3300003322 Bacteria 16676
4 JGI25160J50197_1029328 3300003354 Unclassified 1457
5 Ga0065712_10021797 3300005290 Bacteria 1993
6 Ga0065715_10614083 3300005293 Bacteria 699
7 Ga0065715_11153763 3300005293 Bacteria 508
8 Ga0065707_10174467 3300005295 Bacteria 1461
9 Ga0070670_100361356 3300005331 Bacteria 1277
10 Ga0070670_100474056 3300005331 Bacteria 1111
11 Ga0068869_100043397 3300005334 Bacteria 3229
12 Ga0070666_10771830 3300005335 Bacteria 707
13 Ga0070660_100025603 3300005339 Bacteria 4386
14 Ga0070691_10299263 3300005341 Bacteria 878
15 Ga0070669_100005415 3300005353 Bacteria 9203
16 Ga0070675_100028173 3300005354 Bacteria 4520
17 Ga0070675_100049324 3300005354 Bacteria 3455
18 Ga0070671_100109644 3300005355 Bacteria 2318
19 Ga0070674_100025557 3300005356 Bacteria 3846
20 Ga0070674_100529773 3300005356 Bacteria 985
21 Ga0070673_100211811 3300005364 Bacteria 1674
22 Ga0070659_100106446 3300005366 Bacteria 2261
23 Ga0070701_10072989 3300005438 Bacteria 1839
24 Ga0070700_100006183 3300005441 Bacteria 6381
25 Ga0070694_100387043 3300005444 Bacteria 1092
26 Ga0070708_100046678 3300005445 Bacteria 3822
27 Ga0070678_100201409 3300005456 Bacteria 1643
28 Ga0070681_10415497 3300005458 Unclassified 1257
29 Ga0068867_100054699 3300005459 Bacteria 2949
30 Ga0070706_100174452 3300005467 Bacteria 2007
31 Ga0070698_100533832 3300005471 Bacteria 1112
32 Ga0070699_100079978 3300005518 Bacteria 2848
33 Ga0070699_100194054 3300005518 Unclassified 1804
34 Ga0070679_100012043 3300005530 Bacteria 8255
35 Ga0070697_100140718 3300005536 Bacteria 2029
36 Ga0068853_100123720 3300005539 Bacteria 2310
37 Ga0070686_100076391 3300005544 Bacteria 2205
38 Ga0070686_100154323 3300005544 Bacteria 1611
39 Ga0070696_100078637 3300005546 Archaea 2332
40 Ga0070696_100517315 3300005546 Unclassified 952
41 Ga0068855_100064737 3300005563 Bacteria 4263
42 Ga0068857_100191890 3300005577 Unclassified 1861
43 Ga0070702_100113642 3300005615 Bacteria 1683
44 Ga0070702_100609613 3300005615 Bacteria 820
45 Ga0068859_101884165 3300005617 Bacteria 660
46 Ga0068870_11207905 3300005840 Bacteria 548
47 Ga0068858_100143559 3300005842 Bacteria 2242
48 Ga0075366_10260899 3300006195 Bacteria 1057
49 Ga0068865_101105628 3300006881 Bacteria 698
50 Ga0097620_101883897 3300006931 Bacteria 660
51 Ga0075435_100492732 3300007076 Bacteria 1059
52 Ga0114129_11288014 3300009147 Unclassified 906
53 Ga0105241_10441556 3300009174 Bacteria 1149
54 Ga0105248_10928700 3300009177 Bacteria 983
55 Ga0105237_10792782 3300009545 Bacteria 954
56 Ga0105249_10018339 3300009553 Bacteria 6223
57 Ga0105239_10016636 3300010375 Bacteria 8130
58 Ga0105239_10521327 3300010375 Bacteria 1352
59 Ga0105239_13182999 3300010375 Unclassified 534
60 Ga0157373_10009272 3300013100 Bacteria 7276
61 Ga0157370_10085758 3300013104 Bacteria 2959
62 Ga0157378_10122853 3300013297 Bacteria 2395
63 Ga0157372_10081062 3300013307 Bacteria 3673
64 Ga0157372_10342997 3300013307 Bacteria 1740
65 Ga0157380_10168153 3300014326 Bacteria 1913
66 Ga0157379_10295536 3300014968 Bacteria 1476
67 Ga0163161_10072041 3300017792 Bacteria 2530
68 Ga0163161_12060835 3300017792 Bacteria 507
69 Ga0209436_100347 3300025208 Bacteria 20952
70 Ga0209130_1001798 3300025284 Bacteria 12573
71 Ga0207426_1000216 3300025302 Bacteria 136337
72 Ga0207653_10039023 3300025885 Unclassified 1553
73 Ga0207682_10003675 3300025893 Bacteria 6613
74 Ga0207680_10183643 3300025903 Bacteria 1416
75 Ga0207643_10439722 3300025908 Bacteria 829
76 Ga0207684_10181437 3300025910 Unclassified 1815
77 Ga0207707_10212294 3300025912 Bacteria 1686
78 Ga0207693_10448446 3300025915 Unclassified 1008
79 Ga0207660_10043435 3300025917 Bacteria 3158
80 Ga0207662_10030162 3300025918 Bacteria 3146
81 Ga0207657_10019446 3300025919 Bacteria 6449
82 Ga0207657_10036663 3300025919 Bacteria 4387
83 Ga0207652_10029357 3300025921 Bacteria 4597
84 Ga0207646_10059379 3300025922 Bacteria 3416
85 Ga0207681_10020142 3300025923 Bacteria 4223
86 Ga0207681_10454139 3300025923 Bacteria 1043
87 Ga0207650_10279229 3300025925 Bacteria 1360
88 Ga0207690_10215926 3300025932 Unclassified 1465
89 Ga0207706_10075704 3300025933 Bacteria 2960
90 Ga0207669_10844045 3300025937 Bacteria 762
91 Ga0207691_10084490 3300025940 Bacteria 2849
92 Ga0207667_10145305 3300025949 Bacteria 2441
93 Ga0207651_10212999 3300025960 Bacteria 1557
94 Ga0207712_10191732 3300025961 Unclassified 1614
95 Ga0207703_10129057 3300026035 Bacteria 2181
96 Ga0207639_10168725 3300026041 Unclassified 1851
97 Ga0207708_10014422 3300026075 Bacteria 5915
98 Ga0207708_10168069 3300026075 Bacteria 1735
99 Ga0207708_10186673 3300026075 Bacteria 1648
100 Ga0207648_10290851 3300026089 Bacteria 1463
101 Ga0207648_11156809 3300026089 Bacteria 726
102 Ga0207674_10105877 3300026116 Unclassified 2790
103 Ga0207675_100248088 3300026118 Bacteria 1722
104 Ga0207675_100251385 3300026118 Bacteria 1711
105 Ga0268265_10196670 3300028380 Bacteria 1745
106 Ga0265330_10000792 3300031235 Bacteria 19927
107 Ga0265329_10000329 3300031242 Bacteria 25180
108 Ga0265316_10000241 3300031344 Bacteria 63053
109 Ga0307509_10267871 3300031507 Bacteria 1478
110 Ga0316575_10014742 3300031665 Bacteria 2939
111 Ga0316579_10000744 3300031691 Bacteria 11158
112 Ga0316579_10022038 3300031691 Bacteria 2845
113 Ga0265342_10001159 3300031712 Bacteria 25153
114 Ga0316576_10000944 3300031727 Bacteria 14852
115 Ga0316576_10061776 3300031727 Bacteria 2746
116 Ga0316576_10097034 3300031727 Bacteria 2200
117 Ga0316576_10585658 3300031727 Unclassified 815
118 Ga0316576_10648657 3300031727 Unclassified 768
119 Ga0316576_10676026 3300031727 Bacteria 749
120 Ga0316578_10009574 3300031728 Bacteria 4985
121 Ga0316578_10028231 3300031728 Bacteria 3176
122 Ga0316577_10066384 3300031733 Archaea 2014
123 Ga0316577_10073530 3300031733 Bacteria 1908
124 Ga0316577_10085833 3300031733 Unclassified 1762
125 Ga0307414_10248838 3300032004 Bacteria 1476
126 Ga0316583_10013384 3300032133 Bacteria 2960
127 Ga0316583_10028873 3300032133 Bacteria 1978
128 Ga0316585_10010486 3300032137 Bacteria 2719
129 Ga0316585_10013857 3300032137 Bacteria 2403
130 Ga0316585_10052874 3300032137 Bacteria 1305
131 Ga0316580_10011019 3300032139 Bacteria 2739
132 Ga0316580_10016820 3300032139 Bacteria 2245
133 Ga0316580_10024682 3300032139 Unclassified 1858
134 Ga0316593_10039720 3300032168 Bacteria 1562
135 Ga0316596_1048624 3300033541 Bacteria 1121
136 Ga0316574_0001275 3300035398 Bacteria 11765
137 Ga0316574_0033087 3300035398 Bacteria 3146
138 Ga0316574_0061549 3300035398 Bacteria 2357
139 Ga0316574_0384387 3300035398 Bacteria 885
140 Ga0316582_0042321 3300036647 Unclassified 2852
141 Ga0316582_0044573 3300036647 Bacteria 2789
142 Ga0316582_0107905 3300036647 Bacteria 1850
143 Ga0316582_0274123 3300036647 Bacteria 1157
144 Ga0316582_0385749 3300036647 Bacteria 965
145 Ga0316584_0001392 3300036712 Bacteria 14423
146 Ga0316584_0006095 3300036712 Bacteria 8151
147 Ga0316584_0299110 3300036712 Bacteria 1165
148 Ga0316581_0029201 3300037588 Bacteria 1655
149 Ga0451798_0029318 3300041458 Bacteria 781
150 Ga0451807_2692454 3300041486 Bacteria 917
151 Ga0451833_1324574 3300041491 Bacteria 559
152 Ga0451849_1422030 3300041505 Bacteria 1022
153 Ga0451851_1341159 3300041507 Unclassified 674
154 Ga0451853_0839736 3300041512 Unclassified 1131
155 Ga0439460_0227831 3300042461 Archaea 640
156 Ga0451577_0000022 3300042876 Bacteria 437063
157 Ga0451577_0000131 3300042876 Bacteria 167486
158 Ga0451577_0004403 3300042876 Bacteria 14887
159 Ga0451577_0127152 3300042876 Bacteria 2284
160 Ga0451577_1055943 3300042876 Bacteria 728
161 Ga0453683_0000991 3300044673 Bacteria 26762
162 Ga0453683_0003239 3300044673 Bacteria 12100
163 Ga0453683_0083117 3300044673 Bacteria 2006
164 Ga0453684_0000012 3300044712 Bacteria 1062512
165 Ga0453684_0000127 3300044712 Bacteria 336026
166 Ga0453684_0000464 3300044712 Bacteria 161638
167 Ga0453684_0000501 3300044712 Bacteria 153475
168 Ga0453684_0001416 3300044712 Bacteria 69082
169 Ga0453684_0017934 3300044712 Bacteria 10912
170 Ga0453684_0025002 3300044712 Bacteria 8691
171 Ga0453684_0082455 3300044712 Bacteria 4006
172 Ga0453684_0104931 3300044712 Bacteria 3448
173 Ga0453684_0111765 3300044712 Bacteria 3318
174 Ga0453684_0150906 3300044712 Bacteria 2762
175 Ga0453684_0221038 3300044712 Bacteria 2194
176 Ga0453684_0334837 3300044712 Bacteria 1711
177 Ga0453684_0515652 3300044712 Bacteria 1322
178 Ga0453684_0979835 3300044712 Bacteria 900
179 Ga0453684_1242580 3300044712 Unclassified 780
180 Ga0451576_0000027 3300045051 Bacteria 422925
181 Ga0451576_0000044 3300045051 Bacteria 334467
182 Ga0451576_0000054 3300045051 Bacteria 308162
183 Ga0451576_0000198 3300045051 Bacteria 152129
184 Ga0451576_0016839 3300045051 Bacteria 8059
185 Ga0451576_0233324 3300045051 Unclassified 1922
186 Ga0451576_0582085 3300045051 Bacteria 1176
187 Ga0451576_0787277 3300045051 Unclassified 999
188 Ga0496114_0028491 3300048917 Bacteria 4583
189 Ga0496126_0124874 3300048929 Bacteria 2229
190 Ga0501031_0009813 3300049568 Bacteria 6233
191 Ga0501033_0031184 3300049570 Bacteria 4007
192 Ga0501036_0021497 3300049572 Archaea 5425
193 Ga0501036_1348029 3300049572 Bacteria 579
194 Ga0501037_0013821 3300049573 Archaea 5948
195 Ga0501038_0043247 3300049574 Bacteria 3918
196 Ga0501038_0359026 3300049574 Bacteria 1133
197 Ga0501039_0012393 3300049575 Archaea 6508
198 Ga0501040_0018265 3300049576 Archaea 4655
199 Ga0501041_0001153 3300049577 Archaea 14462
200 Ga0501042_0091512 3300049578 Bacteria 2183
201 Ga0501043_0144986 3300049579 Bacteria 1859
202 Ga0501046_0006712 3300049580 Archaea 10163
203 Ga0501048_0004710 3300049582 Archaea 10389
204 Ga0501070_0035831 3300049586 Bacteria 4144
205 Ga0501071_0003585 3300049587 Archaea 9721
206 Ga0501072_0006750 3300049588 Archaea 8717
207 Ga0501073_0388463 3300049589 Bacteria 964
208 Ga0501074_0011827 3300049590 Bacteria 6344
209 Ga0501074_0365738 3300049590 Bacteria 1023
210 Ga0501075_0002001 3300049591 Archaea 13465
211 Ga0501075_0111781 3300049591 Bacteria 2077
212 Ga0501076_0030534 3300049592 Archaea 4197
213 Ga0501077_0008629 3300049593 Bacteria 6316
214 Ga0501202_105877 3300049652 Bacteria 691
215 Ga0501243_064379 3300049675 Bacteria 686
216 Ga0501225_0084873 3300049705 Bacteria 912
217 Ga0501079_0026045 3300049741 Bacteria 4485
218 Ga0501079_0048768 3300049741 Bacteria 3268
219 Ga0501080_0028714 3300049742 Archaea 5178
220 Ga0501080_0169787 3300049742 Bacteria 2012
221 Ga0501081_0002952 3300049743 Archaea 10784
222 Ga0501081_0078647 3300049743 Bacteria 2306
223 Ga0501272_044160 3300049769 Bacteria 603
224 Ga0501035_0102619 3300049822 Archaea 2509
225 Ga0501035_0706322 3300049822 Bacteria 813
226 Ga0501044_0038366 3300049823 Archaea 5003
227 Ga0501045_0000487 3300049824 Archaea 24554
228 Ga0501045_0457492 3300049824 Bacteria 948
229 nmdc:mga05p37_1334506_c1 3300050507 Unclassified 728
230 nmdc:mga0rr50_752880_c1 3300050513 Unclassified 831
231 Ga0500646_0003203 3300053090 Bacteria 4201
232 Ga0500583_0000578 3300053092 Bacteria 11027
233 Ga0500641_0001847 3300053096 Bacteria 7513
234 Ga0500561_0064376 3300053137 Bacteria 1035
235 Ga0500589_194995 3300053147 Unclassified 783
236 Ga0500622_0007263 3300053156 Bacteria 6308
237 Ga0500622_0079096 3300053156 Bacteria 1649
238 Ga0500611_032172 3300053727 Bacteria 1095
239 Ga0501084_0015817 3300054114 Bacteria 6257
240 Ga0501084_0612894 3300054114 Bacteria 919
241 Ga0501082_0004523 3300060353 Archaea 12144
242 Ga0530510_0001834 3300061734 Archaea 14511
243 Ga0530510_0317592 3300061734 Bacteria 1167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100005415 Ga0070669_1000054155 106
2 3300005438 Ga0070701_10072989 Ga0070701_100729893 106
3 3300005441 Ga0070700_100006183 Ga0070700_1000061833 106
4 3300005546 Ga0070696_100517315 Ga0070696_1005173152 106
5 3300009553 Ga0105249_10018339 Ga0105249_100183393 106
6 3300010375 Ga0105239_13182999 Ga0105239_131829991 106
7 3300025923 Ga0207681_10020142 Ga0207681_100201427 106
8 3300025961 Ga0207712_10191732 Ga0207712_101917322 106
9 3300026075 Ga0207708_10014422 Ga0207708_100144228 106
10 3300026118 Ga0207675_100251385 Ga0207675_1002513853 106
11 3300044712 Ga0453684_0001416 Ga0453684_0001416_68531_68917 108
12 3300045051 Ga0451576_0016839 Ga0451576_0016839_6484_6828 110
13 3300031665 Ga0316575_10014742 Ga0316575_100147421 111
14 3300031691 Ga0316579_10022038 Ga0316579_100220382 111
15 3300031727 Ga0316576_10676026 Ga0316576_106760261 111
16 3300032133 Ga0316583_10028873 Ga0316583_100288732 111
17 3300032137 Ga0316585_10013857 Ga0316585_100138573 111
18 3300035398 Ga0316574_0033087 Ga0316574_0033087_350_712 111
19 3300036712 Ga0316584_0299110 Ga0316584_0299110_497_859 111
20 3300005518 Ga0070699_100194054 Ga0070699_1001940541 112
21 3300005546 Ga0070696_100078637 Ga0070696_1000786372 112
22 3300005615 Ga0070702_100113642 Ga0070702_1001136422 112
23 3300017792 Ga0163161_12060835 Ga0163161_120608352 112
24 3300026075 Ga0207708_10168069 Ga0207708_101680692 112
25 3300031727 Ga0316576_10585658 Ga0316576_105856582 112
26 3300044712 Ga0453684_0000464 Ga0453684_0000464_15909_16289 112
27 3300044673 Ga0453683_0083117 Ga0453683_0083117_1013_1363 113
28 3300045051 Ga0451576_0000027 Ga0451576_0000027_259054_259404 113
29 iso_pu_bacteria 2910245624 2910247191 113
30 3300031235 Ga0265330_10000792 Ga0265330_1000079210 115
31 3300031242 Ga0265329_10000329 Ga0265329_1000032915 115
32 3300031344 Ga0265316_10000241 Ga0265316_1000024110 115
33 3300031712 Ga0265342_10001159 Ga0265342_1000115910 115
34 3300036647 Ga0316582_0385749 Ga0316582_0385749_67_423 115
35 3300044712 Ga0453684_0017934 Ga0453684_0017934_6107_6463 115
36 3300045051 Ga0451576_0000054 Ga0451576_0000054_50526_50879 115
37 3300005293 Ga0065715_11153763 Ga0065715_111537631 116
38 3300005544 Ga0070686_100154323 Ga0070686_1001543231 116
39 3300014968 Ga0157379_10295536 Ga0157379_102955362 116
40 3300031691 Ga0316579_10000744 Ga0316579_100007444 116
41 3300031727 Ga0316576_10000944 Ga0316576_100009448 116
42 3300031727 Ga0316576_10061776 Ga0316576_100617763 116
43 3300031727 Ga0316576_10097034 Ga0316576_100970344 116
44 3300031728 Ga0316578_10009574 Ga0316578_100095744 116
45 3300031728 Ga0316578_10028231 Ga0316578_100282313 116
46 3300031733 Ga0316577_10066384 Ga0316577_100663841 116
47 3300031733 Ga0316577_10073530 Ga0316577_100735304 116
48 3300032004 Ga0307414_10248838 Ga0307414_102488382 116
49 3300032133 Ga0316583_10013384 Ga0316583_100133841 116
50 3300032137 Ga0316585_10010486 Ga0316585_100104861 116
51 3300032137 Ga0316585_10052874 Ga0316585_100528742 116
52 3300032139 Ga0316580_10011019 Ga0316580_100110192 116
53 3300032139 Ga0316580_10016820 Ga0316580_100168203 116
54 3300032139 Ga0316580_10024682 Ga0316580_100246821 116
55 3300032168 Ga0316593_10039720 Ga0316593_100397202 116
56 3300033541 Ga0316596_1048624 Ga0316596_10486241 116
57 3300035398 Ga0316574_0001275 Ga0316574_0001275_2367_2729 116
58 3300035398 Ga0316574_0061549 Ga0316574_0061549_17_379 116
59 3300036647 Ga0316582_0042321 Ga0316582_0042321_2088_2450 116
60 3300036647 Ga0316582_0107905 Ga0316582_0107905_1206_1568 116
61 3300036647 Ga0316582_0274123 Ga0316582_0274123_622_984 116
62 3300036712 Ga0316584_0001392 Ga0316584_0001392_7449_7811 116
63 3300036712 Ga0316584_0006095 Ga0316584_0006095_1793_2155 116
64 3300037588 Ga0316581_0029201 Ga0316581_0029201_184_546 116
65 3300042461 Ga0439460_0227831 Ga0439460_0227831_206_571 116
66 3300042876 Ga0451577_0127152 Ga0451577_0127152_33_395 116
67 3300049568 Ga0501031_0009813 Ga0501031_0009813_591_956 116
68 3300049570 Ga0501033_0031184 Ga0501033_0031184_2905_3270 116
69 3300049572 Ga0501036_0021497 Ga0501036_0021497_2732_3097 116
70 3300049573 Ga0501037_0013821 Ga0501037_0013821_3176_3541 116
71 3300049574 Ga0501038_0043247 Ga0501038_0043247_2897_3262 116
72 3300049575 Ga0501039_0012393 Ga0501039_0012393_3044_3409 116
73 3300049576 Ga0501040_0018265 Ga0501040_0018265_1244_1609 116
74 3300049577 Ga0501041_0001153 Ga0501041_0001153_5292_5657 116
75 3300049578 Ga0501042_0091512 Ga0501042_0091512_840_1205 116
76 3300049579 Ga0501043_0144986 Ga0501043_0144986_720_1085 116
77 3300049580 Ga0501046_0006712 Ga0501046_0006712_2546_2911 116
78 3300049582 Ga0501048_0004710 Ga0501048_0004710_6951_7316 116
79 3300049586 Ga0501070_0035831 Ga0501070_0035831_2943_3308 116
80 3300049587 Ga0501071_0003585 Ga0501071_0003585_5865_6230 116
81 3300049588 Ga0501072_0006750 Ga0501072_0006750_5297_5662 116
82 3300049589 Ga0501073_0388463 Ga0501073_0388463_23_388 116
83 3300049590 Ga0501074_0011827 Ga0501074_0011827_706_1071 116
84 3300049591 Ga0501075_0002001 Ga0501075_0002001_1200_1565 116
85 3300049592 Ga0501076_0030534 Ga0501076_0030534_3066_3431 116
86 3300049593 Ga0501077_0008629 Ga0501077_0008629_5249_5614 116
87 3300049705 Ga0501225_0084873 Ga0501225_0084873_64_429 116
88 3300049741 Ga0501079_0026045 Ga0501079_0026045_850_1215 116
89 3300049742 Ga0501080_0028714 Ga0501080_0028714_3667_4032 116
90 3300049743 Ga0501081_0002952 Ga0501081_0002952_8001_8366 116
91 3300049822 Ga0501035_0102619 Ga0501035_0102619_1245_1610 116
92 3300049823 Ga0501044_0038366 Ga0501044_0038366_2286_2651 116
93 3300049824 Ga0501045_0000487 Ga0501045_0000487_9595_9960 116
94 3300053156 Ga0500622_0079096 Ga0500622_0079096_1201_1557 116
95 3300054114 Ga0501084_0015817 Ga0501084_0015817_5297_5662 116
96 3300060353 Ga0501082_0004523 Ga0501082_0004523_6386_6751 116
97 3300061734 Ga0530510_0001834 Ga0530510_0001834_2264_2629 116
98 3300005445 Ga0070708_100046678 Ga0070708_1000466784 117
99 3300005467 Ga0070706_100174452 Ga0070706_1001744521 117
100 3300005471 Ga0070698_100533832 Ga0070698_1005338322 117
101 3300005518 Ga0070699_100079978 Ga0070699_1000799782 117
102 3300005536 Ga0070697_100140718 Ga0070697_1001407181 117
103 3300006195 Ga0075366_10260899 Ga0075366_102608992 117
104 3300007076 Ga0075435_100492732 Ga0075435_1004927322 117
105 3300025885 Ga0207653_10039023 Ga0207653_100390232 117
106 3300025910 Ga0207684_10181437 Ga0207684_101814372 117
107 3300025915 Ga0207693_10448446 Ga0207693_104484461 117
108 3300025922 Ga0207646_10059379 Ga0207646_100593792 117
109 3300041458 Ga0451798_0029318 Ga0451798_0029318_384_758 117
110 3300041486 Ga0451807_2692454 Ga0451807_2692454_375_737 117
111 3300041491 Ga0451833_1324574 Ga0451833_1324574_79_441 117
112 3300041505 Ga0451849_1422030 Ga0451849_1422030_445_807 117
113 3300041507 Ga0451851_1341159 Ga0451851_1341159_235_609 117
114 3300044712 Ga0453684_0082455 Ga0453684_0082455_3583_3951 117
115 3300044712 Ga0453684_0150906 Ga0453684_0150906_842_1210 117
116 3300044712 Ga0453684_0515652 Ga0453684_0515652_668_1033 117
117 3300049769 Ga0501272_044160 Ga0501272_044160_83_445 117
118 3300050513 nmdc:mga0rr50_752880_c1 nmdc:mga0rr50_752880_c1_249_611 117
119 3300053090 Ga0500646_0003203 Ga0500646_0003203_3503_3865 117
120 3300053092 Ga0500583_0000578 Ga0500583_0000578_7522_7884 117
121 3300053137 Ga0500561_0064376 Ga0500561_0064376_628_990 117
122 3300053147 Ga0500589_194995 Ga0500589_194995_236_598 117
123 3300053156 Ga0500622_0007263 Ga0500622_0007263_997_1359 117
124 3300053727 Ga0500611_032172 Ga0500611_032172_85_447 117
125 iso_pu_bacteria 2915597211 2915599992 117
126 iso_pu_bacteria 2929183550 2929185161 117
127 3300005334 Ga0068869_100043397 Ga0068869_1000433974 118
128 3300005335 Ga0070666_10771830 Ga0070666_107718302 118
129 3300005355 Ga0070671_100109644 Ga0070671_1001096443 118
130 3300005356 Ga0070674_100529773 Ga0070674_1005297732 118
131 3300005459 Ga0068867_100054699 Ga0068867_1000546992 118
132 3300005544 Ga0070686_100076391 Ga0070686_1000763913 118
133 3300005615 Ga0070702_100609613 Ga0070702_1006096132 118
134 3300005617 Ga0068859_101884165 Ga0068859_1018841651 118
135 3300005842 Ga0068858_100143559 Ga0068858_1001435593 118
136 3300006931 Ga0097620_101883897 Ga0097620_1018838971 118
137 3300009174 Ga0105241_10441556 Ga0105241_104415562 118
138 3300009177 Ga0105248_10928700 Ga0105248_109287002 118
139 3300017792 Ga0163161_10072041 Ga0163161_100720414 118
140 3300025903 Ga0207680_10183643 Ga0207680_101836432 118
141 3300025918 Ga0207662_10030162 Ga0207662_100301622 118
142 3300025923 Ga0207681_10454139 Ga0207681_104541392 118
143 3300025933 Ga0207706_10075704 Ga0207706_100757044 118
144 3300025937 Ga0207669_10844045 Ga0207669_108440452 118
145 3300026035 Ga0207703_10129057 Ga0207703_101290573 118
146 3300026075 Ga0207708_10186673 Ga0207708_101866732 118
147 3300026089 Ga0207648_10290851 Ga0207648_102908512 118
148 3300035398 Ga0316574_0384387 Ga0316574_0384387_21_392 118
149 3300042876 Ga0451577_0000131 Ga0451577_0000131_34763_35131 118
150 3300042876 Ga0451577_0004403 Ga0451577_0004403_3206_3580 118
151 3300044673 Ga0453683_0003239 Ga0453683_0003239_8791_9171 118
152 3300044712 Ga0453684_0000012 Ga0453684_0000012_738015_738389 118
153 3300044712 Ga0453684_0000127 Ga0453684_0000127_34763_35131 118
154 3300044712 Ga0453684_0221038 Ga0453684_0221038_962_1348 118
155 3300044712 Ga0453684_0979835 Ga0453684_0979835_139_501 118
156 3300045051 Ga0451576_0000198 Ga0451576_0000198_116999_117367 118
157 3300045051 Ga0451576_0233324 Ga0451576_0233324_168_539 118
158 3300045051 Ga0451576_0582085 Ga0451576_0582085_777_1157 118
159 3300003354 JGI25160J50197_1029328 JGI25160J50197_10293281 119
160 3300005295 Ga0065707_10174467 Ga0065707_101744673 119
161 3300005339 Ga0070660_100025603 Ga0070660_1000256034 119
162 3300005341 Ga0070691_10299263 Ga0070691_102992631 119
163 3300005356 Ga0070674_100025557 Ga0070674_1000255577 119
164 3300005366 Ga0070659_100106446 Ga0070659_1001064462 119
165 3300005444 Ga0070694_100387043 Ga0070694_1003870432 119
166 3300005456 Ga0070678_100201409 Ga0070678_1002014092 119
167 3300005458 Ga0070681_10415497 Ga0070681_104154972 119
168 3300005530 Ga0070679_100012043 Ga0070679_1000120436 119
169 3300005539 Ga0068853_100123720 Ga0068853_1001237203 119
170 3300005563 Ga0068855_100064737 Ga0068855_1000647373 119
171 3300005577 Ga0068857_100191890 Ga0068857_1001918903 119
172 3300009545 Ga0105237_10792782 Ga0105237_107927822 119
173 3300010375 Ga0105239_10521327 Ga0105239_105213273 119
174 3300013100 Ga0157373_10009272 Ga0157373_100092722 119
175 3300013104 Ga0157370_10085758 Ga0157370_100857584 119
176 3300013297 Ga0157378_10122853 Ga0157378_101228533 119
177 3300013307 Ga0157372_10081062 Ga0157372_100810625 119
178 3300013307 Ga0157372_10342997 Ga0157372_103429972 119
179 3300025208 Ga0209436_100347 Ga0209436_1003475 119
180 3300025284 Ga0209130_1001798 Ga0209130_100179816 119
181 3300025302 Ga0207426_1000216 Ga0207426_100021689 119
182 3300025912 Ga0207707_10212294 Ga0207707_102122943 119
183 3300025917 Ga0207660_10043435 Ga0207660_100434354 119
184 3300025919 Ga0207657_10019446 Ga0207657_100194462 119
185 3300025919 Ga0207657_10036663 Ga0207657_100366634 119
186 3300025921 Ga0207652_10029357 Ga0207652_100293576 119
187 3300025932 Ga0207690_10215926 Ga0207690_102159262 119
188 3300025949 Ga0207667_10145305 Ga0207667_101453054 119
189 3300026041 Ga0207639_10168725 Ga0207639_101687252 119
190 3300026116 Ga0207674_10105877 Ga0207674_101058774 119
191 3300031727 Ga0316576_10648657 Ga0316576_106486572 119
192 3300031733 Ga0316577_10085833 Ga0316577_100858332 119
193 3300036647 Ga0316582_0044573 Ga0316582_0044573_663_1034 119
194 3300042876 Ga0451577_1055943 Ga0451577_1055943_167_544 119
195 3300044712 Ga0453684_0104931 Ga0453684_0104931_1331_1705 119
196 3300044712 Ga0453684_0111765 Ga0453684_0111765_2863_3240 119
197 3300044712 Ga0453684_0334837 Ga0453684_0334837_986_1363 119
198 3300045051 Ga0451576_0787277 Ga0451576_0787277_440_811 119
199 3300048917 Ga0496114_0028491 Ga0496114_0028491_602_1006 119
200 3300049652 Ga0501202_105877 Ga0501202_105877_99_485 119
201 3300049675 Ga0501243_064379 Ga0501243_064379_56_442 119
202 3300049822 Ga0501035_0706322 Ga0501035_0706322_177_551 119
203 3300053096 Ga0500641_0001847 Ga0500641_0001847_6656_7027 119
204 3300003316 rootH1_10198596 rootH1_101985962 120
205 3300003320 rootH2_10182324 rootH2_101823242 120
206 3300003322 rootL2_10044949 rootL2_1004494915 120
207 3300005290 Ga0065712_10021797 Ga0065712_100217974 120
208 3300005293 Ga0065715_10614083 Ga0065715_106140832 120
209 3300005331 Ga0070670_100361356 Ga0070670_1003613562 120
210 3300005331 Ga0070670_100474056 Ga0070670_1004740562 120
211 3300005354 Ga0070675_100028173 Ga0070675_1000281738 120
212 3300005354 Ga0070675_100049324 Ga0070675_1000493242 120
213 3300005364 Ga0070673_100211811 Ga0070673_1002118112 120
214 3300005840 Ga0068870_11207905 Ga0068870_112079051 120
215 3300006881 Ga0068865_101105628 Ga0068865_1011056282 120
216 3300009147 Ga0114129_11288014 Ga0114129_112880142 120
217 3300010375 Ga0105239_10016636 Ga0105239_100166366 120
218 3300014326 Ga0157380_10168153 Ga0157380_101681532 120
219 3300025893 Ga0207682_10003675 Ga0207682_100036759 120
220 3300025908 Ga0207643_10439722 Ga0207643_104397221 120
221 3300025925 Ga0207650_10279229 Ga0207650_102792292 120
222 3300025940 Ga0207691_10084490 Ga0207691_100844902 120
223 3300025960 Ga0207651_10212999 Ga0207651_102129993 120
224 3300026089 Ga0207648_11156809 Ga0207648_111568091 120
225 3300026118 Ga0207675_100248088 Ga0207675_1002480882 120
226 3300028380 Ga0268265_10196670 Ga0268265_101966702 120
227 3300031507 Ga0307509_10267871 Ga0307509_102678712 120
228 3300041512 Ga0451853_0839736 Ga0451853_0839736_575_958 120
229 3300042876 Ga0451577_0000022 Ga0451577_0000022_317214_317603 120
230 3300044673 Ga0453683_0000991 Ga0453683_0000991_24514_24903 120
231 3300044712 Ga0453684_0000501 Ga0453684_0000501_70594_70983 120
232 3300044712 Ga0453684_0025002 Ga0453684_0025002_5583_5984 120
233 3300044712 Ga0453684_1242580 Ga0453684_1242580_83_460 120
234 3300045051 Ga0451576_0000044 Ga0451576_0000044_214618_215007 120
235 3300048929 Ga0496126_0124874 Ga0496126_0124874_280_678 120
236 3300049572 Ga0501036_1348029 Ga0501036_1348029_180_548 120
237 3300049574 Ga0501038_0359026 Ga0501038_0359026_428_796 120
238 3300049590 Ga0501074_0365738 Ga0501074_0365738_573_941 120
239 3300049591 Ga0501075_0111781 Ga0501075_0111781_197_565 120
240 3300049741 Ga0501079_0048768 Ga0501079_0048768_2719_3087 120
241 3300049742 Ga0501080_0169787 Ga0501080_0169787_1274_1642 120
242 3300049743 Ga0501081_0078647 Ga0501081_0078647_456_824 120
243 3300049824 Ga0501045_0457492 Ga0501045_0457492_359_727 120
244 3300050507 nmdc:mga05p37_1334506_c1 nmdc:mga05p37_1334506_c1_167_613 120
245 3300054114 Ga0501084_0612894 Ga0501084_0612894_96_464 120
246 3300061734 Ga0530510_0317592 Ga0530510_0317592_717_1085 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

34

125

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.9301 8 116
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.8857 8 113
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.8424 8 116
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7967 8 113
5zlc-assembly1.cif.gz_A binary complex of human dna polymerase mu with mndgtp 0.682 18 40
ID Description Score Start End Superfamily
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.912 8 113 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8513 8 113 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6645 20 117 3.90.1150.30
af_Q2EEQ2_1_41_2.20.28.120 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.6591 29 51 2.20.28.120
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.651 11 115 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A069DHP1-F1-model_v4 YdhG-like domain-containing protein 0.9909 8 117
AF-A0A838FBP9-F1-model_v4 DUF1801 domain-containing protein 0.9898 27 117
AF-A0A1F8U139-F1-model_v4 YdhG-like domain-containing protein 0.9896 5 78
AF-A0A2S0JY42-F1-model_v4 Uncharacterized conserved protein 0.9889 2 117
AF-A0A2N0BGF6-F1-model_v4 deleted 0.9888 5 117

Feature Viewer

pLDDT pTM Quality
94.12 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map