F358157

General Info

Members Datasets Scaffolds Average Seq Length
246 189 493 250

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10083799|Ga0157370_100837994
Length 279
Sequence VLASIAVLSDIHGVLPALEAVLAEPDVQAAERIVLTGDLAAGPQPVQVLDRLVSLSDKAIWVRGNADRELVTLARGGDTEIPDPIVPWAAARLRPDQVELLAGLPHPVTVPVRGFGDVLCCHGTPRSDEEVVLVDTRLSRWQEALDGAPGTVVCGHTHMPFVRLVDRRLVINPGSVGMPYGSIGAHWALLSGGAVQLRRSEYDISAACASIRQSSGYPDVDEWTDYYLNARGSDVEALAVFGPRDGRVVGLPESKGKGAATRSCVLAAVASLTRVGLFR

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
163 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 2501939600 Micromonospora sp. L5 Isolate Unclassified
166 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
167 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
168 2643221647 Streptomyces sp. Root369 Isolate Unclassified
169 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
170 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
171 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
172 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
173 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
174 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
175 2862574272 Streptomyces sp. AcE210 Isolate Nodule
176 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
177 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
178 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
179 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
180 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
181 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
182 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
183 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
184 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
185 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
186 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
187 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
188 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
189 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.84
Metatranscriptomes 0
Isolates 10.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 0.81
Rhizoplane 1.63
Rhizosphere 71.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10083799 3300013104 Bacteria 2997
2 JGI24740J21852_10009531 3300001979 Bacteria 3796
3 JGI24739J22299_10008615 3300001989 Bacteria 3805
4 JGI24737J22298_10007162 3300001990 Bacteria 3775
5 JGI25151J46595_10000576 3300003187 Bacteria 32699
6 rootH1_10009091 3300003316 Bacteria 7308
7 rootH1_10009091 3300003323 Bacteria 4205
8 rootH2_10016530 3300003320 Bacteria 7879
9 rootL2_10077784 3300003322 Bacteria 3099
10 rootH1_10008744 3300003323 Bacteria 14904
11 rootH1_10016318 3300003323 Bacteria 3121
12 rootH1_10037041 3300003323 Bacteria 1466
13 Ga0070658_10028148 3300005327 Bacteria 4510
14 Ga0070676_10064527 3300005328 Bacteria 2184
15 Ga0070683_100003844 3300005329 Bacteria 12271
16 Ga0070683_100126875 3300005329 Bacteria 2412
17 Ga0068869_100005864 3300005334 Bacteria 7757
18 Ga0068868_100093621 3300005338 Bacteria 2423
19 Ga0070660_100113999 3300005339 Bacteria 2153
20 Ga0070661_100010198 3300005344 Bacteria 6526
21 Ga0070692_10009172 3300005345 Bacteria 4449
22 Ga0070668_100008076 3300005347 Bacteria 7815
23 Ga0070675_100043500 3300005354 Bacteria 3670
24 Ga0070700_100015424 3300005441 Bacteria 4332
25 Ga0070700_100414105 3300005441 Bacteria 1017
26 Ga0070663_100001758 3300005455 Bacteria 12054
27 Ga0070663_100015894 3300005455 Bacteria 4872
28 Ga0070678_100118051 3300005456 Bacteria 2087
29 Ga0070681_10004588 3300005458 Bacteria 13187
30 Ga0070681_10278053 3300005458 Bacteria 1585
31 Ga0070679_100010951 3300005530 Bacteria 8619
32 Ga0070684_100091152 3300005535 Bacteria 2711
33 Ga0070684_100185622 3300005535 Bacteria 1891
34 Ga0070664_100002472 3300005564 Bacteria 14886
35 Ga0070664_100091640 3300005564 Bacteria 2631
36 Ga0068857_100102488 3300005577 Bacteria 2569
37 Ga0070702_100025065 3300005615 Bacteria 3191
38 Ga0068852_100115138 3300005616 Bacteria 2451
39 Ga0068858_100048761 3300005842 Bacteria 3923
40 Ga0068862_100030054 3300005844 Bacteria 4578
41 Ga0081455_10038617 3300005937 Bacteria 4227
42 Ga0081540_1059058 3300005983 Bacteria 1844
43 Ga0070717_10780230 3300006028 Bacteria 869
44 Ga0075368_10000779 3300006042 Bacteria 9797
45 Ga0075363_100004344 3300006048 Bacteria 6181
46 Ga0075363_100081040 3300006048 Bacteria 1775
47 Ga0075364_10120689 3300006051 Bacteria 1754
48 Ga0070715_10028058 3300006163 Bacteria 2254
49 Ga0075367_10006224 3300006178 Bacteria 6013
50 Ga0075367_10008740 3300006178 Bacteria 5262
51 Ga0075370_10031944 3300006353 Bacteria 2940
52 Ga0075370_10063005 3300006353 Bacteria 2113
53 Ga0075428_100025494 3300006844 Bacteria 6545
54 Ga0075428_100240224 3300006844 Bacteria 1954
55 Ga0075430_100014646 3300006846 Bacteria 6680
56 Ga0075431_100046975 3300006847 Bacteria 4451
57 Ga0075431_100074938 3300006847 Bacteria 3492
58 Ga0075429_100021489 3300006880 Bacteria 5594
59 Ga0111539_10023578 3300009094 Bacteria 7562
60 Ga0105245_10007613 3300009098 Bacteria 9483
61 Ga0105245_10028548 3300009098 Bacteria 4923
62 Ga0114129_10000436 3300009147 Bacteria 49537
63 Ga0114129_10454886 3300009147 Bacteria 1678
64 Ga0105238_10064386 3300009551 Bacteria 3666
65 Ga0105249_10135841 3300009553 Bacteria 2353
66 Ga0105249_10224880 3300009553 Bacteria 1848
67 Ga0105249_10990919 3300009553 Bacteria 909
68 Ga0105239_10129236 3300010375 Bacteria 2809
69 Ga0105239_10181840 3300010375 Bacteria 2352
70 Ga0105246_10129095 3300011119 Bacteria 1885
71 Ga0163162_10492302 3300013306 Bacteria 1357
72 Ga0157372_10000117 3300013307 Bacteria 84418
73 Ga0157372_10270263 3300013307 Bacteria 1975
74 Ga0182008_10182685 3300014497 Bacteria 1062
75 Ga0157377_10012611 3300014745 Bacteria 4254
76 Ga0209130_1000585 3300025284 Bacteria 35465
77 Ga0209025_1001338 3300025294 Bacteria 33237
78 Ga0209025_1081020 3300025294 Bacteria 1102
79 Ga0209758_1010348 3300025297 Bacteria 5597
80 Ga0207426_1000487 3300025302 Bacteria 59943
81 Ga0207688_10084020 3300025901 Bacteria 1822
82 Ga0207647_10007017 3300025904 Bacteria 8170
83 Ga0207643_10099349 3300025908 Bacteria 1705
84 Ga0207707_10016660 3300025912 Bacteria 6406
85 Ga0207707_10238306 3300025912 Bacteria 1582
86 Ga0207649_10084295 3300025920 Bacteria 2066
87 Ga0207652_10002418 3300025921 Bacteria 15755
88 Ga0207681_10064890 3300025923 Bacteria 2523
89 Ga0207694_10048477 3300025924 Bacteria 3287
90 Ga0207659_10092767 3300025926 Bacteria 2258
91 Ga0207687_10034516 3300025927 Bacteria 3435
92 Ga0207690_10046876 3300025932 Bacteria 2865
93 Ga0207689_10014760 3300025942 Bacteria 6633
94 Ga0207661_10099209 3300025944 Bacteria 2442
95 Ga0207661_10729837 3300025944 Bacteria 911
96 Ga0207679_10073031 3300025945 Bacteria 2594
97 Ga0207667_10676675 3300025949 Bacteria 1036
98 Ga0207668_10020550 3300025972 Bacteria 4197
99 Ga0207668_10247778 3300025972 Bacteria 1445
100 Ga0207677_10216419 3300026023 Bacteria 1533
101 Ga0207703_10031394 3300026035 Bacteria 4200
102 Ga0207678_10005426 3300026067 Bacteria 11418
103 Ga0207678_10006845 3300026067 Bacteria 10111
104 Ga0207708_10011385 3300026075 Bacteria 6626
105 Ga0207676_10076947 3300026095 Bacteria 2698
106 Ga0207674_10029696 3300026116 Bacteria 5754
107 Ga0207674_10129998 3300026116 Bacteria 2482
108 Ga0207698_10190987 3300026142 Bacteria 1824
109 Ga0207698_10483597 3300026142 Bacteria 1201
110 Ga0209813_10005458 3300027866 Bacteria 3087
111 Ga0207428_10039988 3300027907 Bacteria 3806
112 Ga0268265_10080279 3300028380 Bacteria 2572
113 Ga0307515_10000732 3300028794 Bacteria 75720
114 Ga0307515_10074490 3300028794 Bacteria 4540
115 Ga0307515_10147815 3300028794 Bacteria 2477
116 Ga0307515_10245127 3300028794 Bacteria 1555
117 Ga0307515_10322794 3300028794 Bacteria 1209
118 Ga0307515_10474652 3300028794 Bacteria 864
119 Ga0307511_10011179 3300030521 Bacteria 8856
120 Ga0307513_10005466 3300031456 Bacteria 16788
121 Ga0307513_10012266 3300031456 Bacteria 10593
122 Ga0307509_10008482 3300031507 Bacteria 13086
123 Ga0307509_10020620 3300031507 Bacteria 7474
124 Ga0307509_10034779 3300031507 Bacteria 5535
125 Ga0307405_10363123 3300031731 Bacteria 1121
126 Ga0307413_10048312 3300031824 Bacteria 2543
127 Ga0307518_10010928 3300031838 Bacteria 6488
128 Ga0307518_10102044 3300031838 Bacteria 2053
129 Ga0307410_10034891 3300031852 Bacteria 3262
130 Ga0307410_10394906 3300031852 Bacteria 1116
131 Ga0307406_10223896 3300031901 Bacteria 1400
132 Ga0307409_100112612 3300031995 Bacteria 2285
133 Ga0307409_100321866 3300031995 Bacteria 1447
134 Ga0307416_100392561 3300032002 Bacteria 1422
135 Ga0307415_100088840 3300032126 Bacteria 2231
136 Ga0307415_100407171 3300032126 Bacteria 1163
137 Ga0307507_10005078 3300033179 Bacteria 22158
138 Ga0307507_10104537 3300033179 Bacteria 2349
139 Ga0307510_10013098 3300033180 Bacteria 9837
140 Ga0307510_10019543 3300033180 Bacteria 7943
141 Ga0395898_0030835 3300037466 Bacteria 5363
142 Ga0395898_0157081 3300037466 Bacteria 2175
143 Ga0395898_0403630 3300037466 Bacteria 1303
144 Ga0395905_0297549 3300037471 Bacteria 1501
145 Ga0395901_0033370 3300038443 Bacteria 5314
146 Ga0439439_0003304 3300041406 Bacteria 3549
147 Ga0451853_0403237 3300041512 Bacteria 1936
148 Ga0439449_0018903 3300042007 Bacteria 2583
149 Ga0439457_000779 3300042014 Bacteria 9487
150 Ga0466970_0130184 3300044765 Bacteria 1382
151 Ga0466970_0233759 3300044765 Bacteria 1028
152 Ga0466958_0044800 3300045836 Bacteria 2667
153 Ga0466967_0517644 3300045976 Bacteria 1172
154 Ga0495592_0004006 3300046454 Bacteria 10689
155 Ga0495629_0022961 3300046459 Bacteria 4446
156 Ga0495629_0080843 3300046459 Bacteria 2268
157 Ga0495651_0041081 3300046462 Bacteria 3593
158 Ga0495653_0072071 3300046463 Bacteria 2581
159 Ga0495582_0046948 3300046473 Bacteria 2378
160 Ga0495662_0008640 3300046476 Bacteria 5006
161 Ga0495664_0002039 3300046477 Bacteria 10801
162 Ga0495610_0178956 3300046512 Bacteria 883
163 Ga0495618_0088322 3300046514 Bacteria 1982
164 Ga0495628_0126768 3300046516 Bacteria 1955
165 Ga0495630_0155508 3300046517 Bacteria 1740
166 Ga0495652_0198298 3300046529 Bacteria 1526
167 Ga0495640_0134147 3300046533 Bacteria 1600
168 Ga0495586_0087159 3300046535 Bacteria 1721
169 Ga0495587_0018624 3300046536 Bacteria 4304
170 Ga0495645_0021554 3300046543 Bacteria 4656
171 Ga0495634_0029173 3300046642 Bacteria 3820
172 Ga0495625_0004127 3300046660 Bacteria 13860
173 Ga0495635_0003071 3300046663 Bacteria 11487
174 Ga0495657_0002272 3300046675 Bacteria 16229
175 Ga0495646_0002800 3300046680 Bacteria 10787
176 Ga0495613_0010210 3300046689 Bacteria 6976
177 Ga0495671_0051793 3300046692 Bacteria 2041
178 Ga0495600_0058558 3300046809 Bacteria 2516
179 Ga0495581_0005860 3300047315 Bacteria 7123
180 Ga0495604_0009852 3300047317 Bacteria 7561
181 Ga0495604_0021619 3300047317 Bacteria 5137
182 Ga0495674_0067797 3300047319 Bacteria 3090
183 Ga0495676_0014321 3300047321 Bacteria 7098
184 Ga0495687_006006 3300047443 Bacteria 7568
185 Ga0495675_0042169 3300047444 Bacteria 2907
186 Ga0495685_023235 3300047447 Bacteria 2134
187 Ga0495681_0001110 3300047470 Bacteria 20415
188 Ga0495684_0203622 3300047471 Bacteria 1458
189 Ga0495593_0000443 3300047673 Bacteria 23177
190 Ga0495614_0004176 3300048089 Bacteria 6506
191 Ga0495614_0029463 3300048089 Bacteria 2362
192 Ga0496109_0130492 3300048912 Bacteria 2345
193 Ga0496109_0476026 3300048912 Bacteria 1179
194 Ga0496113_0009162 3300048916 Bacteria 6488
195 Ga0496113_0361326 3300048916 Bacteria 1165
196 Ga0501040_0193716 3300049576 Bacteria 1443
197 Ga0501040_0234897 3300049576 Bacteria 1306
198 Ga0501047_0135600 3300049581 Bacteria 2342
199 Ga0501044_0501456 3300049823 Bacteria 1115
200 nmdc:mga03n38_47769_c1 3300050490 Bacteria 1896
201 nmdc:mga00v17_357873_c1 3300050491 Bacteria 949
202 nmdc:mga0yw44_313011_c1 3300050492 Bacteria 1053
203 nmdc:mga06z11_192394_c1 3300050494 Bacteria 1181
204 nmdc:mga06z11_200614_c1 3300050494 Bacteria 1159
205 nmdc:mga06z11_20659_c1 3300050494 Bacteria 3047
206 nmdc:mga04h51_78165_c1 3300050495 Bacteria 1169
207 nmdc:mga07m45_297198_c1 3300050496 Bacteria 939
208 nmdc:mga05p37_10148_c1 3300050507 Bacteria 11179
209 nmdc:mga05p37_50788_c1 3300050507 Bacteria 4514
210 nmdc:mga09592_111795_c1 3300050508 Bacteria 2344
211 nmdc:mga09592_231950_c1 3300050508 Bacteria 1599
212 nmdc:mga09592_440_c1 3300050508 Bacteria 30651
213 nmdc:mga0qj67_103343_c1 3300050509 Bacteria 2298
214 nmdc:mga0qj67_79_c1 3300050509 Bacteria 39197
215 nmdc:mga06r32_1225_c1 3300050510 Bacteria 23146
216 nmdc:mga06r32_183332_c1 3300050510 Bacteria 2080
217 nmdc:mga06r32_71314_c1 3300050510 Bacteria 3361
218 nmdc:mga08y16_10150_c1 3300050511 Bacteria 9886
219 Ga0495612_0114394 3300053078 Bacteria 1157
220 Ga0500640_096095 3300053095 Bacteria 1232
221 Ga0500624_004195 3300053157 Bacteria 1891
222 Ga0466962_0060498 3300061719 Bacteria 1808
223 2501941878 2501939600 Bacteria 6907073
224 2515852422 2515154155 Bacteria 7985436
225 2623585467 2622736626 Bacteria 7181580
226 2644262287 2643221647 Bacteria 10741251
227 2785369513 2784746768 Bacteria 10036182
228 2795796208 2795385472 Bacteria 6627535
229 2816422884 2816332119 Bacteria 8120218
230 2837275756 2837268691 Bacteria 7850704
231 2858902561 2858902515 Bacteria 7086037
232 2861521973 2861520306 Bacteria 8348283
233 2862582366 2862574272 Bacteria 10567477
234 2866614456 2866612099 Bacteria 7543886
235 2867306282 2867302475 Bacteria 7087181
236 2867317091 2867312974 Bacteria 7058875
237 2867322913 2867319477 Bacteria 7069771
238 2873317568 2873314349 Bacteria 8512634
239 2883826522 2883821847 Bacteria 5121194
240 2917741397 2917736166 Bacteria 9690793
241 8003323973 8003314358 Bacteria 10575343
242 8008488513 8008485437 Bacteria 7198341
243 8025527440 8025524527 Bacteria 7197316
244 8055068062 8055066027 Bacteria 9479577
245 8055177807 8055172936 Bacteria 9305943
246 8055418893 8055412473 Bacteria 6257500
247 8056831685 8056829672 Bacteria 9045328
248 Ga0157370_10083799
249 JGI24740J21852_10009531
250 JGI24739J22299_10008615
251 JGI24737J22298_10007162
252 JGI25151J46595_10000576
253 rootH1_10009091
254 rootH2_10016530
255 rootL2_10077784
256 rootH1_10008744
257 rootH1_10016318
258 rootH1_10037041
259 Ga0070658_10028148
260 Ga0070676_10064527
261 Ga0070683_100003844
262 Ga0070683_100126875
263 Ga0068869_100005864
264 Ga0068868_100093621
265 Ga0070660_100113999
266 Ga0070661_100010198
267 Ga0070692_10009172
268 Ga0070668_100008076
269 Ga0070675_100043500
270 Ga0070700_100015424
271 Ga0070700_100414105
272 Ga0070663_100001758
273 Ga0070663_100015894
274 Ga0070678_100118051
275 Ga0070681_10004588
276 Ga0070681_10278053
277 Ga0070679_100010951
278 Ga0070684_100091152
279 Ga0070684_100185622
280 Ga0070664_100002472
281 Ga0070664_100091640
282 Ga0068857_100102488
283 Ga0070702_100025065
284 Ga0068852_100115138
285 Ga0068858_100048761
286 Ga0068862_100030054
287 Ga0081455_10038617
288 Ga0081540_1059058
289 Ga0070717_10780230
290 Ga0075368_10000779
291 Ga0075363_100004344
292 Ga0075363_100081040
293 Ga0075364_10120689
294 Ga0070715_10028058
295 Ga0075367_10006224
296 Ga0075367_10008740
297 Ga0075370_10031944
298 Ga0075370_10063005
299 Ga0075428_100025494
300 Ga0075428_100240224
301 Ga0075430_100014646
302 Ga0075431_100046975
303 Ga0075431_100074938
304 Ga0075429_100021489
305 Ga0111539_10023578
306 Ga0105245_10007613
307 Ga0105245_10028548
308 Ga0114129_10000436
309 Ga0114129_10454886
310 Ga0105238_10064386
311 Ga0105249_10135841
312 Ga0105249_10224880
313 Ga0105249_10990919
314 Ga0105239_10129236
315 Ga0105239_10181840
316 Ga0105246_10129095
317 Ga0163162_10492302
318 Ga0157372_10000117
319 Ga0157372_10270263
320 Ga0182008_10182685
321 Ga0157377_10012611
322 Ga0209130_1000585
323 Ga0209025_1001338
324 Ga0209025_1081020
325 Ga0209758_1010348
326 Ga0207426_1000487
327 Ga0207688_10084020
328 Ga0207647_10007017
329 Ga0207643_10099349
330 Ga0207707_10016660
331 Ga0207707_10238306
332 Ga0207649_10084295
333 Ga0207652_10002418
334 Ga0207681_10064890
335 Ga0207694_10048477
336 Ga0207659_10092767
337 Ga0207687_10034516
338 Ga0207690_10046876
339 Ga0207689_10014760
340 Ga0207661_10099209
341 Ga0207661_10729837
342 Ga0207679_10073031
343 Ga0207667_10676675
344 Ga0207668_10020550
345 Ga0207668_10247778
346 Ga0207677_10216419
347 Ga0207703_10031394
348 Ga0207678_10005426
349 Ga0207678_10006845
350 Ga0207708_10011385
351 Ga0207676_10076947
352 Ga0207674_10029696
353 Ga0207674_10129998
354 Ga0207698_10190987
355 Ga0207698_10483597
356 Ga0209813_10005458
357 Ga0207428_10039988
358 Ga0268265_10080279
359 Ga0307515_10000732
360 Ga0307515_10074490
361 Ga0307515_10147815
362 Ga0307515_10245127
363 Ga0307515_10322794
364 Ga0307515_10474652
365 Ga0307511_10011179
366 Ga0307513_10005466
367 Ga0307513_10012266
368 Ga0307509_10008482
369 Ga0307509_10020620
370 Ga0307509_10034779
371 Ga0307405_10363123
372 Ga0307413_10048312
373 Ga0307518_10010928
374 Ga0307518_10102044
375 Ga0307410_10034891
376 Ga0307410_10394906
377 Ga0307406_10223896
378 Ga0307409_100112612
379 Ga0307409_100321866
380 Ga0307416_100392561
381 Ga0307415_100088840
382 Ga0307415_100407171
383 Ga0307507_10005078
384 Ga0307507_10104537
385 Ga0307510_10013098
386 Ga0307510_10019543
387 Ga0395898_0030835
388 Ga0395898_0157081
389 Ga0395898_0403630
390 Ga0395905_0297549
391 Ga0395901_0033370
392 Ga0439439_0003304
393 Ga0451853_0403237
394 Ga0439449_0018903
395 Ga0439457_000779
396 Ga0466970_0130184
397 Ga0466970_0233759
398 Ga0466958_0044800
399 Ga0466967_0517644
400 Ga0495592_0004006
401 Ga0495629_0022961
402 Ga0495629_0080843
403 Ga0495651_0041081
404 Ga0495653_0072071
405 Ga0495582_0046948
406 Ga0495662_0008640
407 Ga0495664_0002039
408 Ga0495610_0178956
409 Ga0495618_0088322
410 Ga0495628_0126768
411 Ga0495630_0155508
412 Ga0495652_0198298
413 Ga0495640_0134147
414 Ga0495586_0087159
415 Ga0495587_0018624
416 Ga0495645_0021554
417 Ga0495634_0029173
418 Ga0495625_0004127
419 Ga0495635_0003071
420 Ga0495657_0002272
421 Ga0495646_0002800
422 Ga0495613_0010210
423 Ga0495671_0051793
424 Ga0495600_0058558
425 Ga0495581_0005860
426 Ga0495604_0009852
427 Ga0495604_0021619
428 Ga0495674_0067797
429 Ga0495676_0014321
430 Ga0495687_006006
431 Ga0495675_0042169
432 Ga0495685_023235
433 Ga0495681_0001110
434 Ga0495684_0203622
435 Ga0495593_0000443
436 Ga0495614_0004176
437 Ga0495614_0029463
438 Ga0496109_0130492
439 Ga0496109_0476026
440 Ga0496113_0009162
441 Ga0496113_0361326
442 Ga0501040_0193716
443 Ga0501040_0234897
444 Ga0501047_0135600
445 Ga0501044_0501456
446 nmdc:mga03n38_47769_c1
447 nmdc:mga00v17_357873_c1
448 nmdc:mga0yw44_313011_c1
449 nmdc:mga06z11_192394_c1
450 nmdc:mga06z11_200614_c1
451 nmdc:mga06z11_20659_c1
452 nmdc:mga04h51_78165_c1
453 nmdc:mga07m45_297198_c1
454 nmdc:mga05p37_10148_c1
455 nmdc:mga05p37_50788_c1
456 nmdc:mga09592_111795_c1
457 nmdc:mga09592_231950_c1
458 nmdc:mga09592_440_c1
459 nmdc:mga0qj67_103343_c1
460 nmdc:mga0qj67_79_c1
461 nmdc:mga06r32_1225_c1
462 nmdc:mga06r32_183332_c1
463 nmdc:mga06r32_71314_c1
464 nmdc:mga08y16_10150_c1
465 Ga0495612_0114394
466 Ga0500640_096095
467 Ga0500624_004195
468 Ga0466962_0060498
469 2501941878
470 2515852422
471 2623585467
472 2644262287
473 2785369513
474 2795796208
475 2816422884
476 2837275756
477 2858902561
478 2861521973
479 2862582366
480 2866614456
481 2867306282
482 2867317091
483 2867322913
484 2873317568
485 2883826522
486 2917741397
487 8003323973
488 8008488513
489 8025527440
490 8055068062
491 8055177807
492 8055418893
493 8056831685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

4

192

0.86

PF00149

Metallophos

Calcineurin-like phosphoesterase

3

181

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.8403 1 222
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8362 3 225
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.825 1 226
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.7988 2 225
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.795 3 227
ID Description Score Start End Superfamily
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8389 1 226 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.825 1 226 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7852 4 227 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7766 1 226 3.60.21.10
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7744 4 227 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7G6X293-F1-model_v4 Metallophosphoesterase family protein 0.9963 3 245 GO:0005737
GO:0016791
AF-A0A4R2GUC2-F1-model_v4 Putative phosphodiesterase 0.9942 22 245 GO:0005737
GO:0016791
AF-A0A7G6X293-F1-model_v4 Metallophosphoesterase family protein 0.9882 3 245 GO:0005737
GO:0016791
AF-A0A4R4P795-F1-model_v4 Metallophosphoesterase 0.9879 1 98 GO:0005737
GO:0016791
AF-A0A4R2GUC2-F1-model_v4 Putative phosphodiesterase 0.9855 22 245 GO:0005737
GO:0016791

Map